# PaCkAgE DaTaStReAm STATsrv 1 8123 # end of header 0707010000771e000081a40000000000000000000000014bbc938300000116000000200000001d00000000000000000000001000000000STATsrv/pkginfoPKG=STATsrv NAME=dim_STAT v.8+: Solaris8+/SPARC STAT-service VERSION=8.5 ARCH=sparc VENDOR=by Dimitri KRAVTCHUK, Paris Sun Benchmark Center, FRANCE. HOTLINE=:-) EMAIL=dimitri.kravtchuk@france.sun.com CATEGORY=system ISTATES=2 3 RSTATES=2 3 PSTAMP=dim_STAT v.8+ CLASSES=dim_STAT 0707010000771b000081a40000000000000000000000014bbc938300001f92000000200000001d00000000000000000000000f00000000STATsrv/pkgmap: 1 8123 1 d dim_STAT /etc/STATsrv 0755 root root 1 f dim_STAT /etc/STATsrv/STAT-service 0775 root root 1037 2617 1244647507 1 f dim_STAT /etc/STATsrv/VERSION 0664 root root 19 1508 1265014623 1 f dim_STAT /etc/STATsrv/access 0664 root root 4934 29930 1270649720 1 d dim_STAT /etc/STATsrv/bin 0755 root root 1 f dim_STAT /etc/STATsrv/bin/CPUSet.sh 0755 root root 57 4367 1237457743 1 f dim_STAT /etc/STATsrv/bin/EasySTAT.sh 0775 root root 1976 8185 1264416167 1 f dim_STAT /etc/STATsrv/bin/ForkExec.sh 0775 root root 65 4707 1241375961 1 f dim_STAT /etc/STATsrv/bin/IObench_STAT.sh 0755 root root 66 5078 1241375973 1 f dim_STAT /etc/STATsrv/bin/IObench_v4 0755 root root 71040 19608 1202376605 1 f dim_STAT /etc/STATsrv/bin/IObstat 0755 root root 27480 56693 1202376639 1 f dim_STAT /etc/STATsrv/bin/IOpatt.sh 0755 root root 142 12055 1241375985 1 f dim_STAT /etc/STATsrv/bin/MemStat.sh 0775 root root 57 4485 1241375992 1 f dim_STAT /etc/STATsrv/bin/PoolLOAD.sh 0775 root root 169 14504 1241376041 1 f dim_STAT /etc/STATsrv/bin/ProcLOAD.sh 0775 root root 380 32637 1241376053 1 f dim_STAT /etc/STATsrv/bin/ProjLOAD.sh 0775 root root 169 14503 1241376062 1 f dim_STAT /etc/STATsrv/bin/STATcmd 0775 root root 30156 40445 1163543608 1 f dim_STAT /etc/STATsrv/bin/STATsrv 0775 root root 16736 7824 1268303547 1 f dim_STAT /etc/STATsrv/bin/Siostat.sh 0755 root root 58 4592 1241376072 1 f dim_STAT /etc/STATsrv/bin/T3stat 0755 root root 96136 47162 1008455958 1 f dim_STAT /etc/STATsrv/bin/T3stat.sh 0755 root root 711 56203 1241376084 1 f dim_STAT /etc/STATsrv/bin/TaskLOAD.sh 0775 root root 169 14505 1241376092 1 f dim_STAT /etc/STATsrv/bin/Timer.sh 0755 root root 113 9257 1244717591 1 f dim_STAT /etc/STATsrv/bin/UDPstat.sh 0755 root root 116 9453 1270448453 1 f dim_STAT /etc/STATsrv/bin/UserLOAD.sh 0775 root root 378 32495 1241376101 1 f dim_STAT /etc/STATsrv/bin/WebX 0755 root root 279632 43725 1268763323 1 f dim_STAT /etc/STATsrv/bin/WebX.mySQL 0755 root root 348376 38379 1268763444 1 f dim_STAT /etc/STATsrv/bin/WebX.mySQL5 0755 root root 724612 64661 1268763451 1 f dim_STAT /etc/STATsrv/bin/WebX.pgSQL 0755 root root 383240 59972 1268763456 1 f dim_STAT /etc/STATsrv/bin/ZoneLOAD.sh 0775 root root 169 14520 1241376115 1 f dim_STAT /etc/STATsrv/bin/bsdlink 0755 root root 65 5603 961167827 1 f dim_STAT /etc/STATsrv/bin/bsdlink.pl 0755 root root 2194 22067 898249204 1 f dim_STAT /etc/STATsrv/bin/bsdlink.sh 0755 root root 84 7037 1241376124 1 f dim_STAT /etc/STATsrv/bin/chldPID.sh 0755 root root 112 8886 1241376136 1 f dim_STAT /etc/STATsrv/bin/cpuinfo 0755 root root 10764 2062 1202396018 1 f dim_STAT /etc/STATsrv/bin/dbSTRESS_STAT.sh 0755 root root 71 5244 1241376149 1 f dim_STAT /etc/STATsrv/bin/dbsSTAT 0755 root root 29176 44730 1202376678 1 f dim_STAT /etc/STATsrv/bin/grepX 0755 root root 25096 21230 1070617717 1 f dim_STAT /etc/STATsrv/bin/har 0755 root root 84008 45401 1015854117 1 f dim_STAT /etc/STATsrv/bin/har2 0755 root root 261408 41844 1244637684 1 f dim_STAT /etc/STATsrv/bin/harSTAT.sh 0755 root root 148 11908 1241376167 1 f dim_STAT /etc/STATsrv/bin/harSTATus3.sh 0755 root root 151 12191 1241376180 1 f dim_STAT /etc/STATsrv/bin/harSTATv2.sh 0755 root root 118 9652 1244640932 1 f dim_STAT /etc/STATsrv/bin/innodbIOSTAT.sh 0755 root root 396 27868 1251213391 1 f dim_STAT /etc/STATsrv/bin/innodbSTAT.sh 0755 root root 558 42245 1268909287 1 f dim_STAT /etc/STATsrv/bin/ioSTAT 0755 root root 41788 15714 924267150 1 f dim_STAT /etc/STATsrv/bin/ioSTAT.25 0755 root root 41788 15714 950020046 1 f dim_STAT /etc/STATsrv/bin/ioSTAT.7 0755 root root 66364 41196 950020046 1 f dim_STAT /etc/STATsrv/bin/ioSTAT.sh 0755 root root 360 26111 1241376196 1 f dim_STAT /etc/STATsrv/bin/iopattern 0755 root root 6822 50873 1201628322 1 f dim_STAT /etc/STATsrv/bin/jvmGC.sh 0755 root root 741 58828 1241376232 1 f dim_STAT /etc/STATsrv/bin/jvmSTAT.sh 0755 root root 1027 2395 1169199261 1 f dim_STAT /etc/STATsrv/bin/mysqlLOAD.sh 0755 root root 560 42455 1251213300 1 f dim_STAT /etc/STATsrv/bin/mysqlSTAT.sh 0755 root root 555 42067 1251213331 1 f dim_STAT /etc/STATsrv/bin/netLOAD 0775 root root 64520 57815 1163543461 1 f dim_STAT /etc/STATsrv/bin/netLOAD.sh 0775 root root 63 4920 1241376254 1 f dim_STAT /etc/STATsrv/bin/oraENQ.sh 0755 root root 131 10781 1241376262 1 f dim_STAT /etc/STATsrv/bin/oraENQ.sql 0644 root root 79 7105 1171701903 1 f dim_STAT /etc/STATsrv/bin/oraEXEC.sh 0755 root root 132 10846 1241376271 1 f dim_STAT /etc/STATsrv/bin/oraIO.sh 0755 root root 130 10705 1241376283 1 f dim_STAT /etc/STATsrv/bin/oraLATCH.sh 0755 root root 133 10917 1241376291 1 f dim_STAT /etc/STATsrv/bin/oraSLEEP.sh 0755 root root 133 10930 1241376298 1 f dim_STAT /etc/STATsrv/bin/oraexec.sql 0644 root root 135 12010 1036600598 1 f dim_STAT /etc/STATsrv/bin/oraio.sql 0644 root root 331 26568 1036600597 1 f dim_STAT /etc/STATsrv/bin/oralatch.sql 0644 root root 135 12631 1036600598 1 f dim_STAT /etc/STATsrv/bin/oravlatch.sql 0644 root root 147 12719 1052836700 1 f dim_STAT /etc/STATsrv/bin/perl 0755 root root 647736 37297 908548063 1 f dim_STAT /etc/STATsrv/bin/pgsqlLOAD.sh 0755 root root 568 43053 1251213626 1 f dim_STAT /etc/STATsrv/bin/pgsqlSTAT.sh 0755 root root 563 42761 1251213641 1 f dim_STAT /etc/STATsrv/bin/psSTAT 0755 root root 53236 6846 1097692289 1 f dim_STAT /etc/STATsrv/bin/psSTAT.sh 0755 root root 169 13273 1241376307 1 f dim_STAT /etc/STATsrv/bin/psSTAT64 0755 root root 74520 15844 1097507278 1 f dim_STAT /etc/STATsrv/bin/psSTAT64_10 0755 root root 115264 32097 1244652377 1 f dim_STAT /etc/STATsrv/bin/psSTAT_std.sh 0755 root root 238 22140 1244822825 1 f dim_STAT /etc/STATsrv/bin/sysinfo.sh 0755 root root 1410 45196 1241376326 1 f dim_STAT /etc/STATsrv/bin/sysv 0755 root root 45368 21175 1018250253 1 f dim_STAT /etc/STATsrv/bin/tailX 0755 root root 25644 53603 1070617710 1 f dim_STAT /etc/STATsrv/bin/tst64 0755 root root 9328 65041 970427414 1 f dim_STAT /etc/STATsrv/bin/x.EasySTAT 0644 root root 9434 2710 1264621702 1 f dim_STAT /etc/STATsrv/bin/x.SysINFO 0644 root root 1338 33656 1011218459 1 f dim_STAT /etc/STATsrv/bin/x.T3stat 0644 root root 1558 43670 993416764 1 f dim_STAT /etc/STATsrv/bin/x.Timer 0644 root root 862 61789 1244755777 1 f dim_STAT /etc/STATsrv/bin/x.UDPstat 0644 root root 1868 63031 1270448454 1 f dim_STAT /etc/STATsrv/bin/x.chldPID 0644 root root 474 33495 1214579475 1 f dim_STAT /etc/STATsrv/bin/x.harSTAT 0644 root root 1186 13426 984071988 1 f dim_STAT /etc/STATsrv/bin/x.harSTATus3 0644 root root 1370 26986 988646815 1 f dim_STAT /etc/STATsrv/bin/x.harSTATv2 0644 root root 1381 27939 1244637649 1 f dim_STAT /etc/STATsrv/bin/x.innodbIOSTAT 0644 root root 3680 1770 1244630708 1 f dim_STAT /etc/STATsrv/bin/x.innodbSTAT 0644 root root 14965 50055 1269548637 1 f dim_STAT /etc/STATsrv/bin/x.jvmGC 0644 root root 2419 34390 1069357708 1 f dim_STAT /etc/STATsrv/bin/x.jvmSTAT 0644 root root 3203 15185 1147374083 1 f dim_STAT /etc/STATsrv/bin/x.killSTAT 0644 root root 930 740 1112881713 1 f dim_STAT /etc/STATsrv/bin/x.mysqlLOAD 0644 root root 4445 12801 1251453167 1 f dim_STAT /etc/STATsrv/bin/x.mysqlSTAT 0644 root root 4114 43538 1251453028 1 f dim_STAT /etc/STATsrv/bin/x.oraENQ 0644 root root 1626 47285 1215105106 1 f dim_STAT /etc/STATsrv/bin/x.oraEXEC 0644 root root 1901 2520 1215105066 1 f dim_STAT /etc/STATsrv/bin/x.oraIO 0644 root root 2355 31187 1215105190 1 f dim_STAT /etc/STATsrv/bin/x.oraLATCH 0644 root root 1603 47224 1215105205 1 f dim_STAT /etc/STATsrv/bin/x.oraSLEEP 0644 root root 2043 11565 1215105249 1 f dim_STAT /etc/STATsrv/bin/x.pgsqlLOAD 0644 root root 3544 8267 1251195691 1 f dim_STAT /etc/STATsrv/bin/x.pgsqlSTAT 0644 root root 3359 55322 1241588116 1 d dim_STAT /etc/STATsrv/log 0755 root root 1 f dim_STAT /etc/STATsrv/log/access.log 0644 root root 0 0 964026305 1 s dim_STAT /etc/rc0.d/K10stat-srv=/etc/STATsrv/STAT-service 1 s dim_STAT /etc/rc1.d/K10stat-srv=/etc/STATsrv/STAT-service 1 s dim_STAT /etc/rc2.d/S99stat-srv=/etc/STATsrv/STAT-service 1 s dim_STAT /etc/rcS.d/K10stat-srv=/etc/STATsrv/STAT-service 1 i pkginfo 278 21924 1270649731 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010000771e000081a40000000000000000000000014bbc938300000116000000200000001d00000000000000000000000800000000pkginfoPKG=STATsrv NAME=dim_STAT v.8+: Solaris8+/SPARC STAT-service VERSION=8.5 ARCH=sparc VENDOR=by Dimitri KRAVTCHUK, Paris Sun Benchmark Center, FRANCE. HOTLINE=:-) EMAIL=dimitri.kravtchuk@france.sun.com CATEGORY=system ISTATES=2 3 RSTATES=2 3 PSTAMP=dim_STAT v.8+ CLASSES=dim_STAT 0707010000771b000081a40000000000000000000000014bbc938300001f92000000200000001d00000000000000000000000700000000pkgmap: 1 8123 1 d dim_STAT /etc/STATsrv 0755 root root 1 f dim_STAT /etc/STATsrv/STAT-service 0775 root root 1037 2617 1244647507 1 f dim_STAT /etc/STATsrv/VERSION 0664 root root 19 1508 1265014623 1 f dim_STAT /etc/STATsrv/access 0664 root root 4934 29930 1270649720 1 d dim_STAT /etc/STATsrv/bin 0755 root root 1 f dim_STAT /etc/STATsrv/bin/CPUSet.sh 0755 root root 57 4367 1237457743 1 f dim_STAT /etc/STATsrv/bin/EasySTAT.sh 0775 root root 1976 8185 1264416167 1 f dim_STAT /etc/STATsrv/bin/ForkExec.sh 0775 root root 65 4707 1241375961 1 f dim_STAT /etc/STATsrv/bin/IObench_STAT.sh 0755 root root 66 5078 1241375973 1 f dim_STAT /etc/STATsrv/bin/IObench_v4 0755 root root 71040 19608 1202376605 1 f dim_STAT /etc/STATsrv/bin/IObstat 0755 root root 27480 56693 1202376639 1 f dim_STAT /etc/STATsrv/bin/IOpatt.sh 0755 root root 142 12055 1241375985 1 f dim_STAT /etc/STATsrv/bin/MemStat.sh 0775 root root 57 4485 1241375992 1 f dim_STAT /etc/STATsrv/bin/PoolLOAD.sh 0775 root root 169 14504 1241376041 1 f dim_STAT /etc/STATsrv/bin/ProcLOAD.sh 0775 root root 380 32637 1241376053 1 f dim_STAT /etc/STATsrv/bin/ProjLOAD.sh 0775 root root 169 14503 1241376062 1 f dim_STAT /etc/STATsrv/bin/STATcmd 0775 root root 30156 40445 1163543608 1 f dim_STAT /etc/STATsrv/bin/STATsrv 0775 root root 16736 7824 1268303547 1 f dim_STAT /etc/STATsrv/bin/Siostat.sh 0755 root root 58 4592 1241376072 1 f dim_STAT /etc/STATsrv/bin/T3stat 0755 root root 96136 47162 1008455958 1 f dim_STAT /etc/STATsrv/bin/T3stat.sh 0755 root root 711 56203 1241376084 1 f dim_STAT /etc/STATsrv/bin/TaskLOAD.sh 0775 root root 169 14505 1241376092 1 f dim_STAT /etc/STATsrv/bin/Timer.sh 0755 root root 113 9257 1244717591 1 f dim_STAT /etc/STATsrv/bin/UDPstat.sh 0755 root root 116 9453 1270448453 1 f dim_STAT /etc/STATsrv/bin/UserLOAD.sh 0775 root root 378 32495 1241376101 1 f dim_STAT /etc/STATsrv/bin/WebX 0755 root root 279632 43725 1268763323 1 f dim_STAT /etc/STATsrv/bin/WebX.mySQL 0755 root root 348376 38379 1268763444 1 f dim_STAT /etc/STATsrv/bin/WebX.mySQL5 0755 root root 724612 64661 1268763451 1 f dim_STAT /etc/STATsrv/bin/WebX.pgSQL 0755 root root 383240 59972 1268763456 1 f dim_STAT /etc/STATsrv/bin/ZoneLOAD.sh 0775 root root 169 14520 1241376115 1 f dim_STAT /etc/STATsrv/bin/bsdlink 0755 root root 65 5603 961167827 1 f dim_STAT /etc/STATsrv/bin/bsdlink.pl 0755 root root 2194 22067 898249204 1 f dim_STAT /etc/STATsrv/bin/bsdlink.sh 0755 root root 84 7037 1241376124 1 f dim_STAT /etc/STATsrv/bin/chldPID.sh 0755 root root 112 8886 1241376136 1 f dim_STAT /etc/STATsrv/bin/cpuinfo 0755 root root 10764 2062 1202396018 1 f dim_STAT /etc/STATsrv/bin/dbSTRESS_STAT.sh 0755 root root 71 5244 1241376149 1 f dim_STAT /etc/STATsrv/bin/dbsSTAT 0755 root root 29176 44730 1202376678 1 f dim_STAT /etc/STATsrv/bin/grepX 0755 root root 25096 21230 1070617717 1 f dim_STAT /etc/STATsrv/bin/har 0755 root root 84008 45401 1015854117 1 f dim_STAT /etc/STATsrv/bin/har2 0755 root root 261408 41844 1244637684 1 f dim_STAT /etc/STATsrv/bin/harSTAT.sh 0755 root root 148 11908 1241376167 1 f dim_STAT /etc/STATsrv/bin/harSTATus3.sh 0755 root root 151 12191 1241376180 1 f dim_STAT /etc/STATsrv/bin/harSTATv2.sh 0755 root root 118 9652 1244640932 1 f dim_STAT /etc/STATsrv/bin/innodbIOSTAT.sh 0755 root root 396 27868 1251213391 1 f dim_STAT /etc/STATsrv/bin/innodbSTAT.sh 0755 root root 558 42245 1268909287 1 f dim_STAT /etc/STATsrv/bin/ioSTAT 0755 root root 41788 15714 924267150 1 f dim_STAT /etc/STATsrv/bin/ioSTAT.25 0755 root root 41788 15714 950020046 1 f dim_STAT /etc/STATsrv/bin/ioSTAT.7 0755 root root 66364 41196 950020046 1 f dim_STAT /etc/STATsrv/bin/ioSTAT.sh 0755 root root 360 26111 1241376196 1 f dim_STAT /etc/STATsrv/bin/iopattern 0755 root root 6822 50873 1201628322 1 f dim_STAT /etc/STATsrv/bin/jvmGC.sh 0755 root root 741 58828 1241376232 1 f dim_STAT /etc/STATsrv/bin/jvmSTAT.sh 0755 root root 1027 2395 1169199261 1 f dim_STAT /etc/STATsrv/bin/mysqlLOAD.sh 0755 root root 560 42455 1251213300 1 f dim_STAT /etc/STATsrv/bin/mysqlSTAT.sh 0755 root root 555 42067 1251213331 1 f dim_STAT /etc/STATsrv/bin/netLOAD 0775 root root 64520 57815 1163543461 1 f dim_STAT /etc/STATsrv/bin/netLOAD.sh 0775 root root 63 4920 1241376254 1 f dim_STAT /etc/STATsrv/bin/oraENQ.sh 0755 root root 131 10781 1241376262 1 f dim_STAT /etc/STATsrv/bin/oraENQ.sql 0644 root root 79 7105 1171701903 1 f dim_STAT /etc/STATsrv/bin/oraEXEC.sh 0755 root root 132 10846 1241376271 1 f dim_STAT /etc/STATsrv/bin/oraIO.sh 0755 root root 130 10705 1241376283 1 f dim_STAT /etc/STATsrv/bin/oraLATCH.sh 0755 root root 133 10917 1241376291 1 f dim_STAT /etc/STATsrv/bin/oraSLEEP.sh 0755 root root 133 10930 1241376298 1 f dim_STAT /etc/STATsrv/bin/oraexec.sql 0644 root root 135 12010 1036600598 1 f dim_STAT /etc/STATsrv/bin/oraio.sql 0644 root root 331 26568 1036600597 1 f dim_STAT /etc/STATsrv/bin/oralatch.sql 0644 root root 135 12631 1036600598 1 f dim_STAT /etc/STATsrv/bin/oravlatch.sql 0644 root root 147 12719 1052836700 1 f dim_STAT /etc/STATsrv/bin/perl 0755 root root 647736 37297 908548063 1 f dim_STAT /etc/STATsrv/bin/pgsqlLOAD.sh 0755 root root 568 43053 1251213626 1 f dim_STAT /etc/STATsrv/bin/pgsqlSTAT.sh 0755 root root 563 42761 1251213641 1 f dim_STAT /etc/STATsrv/bin/psSTAT 0755 root root 53236 6846 1097692289 1 f dim_STAT /etc/STATsrv/bin/psSTAT.sh 0755 root root 169 13273 1241376307 1 f dim_STAT /etc/STATsrv/bin/psSTAT64 0755 root root 74520 15844 1097507278 1 f dim_STAT /etc/STATsrv/bin/psSTAT64_10 0755 root root 115264 32097 1244652377 1 f dim_STAT /etc/STATsrv/bin/psSTAT_std.sh 0755 root root 238 22140 1244822825 1 f dim_STAT /etc/STATsrv/bin/sysinfo.sh 0755 root root 1410 45196 1241376326 1 f dim_STAT /etc/STATsrv/bin/sysv 0755 root root 45368 21175 1018250253 1 f dim_STAT /etc/STATsrv/bin/tailX 0755 root root 25644 53603 1070617710 1 f dim_STAT /etc/STATsrv/bin/tst64 0755 root root 9328 65041 970427414 1 f dim_STAT /etc/STATsrv/bin/x.EasySTAT 0644 root root 9434 2710 1264621702 1 f dim_STAT /etc/STATsrv/bin/x.SysINFO 0644 root root 1338 33656 1011218459 1 f dim_STAT /etc/STATsrv/bin/x.T3stat 0644 root root 1558 43670 993416764 1 f dim_STAT /etc/STATsrv/bin/x.Timer 0644 root root 862 61789 1244755777 1 f dim_STAT /etc/STATsrv/bin/x.UDPstat 0644 root root 1868 63031 1270448454 1 f dim_STAT /etc/STATsrv/bin/x.chldPID 0644 root root 474 33495 1214579475 1 f dim_STAT /etc/STATsrv/bin/x.harSTAT 0644 root root 1186 13426 984071988 1 f dim_STAT /etc/STATsrv/bin/x.harSTATus3 0644 root root 1370 26986 988646815 1 f dim_STAT /etc/STATsrv/bin/x.harSTATv2 0644 root root 1381 27939 1244637649 1 f dim_STAT /etc/STATsrv/bin/x.innodbIOSTAT 0644 root root 3680 1770 1244630708 1 f dim_STAT /etc/STATsrv/bin/x.innodbSTAT 0644 root root 14965 50055 1269548637 1 f dim_STAT /etc/STATsrv/bin/x.jvmGC 0644 root root 2419 34390 1069357708 1 f dim_STAT /etc/STATsrv/bin/x.jvmSTAT 0644 root root 3203 15185 1147374083 1 f dim_STAT /etc/STATsrv/bin/x.killSTAT 0644 root root 930 740 1112881713 1 f dim_STAT /etc/STATsrv/bin/x.mysqlLOAD 0644 root root 4445 12801 1251453167 1 f dim_STAT /etc/STATsrv/bin/x.mysqlSTAT 0644 root root 4114 43538 1251453028 1 f dim_STAT /etc/STATsrv/bin/x.oraENQ 0644 root root 1626 47285 1215105106 1 f dim_STAT /etc/STATsrv/bin/x.oraEXEC 0644 root root 1901 2520 1215105066 1 f dim_STAT /etc/STATsrv/bin/x.oraIO 0644 root root 2355 31187 1215105190 1 f dim_STAT /etc/STATsrv/bin/x.oraLATCH 0644 root root 1603 47224 1215105205 1 f dim_STAT /etc/STATsrv/bin/x.oraSLEEP 0644 root root 2043 11565 1215105249 1 f dim_STAT /etc/STATsrv/bin/x.pgsqlLOAD 0644 root root 3544 8267 1251195691 1 f dim_STAT /etc/STATsrv/bin/x.pgsqlSTAT 0644 root root 3359 55322 1241588116 1 d dim_STAT /etc/STATsrv/log 0755 root root 1 f dim_STAT /etc/STATsrv/log/access.log 0644 root root 0 0 964026305 1 s dim_STAT /etc/rc0.d/K10stat-srv=/etc/STATsrv/STAT-service 1 s dim_STAT /etc/rc1.d/K10stat-srv=/etc/STATsrv/STAT-service 1 s dim_STAT /etc/rc2.d/S99stat-srv=/etc/STATsrv/STAT-service 1 s dim_STAT /etc/rcS.d/K10stat-srv=/etc/STATsrv/STAT-service 1 i pkginfo 278 21924 1270649731 07070100007721000041ed0000000000000000000000034bbc938300000000000000200000001d00000000000000000000000500000000root07070100007724000041ed0000000000000000000000034bbc938300000000000000200000001d00000000000000000000000900000000root/etc07070100007726000041ed0000000000000000000000044bbc938300000000000000200000001d00000000000000000000001100000000root/etc/STATsrv07070100007729000081fd0000000000000000000000014a2fd0530000040d000000200000001d00000000000000000000001e00000000root/etc/STATsrv/STAT-service#!/bin/sh # *************************************************************************** # STAT-service # # part of dim_STAT tool # http://dimitrik.free.fr # *************************************************************************** LD_LIBRARY_PATH=/etc/STATsrv/lib:$LD_LIBRARY_PATH PATH=/etc/STATsrv/bin:$PATH export LD_LIBRARY_PATH PATH LANG=C LC_ALL=C export LANG LC_ALL port=5000 log=/etc/STATsrv/log/access.log case "$1" in 'start') echo "Start STAT-service..." echo " port: $port" echo " access log: $log" /etc/STATsrv/bin/STATsrv -p $port >> $log 2>&1 & ;; 'stop') echo "Stop STAT-service..." # folowing instractions may be replaced by a simple "pkill STATsrv" # (but some older systems may not have 'pkill' command :-)) cd /etc/STATsrv/bin; ./WebX ./x.killSTAT -cmd /etc/STATsrv/bin/STATsrv ;; *) echo "Usage: $0 { start | stop }" exit 1 esac exit 0 0707010000772a000081b40000000000000000000000014b66975f00000013000000200000001d00000000000000000000001900000000root/etc/STATsrv/VERSIONv.8.5 Solaris/SPARC0707010000772d000081b40000000000000000000000014bbc937800001346000000200000001d00000000000000000000001800000000root/etc/STATsrv/access# # STAT-service access file # # Format: # ... # command name[:port] fullpath # ... # access IP-address # ... # command name[:port] fullpath # ... # # By default all machines in the network may access to STAT-services # # Keyword "access" make access restriction by IP-adress for all following # commands till next "access" section. # # For example: # # ==================================================================== # # # # Any host may access to vmstat and mpstat collections # # # command vmstat /usr/bin/vmstat # command mpstat /usr/bin/mpstat # # # # Only machines 129.157.1.[1-3] may access netLOAD collections # # # access 129.157.1.1 # access 129.157.1.2 # access 129.157.1.3 # command netLOAD.sh /etc/STATsrv/bin/netLOAD.sh # # # # Only machine 129.157.1.1 may access psSTAT collections # # # access 129.157.1.1 # command psSTAT /etc/STATsrv/bin/psSTAT # # # ==================================================================== # # # """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""" # // All folowing commands should work out the box... // # """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""" command vmstat /usr/bin/vmstat command mpstat /usr/bin/mpstat command netstat /usr/bin/netstat command MEMSTAT /etc/STATsrv/bin/MemStat.sh command tailX /etc/STATsrv/bin/tailX command ioSTAT.sh /etc/STATsrv/bin/ioSTAT.sh command netLOAD.sh /etc/STATsrv/bin/netLOAD.sh command netLOAD /etc/STATsrv/bin/netLOAD.sh command psSTAT /etc/STATsrv/bin/psSTAT.sh command UserLOAD /etc/STATsrv/bin/UserLOAD.sh command ProcLOAD /etc/STATsrv/bin/ProcLOAD.sh command bsdlink /etc/STATsrv/bin/bsdlink.sh command bsdlink.sh /etc/STATsrv/bin/bsdlink.sh command sysinfo /etc/STATsrv/bin/sysinfo.sh command SysINFO /etc/STATsrv/bin/sysinfo.sh command IObench /etc/STATsrv/bin/IObench_STAT.sh command dbSTRESS /etc/STATsrv/bin/dbSTRESS_STAT.sh command Siostat /etc/STATsrv/bin/Siostat.sh command CPUSet /etc/STATsrv/bin/CPUSet.sh command UDPstat /etc/STATsrv/bin/UDPstat.sh # """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""" # // Next commands will need some system conditions... // # """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""" # ** Only for Solaris 10+ ##command ProjLOAD /etc/STATsrv/bin/ProjLOAD.sh ##command PoolLOAD /etc/STATsrv/bin/PoolLOAD.sh ##command TaskLOAD /etc/STATsrv/bin/TaskLOAD.sh ##command ZoneLOAD /etc/STATsrv/bin/ZoneLOAD.sh ##command IOpatt /etc/STATsrv/bin/IOpatt.sh ##command ForkExec /etc/STATsrv/bin/ForkExec.sh ##command innodbIOSTAT /etc/STATsrv/bin/innodbIOSTAT.sh # ** Check VxVM is running on this host before uncomment... ##command vxstat /usr/sbin/vxstat # ** for US-II and US-III CPU chips only ##command harSTAT.sh /etc/STATsrv/bin/harSTAT.sh ##command harSTATus3.sh /etc/STATsrv/bin/harSTATus3.sh # ** Collect CPU chip stats # NOTE : stat gathering requiring an exclusive access to the CPU !!! # it may bring some negative secondary effects !! # don't leave running penrmanently !! # BE AWARE before uncomment !! # ##command harSTATv2 /etc/STATsrv/bin/harSTATv2.sh # ** CoreSTAT ** # NOTE: needs 'corestat' to be installed (see: http://cooltools.sunsource.net/corestat/index.html) # WARNING: be aware, gets exclusive access on CPU while getting stats, # may have negative effect on global server performance... ##command CoreSTAT /usr/bin/corestat # """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""" # // Next commands may need some additional configuration // # // (see each *.sh to get more details before uncomment) // # """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""" # Java (JVM) #command jvmSTAT /etc/STATsrv/bin/jvmSTAT.sh #command jvmGC /etc/STATsrv/bin/jvmGC.sh # Oracle #command oraEXEC /etc/STATsrv/bin/oraEXEC.sh #command oraIO /etc/STATsrv/bin/oraIO.sh #command oraENQ /etc/STATsrv/bin/oraENQ.sh #command oraLATCH /etc/STATsrv/bin/oraLATCH.sh #command oraSLEEP /etc/STATsrv/bin/oraSLEEP.sh # MySQL #command innodbSTAT /etc/STATsrv/bin/innodbSTAT.sh #command innodbMUTEX /etc/STATsrv/bin/innodbMUTEX.sh #command mysqlSTAT /etc/STATsrv/bin/mysqlSTAT.sh #command mysqlLOAD /etc/STATsrv/bin/mysqlLOAD.sh # PostgreSQL #command pgsqlSTAT /etc/STATsrv/bin/pgsqlSTAT.sh #command pgsqlLOAD /etc/STATsrv/bin/pgsqlLOAD.sh 07070100007735000041ed0000000000000000000000024bbc938300000000000000200000001d00000000000000000000001500000000root/etc/STATsrv/bin07070100007737000081ed00000000000000000000000149c21b4f00000039000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/CPUSet.sh#!/bin/sh LANG=C export LANG exec /usr/bin/mpstat -a $1 07070100007738000081fd0000000000000000000000014b5d75a7000007b8000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/EasySTAT.sh#!/bin/ksh #================================================================ # EasySTAT (dim) v.1.9 #================================================================ # # STATS env contains the list of stat commands # to be collected in the following sysntax # "Name1!Command1[; NameN!CommandN] # # Change default STATS list according your needs... # Have fun! :) # -Dimitri # #================================================================ VER="v.1.9" # << The *Must* env sys settings, don't remove! >> #======================================================== LANG=C LC_ALL=C PATH=/etc/STATsrv/bin:$PATH LD_LIBRARY_PATH=/etc/STATsrv/lib:$LD_LIBRARY_PATH export PATH LD_LIBRARY_PATH LANG LC_ALL #======================================================== # Compress output files (optional) # """""""""""""""""""""""""""""""""""""""" COMPRESS=gzip export COMPRESS # Auto-include timestamps (optional) # """""""""""""""""""""""""""""""""""""""" TIMER=yes export TIMER # Log output into this file (optional) # """""""""""""""""""""""""""""""""""""""" ##LOG=/var/log/stat.log ##export LOG #================================================================== # Stats to collect #================================================================== STATS="$STATS; VMSTAT!/usr/bin/vmstat %i" STATS="$STATS; CPUSet!/etc/STATsrv/bin/CPUSet.sh %i" STATS="$STATS; MPSTAT!/usr/bin/mpstat %i" STATS="$STATS; IOSTAT-xn!/etc/STATsrv/bin/ioSTAT.sh -xn %i" STATS="$STATS; netLOAD!/etc/STATsrv/bin/netLOAD %i" STATS="$STATS; ProcLOAD!/etc/STATsrv/bin/ProcLOAD.sh %i" Usage() { echo "EasySTAT (dim) $VER " echo " Usage: " echo " $ EasySTAT.sh OutDIR IntervalSec NbHours [Title [Hostname [DBname [Batch [Log]]]]]" exit } if [ "$1" = "-h" ] || [ "$1" = "-?" ] || [ "X$1" = "X" ]; then Usage; fi export PATH STATS cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.EasySTAT -Dir "$1" -Timeout "$2" -Hours "$3" -Title "$4" -Host "$5" -Base "$6" -Batch "$7" -Log "$8" 0707010000773a000081fd00000000000000000000000149fde4d900000041000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/ForkExec.sh#!/bin/ksh LANG=C export LANG exec /usr/sbin/sar -c $1 100000000 0707010000773e000081ed00000000000000000000000149fde4e500000042000000200000001d00000000000000000000002500000000root/etc/STATsrv/bin/IObench_STAT.sh#!/bin/sh LANG=C export LANG exec /etc/STATsrv/bin/IObstat 505 $1 0707010000773f000081ed00000000000000000000000147aacf9d00011580000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/IObench_v4ELF4 4 (44SSSSV V /usr/lib/ld.so.1\CDV:_[`M8!.R9K76uHhBa+j$&mfr-wi='ZPy(pG;> zLc{SN#onxQs|3T~t"FgdbvqJe4@%,0<)2/AX1U?IW*5^]YElkO}|<0I I I S S V VWW W(XUxPD=t T%&1V9(H?UHDUIWTVZYc[hTdrUyUY@!UG HVS UYUTXWT(YT4UU$YT| I VV T&YH)YXH, |2T7U <Y ?Y B(KTpQGTHmWsY |YU<YVWYTYTV Y<4Vp|TLY@VVWTT#hH[0 VU0H(.V6T@<TDY!L[RVZVbUg[n[tV|[GVUW XS UUlS VI 9(*U TUUU`#UT*I 0V4T<[getoptaw_term__muldi3_startreadSetPositionaw_waitUsageatoiatollimitIOsecnbrec_environ_endgetrusageopen64getpid_iobsrandom__register_frame_infop_cmd_GLOBAL_OFFSET_TABLE_GoOutsleepsessSTATabortsignalIDatexitbuffexitmallocsprintfposputs_initoff_endmode.umulR0R1Lreadtime.remT0T1SHM_initftime__register_frame_info_tablePcallRW_OrderTsgetenvTuoff_begGroupTimestrncpyt_endrandom_DYNAMICt_beginPerrorsizeLwriteprintf__iobfdRfdWLoopwritepwrite64Initsstatbufp_fileRlseek64__frame_state_forp_fileW_exitpread64environerrnolimitKBwrcountfreeoptindoflagrdcountoptarg__deregister_frame_infop_syncstrcmpKey_edata_PROCEDURE_LINKAGE_TABLE_memsetstrcpy_etextasflg_lib_version__moddi3main.udiv.divmemcpystrlenshmatshmget_finicmdfprintfnewposlibc.so.1SUNW_1.1libc.so.1C ='MY([q[tY^T(8T4:T@jTL]TX6Td*TpKT|>TFTTBTTWTcTbTUTkT U,U GU.U$<U0gU<PUH$UTU`Ul|UxU%UwUU+U3UU;UUpU5U{ @D# @O?R!@O;@ , @ "@@O0@O1㿐@/OL @   $? 2 @ 㿐㿐@/NĮ ` @  㿐㿐'D""Rb@N FP@Nx'D (X@N  Ra@^?@N(a@N  Rb@P?@ND  F@N F@NRb@N(a@N((!a" '쀢  '!(( !X@ ( a @"  #@N$!((((X"  + " * + aܔ@ "!!(( !X@ ( a @"  #@N$!((( X (  "  + " * + aؔ@ "!(((a"@  *" * *(  *3 ( ᠖ + 3`" @ "!Rb @NE" R"8b@N8"ą쇠"?"쇠"?"b '쇠"?(!"b '";`#\RbX  @N"b@N'*` '"?"b@M'*` '"?"b b@M'*` '"?#\Rb@M(Ra@M(Ra@M((!aؒ R@M((!aؐ '"b '"?Rc0  @M @M㿐'D((bRPD@M㿈'D'H'L"䀢`A"`4#`$@M!:  Ж@c@"В@ B L @ DHL  @Me' D@DHL@M]'DHL@MU'쀢 "(#Ȁ`Rcp 1(#Ȁ #` $D@/b""#$!`aa`," ,aa`$" $!c @Ma " 㿈'D'H'L"䀢`A"`4#`$@L!:  Ж@c@"В@ B L @ DHL  @L' D@;DHL@L'DHL@L'쀢 "(#Ȁ`Rcx (#Ȁ #` D@ /bĒ""#$!`aa`(" (aa`$" $!c @Lia " 㾀'"Ȁ@!@ `  `* '(a@L-@LI(!# @LD @LC F@L F@L "䀢` FP@K@L'"R#R#R"b@K#` Rb@K""S `""S `#S hS p#` "Ж #\"S(@KSxb@K(a@K (@K?h SSؖ!S`@Kh  @K|(a@K? SSؖ!%@K  @Ke㿈'DD??p"`-"ȓ:"Ș   @ D   @K   ` `  Sa E @@KI:  Ж@c@o';  "В B "ț8"Ȕ @i D   @KC   ` `  Sat  㿐'D(bSDT D$@J?@J㿀#?}# '쀢`T`@K'쀢`T`'@J'#`T"#0#@J'䀢? T`@J?@J  @J' T`@J?@J#` #d "# * *@ "!!c @Ja " a" $a" (a" ,Ta@J] x'D'H'( "#TH""TP""(aT`@JDHTh@J'쀢? (s*`J -`1T1T1T-t1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T1T,/P1T,1T-H,P-1T-0,.,h01T1T1T0\-H@B#(c@JD$b:#(c@J< bؒ@ "@: $b-#(c@J/ bВ@ "@: $b #(c@J"$b(c@J"c(c"#  (c"# "# "#?""(cT@I   ""TP""(cT@I ""T""(cT@I  ""T""((cВ"#"䀢  '(Tc@In?""(cT@I  ""(cT@I  """  '(Tc@IC?""(cT@I   ""TH""(cT@Iy   ""T""(cT@Ii   ""T"""  '(T c@IE#(c@I8$b"Ȁ` " @  'Tb8@HbȒ *` ""#((cԔ @H( !@ *(a@I    'Tbp@H 'x"`,bȒ `c:` "  Tb@HH@#" *  @Hb*` $c耢  (#D@H@"`2"`-b"Ѐ b"Ѐ ! bؒ  "А @  @@ bؒ  Д @"@ """`$b"Ѐ b"Ѐ  bؒ  "А @  @@H@0# Tb@H!H@#b  $B(̔ *H@ @""("cД!@HN"bb  bi(c@Gn(̔ *H@ @""("cД!@H."bb  bI(c@GN(@  + H """@("cД!@H "bb  b%(c@Gb""(#D@ (̔ *H@ @""("cД!@G"bb  b(c@Gw@b b#`  @Gu '#`%"b c@G  @GY䀢  ' "  @G '"` "b b #` 2bb"b""b    P K""A"y7(a' *`: ) *`: W"bbS "ܒ 'V㿈@/FP  ?  b      b   W耢 $ D`  $ $ `$ : 8 @FҒ    @`  ` :  $ D`  $ $ `$ : ` ??#@? ?#   3 @  @"@  ` d`a^. 2 @* 4 , 6 @.   "B `  ""€ `":  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ `@`@ b` d, 6 @4 <@  b ?㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@E@E   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @EH* ?''' `      & && 㿐@/D‮   @@*  @    2      2 *@ @ :  @@   㿈@/Dᘮ  "  @D&@ @`@D @J z- @D@@`  @D 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @DJ ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @CА ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@Cܐ"@C۔"$&b""@CԒ@CՐ0 ' @*!*@ * "`'0 &` @C㿐@/CĮ&`&`&@ &` @&`&`"@㿐@/C|&`&` &` &@@&`&`"@㿐@/C4  ` `"@  @C|` 0 `@CyXL ؠ =  @Cj"7j'?$   ؐ  J zo  '  @C*"㿐@/B⌮ ? ???㿐㿠㿠pSIG aio: %d gerrusageftime Termination requiredElapsed: %d seconds Reads: %d Writes: %d IOs: %d Reads/sec: %f Writes/sec: %f IO/sec: %f Time(ms) per IO: %f Read Kb/sec: %f Write Kb/sec: %f IO Kb/sec: %f CPU System time(ms): %d CPU User time(ms) : %d CPU time(ms) : %d CPU time(ms) per IO: %f ### I/O ERROR: %s errno: %d LwriteLreadInit completed PID: %d, now proceed to %s %s %s, I/O size: %d bytes sequentialrandomI/O throughput limited to: %d KB/sec (%d IO/sec) Files: R[%s] W[%s], RW-Order:%s P-syscall:%s offset:%d nbrec:%d -yesno==> (Ctrl_C) or TERM signal to terminate or will auto-stop at %d I/Os %s:%d,%sIObench_v4.cinits%s:%d,ftime)lseek fd %s (dim) %s Usage: %s Options File [File2] Operation options: -h -- help -c command -- I/O command: read, write, rw -s size -- I/O size in KBytes -m mode -- I/O mode: seq, rnd -o order -- I/O rw-mode order chain: R=read, W=write, ex:'RWRRWR' (default: 'RW') -b position -- Begin offset (in units) -e position -- End offset (in units) -t type -- I/O Type: buff, aio, osync -n Numb -- Finish after Numb I/O commands -l Limit -- Limit own throughput to Limit KB/sec -P -- Use pread/pwrite syscalls -L -- Loop I/O non-stop STAT options: -i ID -- Client ID for anySTAT (1:%d), -1 to disable anySTAT -k key -- SHMKEY for anySTAT -g group -- Group name for anySTAT Note: both -e and -b must be specified for random I/Os v.4.0SHMKEY505IObench### Cannot get SHM...### Cannot attach SHM...## STAT> shmkey: %s group: %s id: %d readsbufferedRWPLhc:s:m:b:e:t:n:l:g:i:k:o:buffaioAIOosyncO_SYNC illegal I/O type: %s seqrnd illegal I/O mode: %s readwritewritesrwreads+writes illegal command %s illegal IOsize: should be between 1 and 10240 KB RW-Order chain is too short! illegal KB/s limit < IO size Empty ID number...ehV VW(XRSSXW00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~V I Ioo< | S0 W$ |e  e9( - e|e  e= - e|e  e >4 (>L 8?H H?PTX? - et@@ - eAP - eB8( - eC` - eG H - eGTH - eG - e8H( - e|<0I I I S S V VWW W(X]['2V6WDW RhwW(VDX W(R WXS S "?H-X5>LD>4SC`dB8(uW?PT@@?APXIDIDWIW$W%Ux,PD4==tDTI&UVe(HkUHpUuWVY[TdUUY@!UG HVS UYUTX WT(YT4!U(U$0Y4T|9I ?VGVLTRYHUYXHX |^TcU hY kY n(wTp}GTHWY YU<YVWYTYTV Y<4Vp|TLY@VVW!T'T0#hH6[0>VFU0NH(`VhT@nTvY!~[VVU[[V[GVUW XS UUlS VI (9(1*6U<TAUHUOU`UUT\I bVfTn[IObench_v4.sparc32crti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummyIObench_v4.clibgcc2.c__FRAME_BEGIN____clz_tablibgcc2.c__FRAME_BEGIN__frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.sgetoptaw_term__muldi3_startreadSetPositionaw_wait_START_UsageatoiatollimitIOsecnbrec_environ_endgetrusageopen64getpid_iobsrandom__register_frame_infop_cmd_GLOBAL_OFFSET_TABLE_GoOutsleepsessSTATabortsignalIDatexitbuffexitmallocsprintfposputs_initoff_endmode.umulR0R1Lreadtime.remT0T1SHM_initftime__register_frame_info_tablePcallRW_OrderTsgetenvTu_END_off_begGroupTimestrncpyt_endrandom_DYNAMICt_beginPerrorsizeLwriteprintf__iobfdRfdWLoopwritepwrite64Initsstatbufp_fileRlseek64__frame_state_forp_fileW_exitpread64environerrnolimitKBwrcountfreeoptindoflagrdcountoptarg__deregister_frame_infop_syncstrcmpKey_edata_PROCEDURE_LINKAGE_TABLE_memsetstrcpy_etextasflg_lib_version__moddi3main.udiv.divmemcpystrlenshmatshmget_finicmdfprintfnewposas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I42dPdP*<9c}̀?ۀ&@[|؀&:Op,",؀<?GJ*Ђ >!\#'؀>DEJ+NAOWPmU^_nȀow}~3OlÀ-ۀ.> ?!@5AJCfD{EGHIπJfg h )i Bl Xm qn o ǀu $ = Q j ǀ # < O h ~ Հ   0 F Z o € ր  f&Dy%ր-65X<EҀKPUZ+`AaVbic}Ԁ1KcB~,@9vzƀ'/Â݀"$ECYsр]p߀ = X s р7 !!M!7!d!˂!"$"j""Â""###׀$x$$܀$% &&׀'8'T?'i'O'()))*E*\{*s+,Z,--- 9- 9- :. :. ;. <.* =.6 A.E B.T C.a F.n G.} M. M. M. M. O. P. R. S. T. U/ V/$[P/!ZDD[D\D]D^(D_</-$D/.$c/;bDDcDdDfDgDDi|DkDlDmDpDqDrDtDuHDvDwDx$DzD{D|DDDDD,DDD/Hd(D`|/W$/X$</fDDDD,/q$4/r$p/D/H/LDDDD$D8DDDDDDD D0D\DhD|DDDDDdDtDt/8|t/$|/$ /D/ŠH/ѠLDDDD$D8DDDDDDD D0D\DhD|DDDDDdDtDt/݀8|t/$|/$#hDDDDdDtDDD D D\DDTDlD|DDDDD D"D$D%D&$D'4D(@D)@D)@//h0$@@0:$H0;$-&0N,DD-D.D0D2$D48D5D8D9 D;D<D<0X.0b$0c$@(0p?DD@DADV4DW@0y$H0z$[(D[D\D`Db$Dc<Dd`DelDg|DiDkDlDoDq DrDu(DvdDwDxDyDzD{D}D~DD0\0]0]0^0$0$*0ϠD0۠HDD D DDD,D<DTDD\DtDDDDD<DTDlDDDDDDpDDDDDDDD0D<DTD\DhDDD(D<DHD`DhDDDDDDD D D<DHDXD`DlDtDtD|DDD8DxDLDD D DD hD D D D <D DD xD D D D D lD tD |D D D D D D (D 8D `D xD D D D D D# D& XD' xD* D+ D/ D1 D3 D4@D1`D6tD7tD:|D;D;0011 \t1/ t1%$1& W1? &1J &1U '1` '1k (1u (1 (1 71 81 >1 ?1 @1 C1 D2 D2d9R d9$d90<?iӀE,Faހ,@Jay~Ԁ 2ˀh  v . C Y nI J K L ŀM ۀO P V Y 5 l| &R $9 @ @ $( d=Q d=$d=0<?iӀE,Faހ,@Jay~Ԁ 2ˀh  v . C Y nI J K L ŀM ۀO P V Y 5 l| $= @ @ $ d>, d>"d>,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$i>)@h)@h )$4)$~>)@})@} )$L)*<$?*O@*m@ *w@ *$H*$?P*@*$T*$?*@*@*@*@+ @+$+$@@+0@+<$+=$'AP+N@&+Y$+Z$RB8+s@Q+}@Q+$(+$C`+@}+@}+@~+@~+$+$G +@,@,$H,$ GT,7@ ,E@ ,Q$H,R$G,r@,$,$4H,@3,@3,$(,(PX,dID.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpIObench_v4.c/SOFT/IObench/IObench_v4.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/sys/feature_tests.h/usr/include/sys/va_list.h__va_list:t(3,1)=(3,2)=*(0,19)size_t:t(1,1)=(0,4)__longlong_t:t(1,2)=(0,6)off_t:t(1,3)=(1,2)off64_t:t(1,4)=(1,2)fpos_t:t(1,5)=(1,2)fpos64_t:t(1,6)=(1,2)FILE:t(1,7)=(1,8)=s16_cnt:(0,1),0,32;_ptr:(1,9)=*(0,11),32,32;_base:(1,9),64,32;_flag:(0,11),96,8;_file:(0,11),104,8;;/usr/include/unistd.h/usr/include/sys/types.h/usr/include/sys/isa_defs.h/usr/include/sys/machtypes.h_physadr_t:T(7,1)=s4r:(7,2)=ar(0,0);0;0;(0,1),0,32;;physadr_t:t(7,3)=(7,4)=*(7,1)_label_t:T(7,5)=s8val:(7,6)=ar(0,0);0;1;(0,1),0,64;;label_t:t(7,7)=(7,5)lock_t:t(7,8)=(0,11)/usr/include/sys/int_types.hint8_t:t(8,1)=(0,2)int16_t:t(8,2)=(0,8)int32_t:t(8,3)=(0,1)int64_t:t(8,4)=(0,6)uint8_t:t(8,5)=(0,11)uint16_t:t(8,6)=(0,9)uint32_t:t(8,7)=(0,4)uint64_t:t(8,8)=(0,7)intmax_t:t(8,9)=(8,4)uintmax_t:t(8,10)=(8,8)intptr_t:t(8,11)=(0,1)uintptr_t:t(8,12)=(0,4)int_least8_t:t(8,13)=(0,2)int_least16_t:t(8,14)=(0,8)int_least32_t:t(8,15)=(0,1)int_least64_t:t(8,16)=(0,6)uint_least8_t:t(8,17)=(0,11)uint_least16_t:t(8,18)=(0,9)uint_least32_t:t(8,19)=(0,4)uint_least64_t:t(8,20)=(0,7)longlong_t:t(5,1)=(0,6)u_longlong_t:t(5,2)=(0,7)uchar_t:t(5,3)=(0,11)ushort_t:t(5,4)=(0,9)uint_t:t(5,5)=(0,4)ulong_t:t(5,6)=(0,5)caddr_t:t(5,7)=(5,8)=*(0,2)daddr_t:t(5,9)=(0,3)cnt_t:t(5,10)=(0,8)paddr_t:t(5,11)=(5,6)use_t:t(5,12)=(5,3)sysid_t:t(5,13)=(0,8)index_t:t(5,14)=(0,8)ino_t:t(5,15)=(5,2)blkcnt_t:t(5,16)=(5,1)fsblkcnt_t:t(5,17)=(5,2)fsfilcnt_t:t(5,18)=(5,2)ino64_t:t(5,19)=(5,2)blkcnt64_t:t(5,20)=(5,1)fsblkcnt64_t:t(5,21)=(5,2)fsfilcnt64_t:t(5,22)=(5,2) :T(5,23)=eB_FALSE:0,B_TRUE:1,;boolean_t:t(5,24)=(5,23)pad64_t:t(5,25)=(8,4)upad64_t:t(5,26)=(8,8)offset_t:t(5,27)=(5,1)u_offset_t:t(5,28)=(5,2)len_t:t(5,29)=(5,2)diskaddr_t:t(5,30)=(5,1)lloff_t:t(5,31)=(5,32)=u16_f:(5,27),0,64;_p:(5,33)=s16_u:(0,3),0,32;_l:(1,3),64,64;;,0,128;;lldaddr_t:t(5,34)=(5,35)=u8_f:(5,30),0,64;_p:(5,36)=s8_u:(0,3),0,32;_l:(5,9),32,32;;,0,64;;k_fltset_t:t(5,37)=(5,6)id_t:t(5,38)=(0,3)useconds_t:t(5,39)=(5,5)major_t:t(5,40)=(5,6)minor_t:t(5,41)=(5,6)pri_t:t(5,42)=(0,8)o_mode_t:t(5,43)=(5,4)o_dev_t:t(5,44)=(0,8)o_uid_t:t(5,45)=(5,4)o_gid_t:t(5,46)=(5,45)o_nlink_t:t(5,47)=(0,8)o_pid_t:t(5,48)=(0,8)o_ino_t:t(5,49)=(5,4)key_t:t(5,50)=(0,1)mode_t:t(5,51)=(5,6)uid_t:t(5,52)=(0,3)gid_t:t(5,53)=(5,52)nlink_t:t(5,54)=(5,6)dev_t:t(5,55)=(5,6)pid_t:t(5,56)=(0,3)pthread_t:t(5,57)=(0,4)pthread_key_t:t(5,58)=(0,4)_pthread_mutex:T(5,59)=s24__pthread_mutex_flags:(5,60)=s8__pthread_mutex_flag:(5,61)=ar(0,0);0;3;(8,5),0,32;__pthread_mutex_type:(8,7),32,32;;,0,64;__pthread_mutex_lock:(5,62)=u8__pthread_mutex_lock64:(5,63)=s8__pthread_mutex_pad:(5,64)=ar(0,0);0;7;(8,5),0,64;;,0,64;__pthread_mutex_owner64:(5,26),0,64;;,64,64;__pthread_mutex_data:(5,26),128,64;;pthread_mutex_t:t(5,65)=(5,59)_pthread_cond:T(5,66)=s16__pthread_cond_flags:(5,67)=s8__pthread_cond_flag:(5,61),0,32;__pthread_cond_type:(8,7),32,32;;,0,64;__pthread_cond_data:(5,26),64,64;;pthread_cond_t:t(5,68)=(5,66)_pthread_attr:T(5,69)=s4__pthread_attrp:(3,2),0,32;;pthread_attr_t:t(5,70)=(5,69)_pthread_mutexattr:T(5,71)=s4__pthread_mutexattrp:(3,2),0,32;;pthread_mutexattr_t:t(5,72)=(5,71)_pthread_condattr:T(5,73)=s4__pthread_condattrp:(3,2),0,32;;pthread_condattr_t:t(5,74)=(5,73)_once:T(5,75)=s32__pthread_once_pad:(5,76)=ar(0,0);0;3;(5,26),0,256;;pthread_once_t:t(5,77)=(5,75)ssize_t:t(5,78)=(0,1)time_t:t(5,79)=(0,3)clock_t:t(5,80)=(0,3)clockid_t:t(5,81)=(0,1)timer_t:t(5,82)=(0,1)unchar:t(5,83)=(0,11)ushort:t(5,84)=(0,9)uint:t(5,85)=(0,4)ulong:t(5,86)=(0,5)hostid_t:t(5,87)=(0,3)u_char:t(5,88)=(0,11)u_short:t(5,89)=(0,9)u_int:t(5,90)=(0,4)u_long:t(5,91)=(0,5)_quad:T(5,92)=s8val:(5,93)=ar(0,0);0;1;(0,3),0,64;;quad:t(5,94)=(5,92)/usr/include/sys/select.h/usr/include/sys/time.htimeval:T(10,1)=s8tv_sec:(5,79),0,32;tv_usec:(0,3),32,32;;timezone:T(10,2)=s8tz_minuteswest:(0,1),0,32;tz_dsttime:(0,1),32,32;;/usr/include/sys/types.hitimerval:T(10,3)=s16it_interval:(10,1),0,64;it_value:(10,1),64,64;;timespec:T(10,4)=s8tv_sec:(5,79),0,32;tv_nsec:(0,3),32,32;;timespec_t:t(10,5)=(10,4)timestruc_t:t(10,6)=(10,4)itimerspec:T(10,7)=s16it_interval:(10,4),0,64;it_value:(10,4),64,64;;itimerspec_t:t(10,8)=(10,7)hrtime_t:t(10,9)=(5,1)/usr/include/time.htm:T(12,1)=s36tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;;/usr/include/sys/time.h/usr/include/sys/siginfo.hsigval:T(14,1)=u4sival_int:(0,1),0,32;sival_ptr:(3,2),0,32;;sigevent:T(14,2)=s24sigev_notify:(0,1),0,32;_sigev_un:(14,3)=u4_sigev_signo:(0,1),0,32;_sigev_notify_function:(14,4)=*(14,5)=f(0,19),0,32;;,32,32;sigev_value:(14,1),64,32;_sigev_pad1:(0,1),96,32;_sigev_notify_attributes:(3,2),128,32;_sigev_pad2:(0,1),160,32;;/usr/include/sys/machsig.h/usr/include/sys/time.hsiginfo:T(14,6)=s128si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(14,7)=u116__pad:(14,8)=ar(0,0);0;28;(0,1),0,928;__proc:(14,9)=s16__pid:(5,56),0,32;__pdata:(14,10)=u12__kill:(14,11)=s8__uid:(5,52),0,32;__value:(14,1),32,32;;,0,64;__cld:(14,12)=s12__utime:(5,80),0,32;__status:(0,1),32,32;__stime:(5,80),64,32;;,0,96;;,32,96;;,0,128;__fault:(14,13)=s12__addr:(3,2),0,32;__trapno:(0,1),32,32;__pc:(5,7),64,32;;,0,96;__file:(14,14)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(14,15)=s116__faddr:(5,7),0,32;\__tstamp:(10,6),32,64;__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;__sysarg:(14,16)=ar(0,0);0;7;(0,3),128,256;__mstate:(14,17)=ar(0,0);0;16;(0,3),384,544;;,0,928;;,96,928;;siginfo_t:t(14,18)=(14,6)k_siginfo:T(14,19)=s28si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(14,20)=u16__proc:(14,21)=s16__pid:(5,56),0,32;__pdata:(14,22)=u12__kill:(14,23)=s8__uid:(5,52),0,32;__value:(14,1),32,32;;,0,64;__cld:(14,24)=s12__utime:(5,80),0,32;__status:(0,1),32,32;__stime:(5,80),64,32;;,0,96;;,32,96;;,0,128;__fault:(14,25)=s12__addr:(3,2),0,32;__trapno:(0,1),32,32;__pc:(5,7),64,32;;,0,96;__file:(14,26)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(14,27)=s16__faddr:(5,7),0,32;__tstamp:(10,6),32,64;\__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;;,0,128;;,96,128;;k_siginfo_t:t(14,28)=(14,19)sigqueue:T(14,29)=s40sq_next:(14,30)=*(14,29),0,32;sq_info:(14,28),32,224;sq_func:(14,31)=*(14,32)=f(0,19),256,32;sq_backptr:(3,2),288,32;;sigqueue_t:t(14,33)=(14,29)/usr/include/sys/select.hfd_mask:t(9,1)=(0,3)fds_mask:t(9,2)=(0,3)fd_set:T(9,3)=s128fds_bits:(9,4)=ar(0,0);0;31;(0,3),0,1024;;fd_set:t(9,5)=(9,3)/usr/include/sys/unistd.h/usr/include/errno.h/usr/include/sys/errno.h/usr/include/signal.h/usr/include/sys/signal.hsigset_t:t(22,1)=(22,2)=s16__sigbits:(22,3)=ar(0,0);0;3;(0,5),0,128;;k_sigset_t:t(22,4)=(22,5)=s8__sigbits:(22,6)=ar(0,0);0;1;(0,5),0,64;;sigaction:T(22,7)=s32sa_flags:(0,1),0,32;_funcptr:(22,8)=u4_handler:(22,9)=*(22,10)=f(0,19),0,32;_sigaction:(22,11)=*(22,12)=f(0,19),0,32;;,32,32;sa_mask:(22,1),64,128;sa_resv:(7,6),192,64;;sigaltstack:T(22,13)=s12ss_sp:(3,2),0,32;ss_size:(1,1),32,32;ss_flags:(0,1),64,32;;stack_t:t(22,14)=(22,13)signotify_id:T(22,15)=s12sn_pid:(5,56),0,32;sn_index:(0,1),32,32;sn_pad:(0,1),64,32;;signotify_id_t:t(22,16)=(22,15)sigstack:T(22,17)=s8ss_sp:(3,2),0,32;ss_onstack:(0,1),32,32;;sig_atomic_t:t(21,1)=(0,1)/usr/include/sys/procset.hidtype:T(23,1)=eP_PID:0,P_PPID:1,P_PGID:2,P_SID:3,P_CID:4,P_UID:5,P_GID:6,P_ALL:7,P_LWPID:8,;idtype_t:t(23,2)=(23,1)idop:T(23,3)=ePOP_DIFF:0,POP_AND:1,POP_OR:2,POP_XOR:3,;idop_t:t(23,4)=(23,3)procset:T(23,5)=s20p_op:(23,4),0,32;p_lidtype:(23,2),32,32;p_lid:(5,38),64,32;p_ridtype:(23,2),96,32;p_rid:(5,38),128,32;;procset_t:t(23,6)=(23,5)/usr/include/string.h/usr/local/lib/gcc-lib/sparc-sun-solaris2.6/2.8.1/include/limits.h/usr/local/lib/gcc-lib/sparc-sun-solaris2.6/2.8.1/include/syslimits.h/usr/local/lib/gcc-lib/sparc-sun-solaris2.6/2.8.1/include/limits.h/usr/include/limits.h/usr/include/sys/int_limits.h/usr/include/fcntl.h/usr/include/sys/fcntl.hflock:T(31,1)=s48l_type:(0,8),0,16;l_whence:(0,8),16,16;l_start:(1,3),64,64;l_len:(1,3),128,64;l_sysid:(0,3),192,32;l_pid:(5,56),224,32;l_pad:(31,2)=ar(0,0);0;3;(0,3),256,128;;flock_t:t(31,3)=(31,1)flock64:T(31,4)=s48l_type:(0,8),0,16;l_whence:(0,8),16,16;l_start:(1,4),64,64;l_len:(1,4),128,64;l_sysid:(0,3),192,32;l_pid:(5,56),224,32;l_pad:(31,2),256,128;;flock64_t:t(31,5)=(31,4)fshare:T(31,6)=s8f_access:(0,8),0,16;f_deny:(0,8),16,16;f_id:(0,3),32,32;;fshare_t:t(31,7)=(31,6)/usr/include/sys/stat.hstat64:T(32,1)=s152st_dev:(5,55),0,32;st_pad1:(32,2)=ar(0,0);0;2;(0,3),32,96;st_ino:(5,15),128,64;st_mode:(5,51),192,32;st_nlink:(5,54),224,32;st_uid:(5,52),256,32;st_gid:(5,53),288,32;st_rdev:(5,55),320,32;st_pad2:(5,93),352,64;st_size:(1,3),448,64;st_atim:(10,6),512,64;st_mtim:(10,6),576,64;st_ctim:(10,6),640,64;st_blksize:(0,3),704,32;st_blocks:(5,16),768,64;st_fstype:(32,3)=ar(0,0);0;15;(0,2),832,128;st_pad4:(14,16),960,256;;/usr/include/sys/timeb.htimeb:T(33,1)=s12time:(5,79),0,32;millitm:(0,9),32,16;timezone:(0,8),48,16;dstflag:(0,8),64,16;;/usr/include/sys/resource.hrlim_t:t(34,1)=(5,2)rlimit:T(34,2)=s16rlim_cur:(34,1),0,64;rlim_max:(34,1),64,64;;rlim64_t:t(34,3)=(5,2)rlimit64:T(34,4)=s16rlim_cur:(34,3),0,64;rlim_max:(34,3),64,64;;rusage:T(34,5)=s72ru_utime:(10,1),0,64;ru_stime:(10,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;anySTAT.h/usr/include/sys/ipc.hipc_perm:T(36,1)=s44uid:(5,52),0,32;gid:(5,53),32,32;cuid:(5,52),64,32;cgid:(5,53),96,32;mode:(5,51),128,32;seq:(5,6),160,32;key:(5,50),192,32;pad:(31,2),224,128;;/usr/include/sys/shm.hshmatt_t:t(37,1)=(0,5)shmid_ds:T(37,2)=s112shm_perm:(36,1),0,352;shm_segsz:(1,1),352,32;shm_amp:(37,3)=*(37,4)=xsanon_map:,384,32;shm_lkcnt:(5,4),416,16;shm_lpid:(5,56),448,32;shm_cpid:(5,56),480,32;shm_nattch:(37,1),512,32;shm_cnattch:(5,6),544,32;shm_atime:(5,79),576,32;shm_pad1:(0,3),608,32;shm_dtime:(5,79),640,32;shm_pad2:(0,3),672,32;shm_ctime:(5,79),704,32;shm_pad3:(0,3),736,32;shm_pad4:(31,2),768,128;;shminfo:T(37,5)=s16shmmax:(1,1),0,32;shmmin:(1,1),32,32;shmmni:(0,1),64,32;shmseg:(0,1),96,32;;segacct:T(37,6)=s20sa_next:(37,7)=*(37,6),0,32;sa_addr:(5,7),32,32;sa_len:(1,1),64,32;sa_amp:(37,3),96,32;sa_as:(37,8)=*(37,9)=xsas:,128,32;;segacct_t:t(37,10)=(37,6)SessionSTAT:t(35,1)=(35,2)=s48group:(35,3)=ar(0,0);0;31;(0,2),0,256;alive:(0,1),256,32;ops:(0,1),288,32;reads:(0,1),320,32;writes:(0,1),352,32;;TableSTAT:t(35,4)=(35,5)=s49152sess:(35,6)=ar(0,0);0;1023;(35,1),0,393216;;fdR:G(0,1)fdW:G(0,1)cmd:G(0,1)mode:G(0,1)wrcount:G(0,1)rdcount:G(0,1)size:G(0,3)off_beg:G(1,3)off_end:G(1,3)nbrec:G(0,3)asflg:G(0,1)aw_wait:G(0,1)p_cmd:G(5,8)p_sync:G(5,8)p_fileR:G(5,8)p_fileW:G(5,8)limitKB:G(0,3)limitIOsec:G(0,3)ID:G(0,1)Group:G(5,8)Key:G(5,8)Loop:G(0,1)Pcall:G(0,1)aw_term:F(0,1)opno:p(0,1)GoOut:F(0,1)signo:p(0,1)elapsed:(5,79)Perror:F(0,1)msg:p(5,8)Lwrite:F(5,78)fd:p(0,1)buff:p(3,2)size:p(1,1)xx:(0,1)Lread:F(5,78)fd:p(0,1)buff:p(3,2)size:p(1,1)xx:(0,1)Inits:F(0,1)i:(0,1)str:(0,20)=ar(0,0);0;127;(0,2)str:(0,21)=ar(0,0);0;127;(0,2)SetPosition:F(0,1)fd:p(0,1)pos:(0,3)Usage:F(0,1)s:p(5,8)SHM_init:F(0,1)kstr:(5,8)key:(0,1)shmid:(0,1)tabSTAT:(0,22)=*(35,4)main:F(0,1)argc:p(0,1)argv:p(0,23)=*(5,8)c:(0,1)errflg:(0,1)Tnext:(0,5)Tcurr:(0,5)rw:(5,8)sessSTAT:G(0,24)=*(35,1)R0:G(34,5)R1:G(34,5)T0:G(33,1)T1:G(33,1)Tu:G(0,3)Ts:G(0,3)Time:G(0,3)buff:G(0,25)=ar(0,0);0;10485759;(0,2)statbuf:G(32,1)RW_Order:G(35,3)pos:G(1,3)oflag:G(0,1)newpos:G(0,3)t_begin:G(5,79)t_end:G(5,79)libgcc2.c/ext1/SOURCES/gcc-2.8.1/./libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hmachmode.hgansidecl.hmachmode.defmachine_mode:T(11,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,QCmode:16,HCmode:17,SCmode:18,DCmode:19,XCmode:20,TCmode:21,CQImode:22,CHImode:23,CSImode:24,CDImode:25,CTImode:26,COImode:27,BLKmode:28,CCmode:29,CCXmode:30,CC_NOOVmode:31,CCX_NOOVmode:32,CCFPmode:33,CCFPEmode:34,MAX_MACHINE_MODE:35,;mode_class:T(11,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;defaults.hinclude/stddef.hptrdiff_t:t(15,1)=(0,1)size_t:t(15,2)=(0,4)wchar_t:t(15,3)=(0,3)wint_t:t(15,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;longlong.h__clz_tab:S(0,32)=ar(0,1);0;-1;(0,20)__moddi3:F(0,23)u:P(0,23)v:P(0,23)libgcc2.c/ext1/SOURCES/gcc-2.8.1/./libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hmachmode.hgansidecl.hmachmode.defmachine_mode:T(11,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,QCmode:16,HCmode:17,SCmode:18,DCmode:19,XCmode:20,TCmode:21,CQImode:22,CHImode:23,CSImode:24,CDImode:25,CTImode:26,COImode:27,BLKmode:28,CCmode:29,CCXmode:30,CC_NOOVmode:31,CCX_NOOVmode:32,CCFPmode:33,CCFPEmode:34,MAX_MACHINE_MODE:35,;mode_class:T(11,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;defaults.hinclude/stddef.hptrdiff_t:t(15,1)=(0,1)size_t:t(15,2)=(0,4)wchar_t:t(15,3)=(0,3)wint_t:t(15,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;longlong.h__muldi3:F(0,23)u:P(0,23)v:P(0,23)frame.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  ||<<o -0 700  A2GIIMIISII [SS$`SS eV V nVVptWW{W W W(W(XXX Jd|uiTlH$ ll- D";]t07070100007740000081ed00000000000000000000000147aacfbf00006b58000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/IObstatELF 4f4 (44   H""/usr/lib/ld.so.15H+F):E*-7@3GA?/5=>'%&!.;D 940,$12"8(6CB<#d      0     """""$ t <!D$000&x+8@!0hHF  \!b!h!o! t!{!\ !! H"!8"!t8@x(!,0!!!$ &  @!G  N0 [!b(g!n!u!h{!P _startUsageatoitab1tab2_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepabortatexitexitmallocputs_init.umultimeSHM_init__register_frame_info_tabletabSTATgetenv_DYNAMICprintf__iob__frame_state_for_exitenvironfree__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memset_etext_lib_versionfflushmainmemcpystrlenshmatshmget_finilibc.so.1SYSVABI_1.3libc.so.17̳0!85!(! )!,7!82!D!PF!\+!hE!t4!>!.!C!&!A!*!;!D!-!9!' @D# @EOG#@EK@, @ 0"@@E@@EA㿐@/E @   $? 2 @㿐㿐@/E ` @ 㿐㿀'DD'쀢 Gc8@E'쀢`Gc@'@D'0#@D'䀢? GcH@D?@D!  @D$" Gc`@D?@D㿐'DGcDGD@D?@DX'D'HD H@ H @@D' H @D b 0@D @D 'Gc@D0b0@D6 @D"  @D '0b0@DGc@D}'#  * * 0@  ` * * 0@  +  *`0  $`$  b * * " M * * 0@  +  *`0  $`$ 8 * * 0@  +  *`0 `$" $ * * 0@  +  *`0 `(" ( * * 0@  +  *`0 `," , **0 + *0   ( ( 0@+( 0 (#\+( 0 ,#`+( 0, +0 $$"'쇠"#d#h+( 0, +0 (("'쇠"#l#p+( 0, +0 ,,"'쇠"#t#xHx`$@Cz '`H@C`000@Cs   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @B* ?''' `      & && 㿐@/B   @@*  @    2      2 *@ @ :  @@   㿈@/B,  "  @B&@ @`@Bz @J z- @Bs@@`  @Bh 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @BC ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @Aɐ ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@A"@At"$&b""@Am@A0 ' @*!*@ * "`'0 &` @Ah㿐@/AX&`&`&@ &` @&`&`"@㿐@/A&`&` &` &@@&`&`"@㿐@/@Ȯ  ` `"@  @A'` 0 `@A$XL ؠ =  @@"7j'?$   ؐ  J zo  '  @@Ô"㿐@/@  ? ???㿐㿠m㿠DSHMKEY505### Cannot get SHM...### Cannot attach SHM... %s (dim) %s Usage: %s key timeout [reset] v.4.0 ID GROUP NAME OpTot ReadTot WriteTot Op/s Read/s Write/s 0 none none 0 0 0 0 0 0%3d %-12s %12s-%03d %8d %8d %8d %7.1f %7.1f %7.1f eh"""$  $("00<0H0T0`0l0x00000000000000  o od /     "|e  e 4 (L 8dH HTX - et - e - e( - e - ehH - eH - e - e8x( - ed      0     """""$x '"+"9"G 0] 0l""  $    dH$(L4'(8"HTS^gp{$""" t <!D$00 0x8@!hH5  K!Q!W!^! c!j!\o u!{! H"!8"!t8@x(!,0!! !$   5!<  C0 P!W(\!c!j!hp!Pw IObstatcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummyIObstat.cgcc2_compiled.frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.s_start_START_Usageatoitab1tab2_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepabortatexitexitmallocputs_init.umultimeSHM_init__register_frame_info_tabletabSTATgetenv_END__DYNAMICprintf__iob__frame_state_for_exitenvironfree__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memset_etext_lib_versionfflushmainmemcpystrlenshmatshmget_finias: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4, d"d,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$i)@h)@h )$4)$~)@})@} )$L)*<$d*O@*m@ *w@ *$H*$*@*$T*$*@*@*@*@+ @+$+$+0@+<$+=$'+N@&+Y$+Z$R+s@Q+}@Q+$(+$+@}+@}+@~+@~+$+$h+@,@,$H,$ ,7@ ,E@ ,Q$H,R$,r@,$,$4x,@3,@3,$(,(P$(,d.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpframe.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  dd/o -  7   A DGMS00[ ` $ e""n""t""{""""T$$h$  F+,}.0$ 0\ 88;:,07070100007745000081ed00000000000000000000000149fde4f10000008e000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/IOpatt.sh#!/bin/ksh # NOTE: you may extend parameters here # (see iopattern source for details) LANG=C export LANG exec /etc/STATsrv/bin/iopattern $107070100007747000081fd00000000000000000000000149fde4f800000039000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/MemStat.sh#!/bin/ksh LANG=C export LANG exec /usr/bin/vmstat -p $1 07070100007748000081fd00000000000000000000000149fde529000000a9000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/PoolLOAD.sh#!/bin/ksh LANG=C export LANG exec /etc/STATsrv/bin/psSTAT64_10 -O -M l -e -o pool,ntot,nact,usrtime,systime,rpcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1 0707010000774a000081fd00000000000000000000000149fde5350000017c000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/ProcLOAD.sh#!/bin/ksh LANG=C export LANG tst=`/etc/STATsrv/bin/tst64 2> /dev/null` if [ "X$tst" = X ]; then exec /etc/STATsrv/bin/psSTAT -O -M proc -e -o pname,ntot,nact,usrtime,systime,pcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1; fi exec /etc/STATsrv/bin/psSTAT64 -O -M proc -e -o pname,ntot,nact,usrtime,systime,pcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1 0707010000774b000081fd00000000000000000000000149fde53e000000a9000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/ProjLOAD.sh#!/bin/ksh LANG=C export LANG exec /etc/STATsrv/bin/psSTAT64_10 -O -M j -e -o proj,ntot,nact,usrtime,systime,rpcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1 0707010000774c000081fd000000000000000000000001455a4438000075cc000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/STATcmdELF4ql4 (44((((**/usr/lib/ld.so.1C[&,EK@5$M?-LS;!'J7#40C2N)8GZVF*9Y=QX /HW3DBT%:<.6"(+1>IOARUPh   &t & & ( ( *+H+P+X+`,)t)*H80 )p%,..T3*<:-@!?#HU( k*q)w*}) )@))(),*T* )L&t *`)X)P8,$$H**#-@)H-)7)=$(O)4U,!]*$d.@j*xo)Lu$l)d,( *.D( & +Lh*l)|& *0 8 )socket_startbzeroreadUsageatoi_environ_endgetpid_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepbcopyabortgethostbynamesigpipesignalatexitexitalarmsinhimNreadmallocsprintfbindsigalrm_init.umulfputstimemessinme__register_frame_info_table_DYNAMICstrncmp__ioberrinet_addrwrite__frame_state_for_exitenvironperrorerrnofreeclose__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memsetfrominet_etext_lib_versionBreakAlarmmainmemcpystrlen_finifprintfNwriteconnectlibsocket.so.1SISCD_2.3libnsl.so.1SISCD_2.3libc.so.1SUNW_0.9libsocket.so.1libnsl.so.1libc.so.1 zt#- zt9C =(M,"-@).)(/)4E)@-)LJ)X9)dL)p!)|V))B)+))):)0))5)Z)C*(* 4*?*$G*0X*<$*H*T3*`8*lU*xI***O @D# @FXI"@FT@, @ "@[@FI@FJ㿐@/Fമ @   $? 2 @㿐㿐@/F, ` @ 㿐㿐㿐 D@F#L*`: `@F 㿐Ib @F?@EP'D'H7c7'''Ic'D  'D В*`H @J@E  7В*`H @J@E А`'А * H@@@E'mВ*`H @J@E А`'А * H@@@E7RВ*`H @J@E !А`'А * H@@@E4#L6В*`H @J @Ew А`'А * H@ 'В*`H @J(@E^ А`'А * H@ 'BВ '_#L*`: 2#L܀   @E: "`ܒ @E1@E(  2 @E( `ܒ "@ @E!'؀ J`0@2` 2 ` @E  ܐ@ "  ܐ@ 2  @ 2 @D'Đ D@D D@D#L*`:  #L*`:  @D   @D"``Ѐ J`@@` @D J`H@`ܔ @D *@D @D'`@DȀ  @D  Ē  '  @Dv @D'Ē @D"@ JP@D @Dt @D!@Dk @ J`p@ Д$@'̀ J`x@s @DK @Dd J @Df TM @D@ Д$@n'̀ (* :`  `@D @D@D @D/'`@DȀ  @C @D# @C @D  `@C @C`@C @C㿐'DD@Da J@@C?@C㿐'D@Ca JD@C㿈'D'H'L#L*`:  #L*`:  @CDHL@C'쀢 H *㿐'D'H'LDHL@C   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @C6* ?''' `      & && 㿐@/B⨮   @@*  @    2      2 *@ @ :  @@   㿈@/B  "  @B&@ @`@B @J z- @B@@`  @Br 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @B ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @B  ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@Aʐ"@A̔"$&b""@AŒ@AƐ0 ' @*!*@ * "`'0 &` @A㿐@/A&`&`&@ &` @&`&`"@㿐@/Aम&`&` &` &@@&`&`"@㿐@/A\  ` `"@  @Am` 0 `@AjXL ؠ =  @A["7j'?$   ؐ  J zo  '  @A"㿐@/@⴮ ? ???㿐㿠㿠`STATcmd v.2.4 (dim) Usage: STATcmd [-k] [-t numb] [-b nsec] -h host [-p port] -c command -b nsec -- break connection after nsec-seconds of inactivity -t numb -- try to connect only numb times (default: 0 (unlimited)) -p port -- STAT-service port number (default: 5000) -k -- keep alive STAT *** NO CONNECTION -k-t-p-b-h-cbad hostnamesocketbindSTAT *** OK CONNECTION %d sec. NwriteNreadSTAT *** BAD COMMANDerrno= %d client pid-%d: %s eh*+H+`,((,+T00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t00000Veq &t &o o  h (  +\|e  e X4 (L 8H H TXt - et - e  - e( - e 0 - e#H - e$$H - e$l - e8$( - eh   &t & & ( ( *+H+P+X+`,.T '+H++P9+XG]l+`+L,,( ( H,L X4 0*(;+`K TVatj s~,&&+N&h+\+T)t)*H 80)p, .T%*<,-@!1#HG( ]*c)i*o)} )@))(),*T* )L&t *`)X)P8,$$H **-@!H%)/)5$(G)4M,!U*$\.@b*xg)Lm$l)d,( *.D( & +Lh*l)|& *0 8)STATcmdcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummySTATcmd.cfdgcc2_compiled.frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.ssocket_startbzeroread_START_Usageatoi_environ_endgetpid_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepbcopyabortgethostbynamesigpipesignalatexitexitalarmsinhimNreadmallocsprintfbindsigalrm_init.umulfputstimemessinme__register_frame_info_table_END__DYNAMICstrncmp__ioberrinet_addrwrite__frame_state_for_exitenvironperrorerrnofreeclose__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memsetfrominet_etext_lib_versionBreakAlarmmainmemcpystrlen_finifprintfNwriteconnectas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4, dX"dX,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$iX)@h)@h )$4)$~)@})@} )$L)*<$*O@*m@ *w@ *$H*$ *@*$T*$t*@*@*@*@+ @+$+$+0@+<$+=$' +N@&+Y$+Z$R+s@Q+}@Q+$(+$ 0+@}+@}+@~+@~+$+$#+@,@,$H,$ $$,7@ ,E@ ,Q$H,R$$l,r@,$,$4$,@3,@3,$(,(P,,d&.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpframe.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  hh  o `- 7    AG&t&tM&&S&&#[(( `(( e**n+H+Ht+P+P{+X+X+`+`T,,,`G5 9 :$ ;\ BxCV;D,0707010000774d000081fd0000000000000000000000014b98c6bb00004160000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/STATsrvELF4=(4 (44****8-P-P/usr/lib/ld.so.1SR  !#%&'(*,-0245679;=?@ABCDEGILMP "$)+./138:<>FHJKNOQ2 ! 1 %+-,4-P>+<C/ K& Q-W/]2=+Hb m,s"L {,-4.4,P,&$4 +%\ t D/ !++++,,\,+,h* , ,, +x-@* &+@%xP D/R,J@ Q.@!V.d],e1n4 x& ~$ P.@-,,+0-(,D+& .,  $ ,% X .0 ,8-T +2 & +<,,B+I,tP4 _environsinhim_Jv_RegisterClassessetpgrpstrcat_DYNAMIC_exit__ctype_finictimesinme_endcheck_charpopenSTATsrvfopenNreadfd_cmdforksocketNwritestrcmp_startatoiaccessstrchrkillsscanfgetpeernamefclosewaitinet_ntoa_GLOBAL_OFFSET_TABLE_fgetsstrlenbindsignal_etext_PROCEDURE_LINKAGE_TABLE_msgerrnoUsage__iob_edatastrncatfrominetkill_chld_initsigtermfflushinet_addrsprintfatexitperroracceptfprintf_lib_version__dso_handle__deregister_frame_infomainsigpipepcloseerrfdlistenstrncpycheck_command__register_frame_infosleepgetpidstrcpysigchldlibsocket.so.1SISCD_2.3libnsl.so.1libc.so.1/usr/sfw/libX ztgq ztg}ztg**A*L2 K.7//-+0;+<+H +TA+`L+l+x(+"+J++M++++O++>+,9,, ',,N,8G,D=,P,\ ,h#,tP,:,&,,%,,!,,2,,D,.- -8-H-(<-4-@) @D# @GCI"@G?@, @  "@@G4@G5㿐#/GH`  @  `@@`" `@$@``` ``@G`  +㿐㿐/Fͮ㐂`$ ` @F ``` `@F㿐㿐 Cc@F㿈@F Cc@F㿐Ib@R@b4@b4@@Fb0@b0@@F  @F @F㿐'DbIcDIc@D@F?@FX'D'Hc7'Ԃ ' 'D@e(`H@I@cP@F`O`'(`H@@ :@F'؀`(`H@@@F7@F(`8`bIcXIc@ @Fi)(@(`H@@'؂`'ؐ@Fb7@Fa(`8`bIcIc@Ԙ @FFH@`'Ic @FE` IcIc@F>?@F@F<c3`ĉ 3@Ԁ`c `c@F)$   Ic@FH@G   @Fb0 @@`J`@Pb0@c̔ @F` J`@T @E Cc@E Cc@E D`$@Eb0@ @EJ`8@6 ' 'b0@a @Eb4 @@`c@`J`X@@E`,b4@  @E`J``@'@Eb4(`8`@ @Db4@@En @EVb4@@Ef㿈/DD(`8`c@```'$'b8@@(`8``b8@@(`8`D(`8`@' `'?'㻈'D'H'P7L'D'@(`8``@(`8`` +@`'/''`a+D@@(`8``"D@@(`8`` ` D@*`"`'@ (D@' /@D'` ` @DJ`p@D`J` @D@DP @F 'IcJ`@D'쀠`J` @D@DP @$'b'' '"@D`(`8``#@D`pJ`  @DJ`@DS``` ''pH@D=` 'J`@D/`'`p :@D"'``@DL(`8`@(@`pJ` @D0@D/P @pp @C`f '@D"`Ja @D@DP @d'`Ja  @C@CP @I' @CJaH@C@C! @  @C/J`@C'쀠`JaP @C@CP @ 'H"@C`Ja @C@CP @@C'$Ja @Cr@CqP @@CeP @'@C('L'<JaȒ @C$``<`YPJaL@C<PJ`@CN''DD`'P!@C2`PHD(`@ Jb @C&D(`@zX`D'DD`'DD` '<'@@D@@(`@zX @B@`'@@C '8{Jb @B`q<`mPJb(L@BPJ`@B'P!@B`PHJb @BHL@'DD`'P!@B`PHD(`@ Jb @BD(`@zX`D'DD`'DD` '<D`D'D(`@zX @B?@B'88P'D'H7Lc @D$@'耠`JbH@}@Bo@B%@BkL(`8`#\bJbP H@Bb@BZ  (@BV/L(`8` HD'`!$@B!`@BD @q`@BD@A@B@A@BL(`8`#\bJb H@Ab@B㿐'DD@AcbJb@@Ab@A?@At㿐'D@AbJbȔ D@Ab@A㿈'D'H'LDHL@A'쀠`H@ (@㿐'D'H'LDHL@A㿐/Al`@?㿐㿠 㿠*** EXIT: got SIGTERM! ***%s %s Usage: %s [-p [IP:]port (default:5000)] v.4.0 (dim)-p STAT-service %s ==> IP:[any] Port:[%d] PID:%d STAT-service %s ==> IP:[%s] Port:[%d] PID:%d /etc/STATsrv/accessNot found access file: %s ## Bad IP address: %s socket-- Bind Error, will try again...*** READY for Service! ***acceptgetpeernameSTAT_LISTSTAT *** LIST COMMAND (%s) rSTAT *** BAD COMMAND (STAT service not configured: %s) %s%s%saccesscommandSTAT: %s STAT *** LIST END (%s) STAT *** BAD COMMAND (no access: %s) STAT *** BAD COMMAND (cannot start: %s) STAT *** BAD COMMAND (not found: %s) STAT *** OK COMMAND (cmd: %s) /etc/STATsrv/bin/chldPID.sh/etc/STATsrv/bin/chldPID.sh %d%d/etc/STATsrv/bin/ptree/etc/STATsrv/bin/ptree %dNreadSTATsrv-%d:%d> Connect -> [%s] CMD= "%s" TIME: %sSTATsrv-%d:%d> Exit -> [%s] CMD= "%s" TIME: %s errno= %d STATsrv-%d: %s -P.X.l.h.`.\.L00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oXq} & &  oo 8o  p oo+.,:*/-_ .T 8    & & & * +-P.(.H.P.X.\.`.hA2G .h%.(0& ?O j< J0 v.(.H.P.Xe .l.h.`.\.8 ?.T&` & .Lv.D .\,.X:P2 !X1_ s+{,-P+</ & -/2+H ,"L ,-4.4,P,&$4 +%\ t / !++++ ,,\ ,'+,,h6* L,R,Y, ^+x-@e* l+%xP /,@ .@!.d,14 & $ .@-,,+0-(,D+& ., 4 9$ A,H% X L.0O,8V-^T B+O2 l +,,+,t4 STATsrvcrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__STATsrv.cvalid.0__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START__environsinhim_Jv_RegisterClassessetpgrpstrcat_DYNAMIC_exit__ctype_finictimesinme_endcheck_charpopenfopenNreadfd_cmdforksocketNwritestrcmp_startatoiaccessstrchrkillsscanfgetpeernamefclosewaitinet_ntoa_GLOBAL_OFFSET_TABLE_fgetsstrlenbindsignal_etext_PROCEDURE_LINKAGE_TABLE_msgerrnoUsage__iob_edatastrncatfrominetkill_chld_initsigtermfflushinet_addrsprintfatexitperroracceptfprintf_lib_version__dso_handle__deregister_frame_infomainsigpipepcloseerrfdlistenstrncpycheck_command__register_frame_infosleepgetpidstrcpysigchld@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic 123647-02 Feb 2008as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.489.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.shstrtab   "o 8 8`-B $  7B 0 AB  KQ&&W&&]&&2**(F++P e-P-Pn.(.( t.H.H{.P.P.X.X.\.\.`.`<.h.h.d; 7$: O |NW:_q{\K#62HTSjFtcVQ)zaBk-Y}o7=LJ ,l,-/S S, S@ [ ] ]`adtd|dee_`9< z$H .? <cL/tS\zcx<l^q`xzYT0<Ҝ;d_z >p4"_?<b4z\,z58:_A1L`@!QPxHgtc|`D]  c^c { bLcPX`} ` _x"4<$+H2}=dM;(_^Xf^m^(rA4z`cac `\^6,l^A&cS|cp$}S :H(%},0D<\,E`,Q)X,Y`8_l0m`r?z(?<80p^^`tTcH `L_0b0PH0,aH"bM*!4@L?_F` N^LUGdfbDpPxTDT`hEt`c^|`I80<_X^d`@^@` 8_(_`P'_-`5<ANR\e`oQ(,8XX^471pɘ|z!x_l&W4ˬtx_!_+_ 0 >$M[<XDc^i sc|: _Q_$ltc9HPe]_%0`7">JR`X5@a^hDnAz#X ] S@ bH^p'4$>{ !4`__TT^ 0 #%4/D6a<_<FHM^S4\S, biͨsc~_Ha$#I`)\)6$``2X`ta`_socketwclrtobot_y16updatenoechosetkeymapf_freeTMPBuffshell_istermios_start_mbaddchcurscrisendwinreadcallocCOLORSgetFieldStringforce_doupdatereset_shell_mode_change_colorf_readTMPFileatoicurs_parm_errw32echochardeltermfreadwscrlendwinMouse_statusgetchacs_mapwnoutrefresh_environ_endgetpidf_initTerm_iob__register_frame_infosetcurscreencswidth__flsbuf_GLOBAL_OFFSET_TABLE_set_term_curs_scrwidthsleepprog_istermiosttimeout__ctype_use_env_called_beforegetHttpPage_slk_initabortgethostbynamekeypadf_signalfilter_quick_ptrreset_prog_modef_getT3CacheFieldsignalatexitexitimmedokalarmcur_strsShowDateOldcolorsaccessmallocf_initParametersprintfdelkeymap_mbinsshiftnewscreen_countcharDef_termparseFieldbit_attributesCOLS_initwclrtoeol_frst_strs_do_slk_tchwtouchlncfgetospeedmemSset.umul_change_video.mulwsyncup_outwchf_showValuetermerrcbreaktime.remsetjmpmbgetwidthcur_nums_do_slk_noref_delaySPsscanfcurs_errno__register_frame_info_tablewsyncdownIntervalmbscrw_endwindelscreenwcursyncupfclosesetvbufgetenvf_getDateAndTimeMD5Update_scrmaxTABSIZEwinsdellnstrncpyf_getSelectedValuecur_termputchar_DYNAMICusagevidupdatestrncmp_csmaxprintf__iobsetlocaletparmcreateDigest_useidlnstrcatioctl_setidlnwriterealloc_first_termgetWebDescripter_rip_init_virtscr_dgettext__frame_state_for_blast_keyswcscrwLINES_exitf_2ndProccessf_loginTerm_branchtoenvironwgetchperror_frst_boolsparseSyntaxerrnottytypetputs_frst_tblstrnewwinstrchrinet_ntoafreeterm_parm_errdef_shell_modef_toBase64_frst_numsclosesetuptermMD5Finalf_showHtmlExtentsnewterm32open_chkinput__deregister_frame_infoportstrcmpwrefreshcur_boolsf_3rdProccess_mbvalidacs32map_edata_PROCEDURE_LINKAGE_TABLE_fopenoutchcountmemsetdelwin_do_slk_ref_mbtruefcntlw32addchstrcpymvcur_quick_echoinit_acsstdscr_etext_lib_versioncurses_versionfflush_makenewwmove_ctype_outchmainCOLOR_PAIRS.divmemcpysetcurtermstrlentinputfd_setechoterm_err_strings_init_costs_imageResetlocaltimembeucwlseekinterval_finiwerasetypeaheadterm_errnorindexgetMD5StringdoupdategetArgumentsfprintfnocbreaktgetchf_1stProccess_mbclrchlongjmpf_readTermisattyMD5Initconnectlibnsl.so.1SISCD_2.3libsocket.so.1SISCD_2.3libc.so.1SUNW_0.9SUNWprivate_1.1libnsl.so.1libsocket.so.1libc.so.1  zt   zt & 0 =( : Nq Cz<`{K^Y^(Z^4^@^L^XX^d^p^|^^^c^|^{^H^^a^)^__ _1_$_0_<_H_T_`_l_xQ__ ___>_____5_`u`*` `,q`8s`DD`P`\``h`t ```` ``}``\`P @D# @#,@@H, @ ޖ"@ @}@~㿐@/ᄮ @   $? 2 @H㿐㿐@/ ` @G 㿐㿐 H@HcP@G p`@ @`  @ M<@4 M<@/ M<@* M<@% M<@ 㿐'D'H'LcX@cp@D xH@ D L@㿈'D'H'L'P@D@(L@cp@@'@/*`:` R* :`  /@ @>耢  H * : @ @* : @cp@?'P *H * : @cp@P * 'c@cp@㿐'D@\ @vX'D'Hc#\`4#`ِb#dِc#hِcd#lڐ`d#pڐad#tڐbd#xڐbn#|DH@jc#\`4#`ِb#dِc#hِcd#lڐ`d#pڐad#tڐbd#xڐbn#|DH@c#\`4#`ِb#dِc#hِcd#lڐ`d#pڐad#tڐbd#xڐbn#|DH@@ 㿐'D'H'L'P'T'XDHLP"""@"T@X@㿀'D'H'L'P'T'XLPTXx|`#\DHdhl\@\d@ @P"@@? @h@  p` hlPx#\|#`X#dThlpt@-L"@X'D'H'L'P'T'XXa5L` hl@lL `*l  @@L`|#\hlptx@ lL `*l`@vX"\d@ @|P"@@? @MPx#\|#`X#dThlpt@L"@x'D'H'L'P'T'XX` TL`@ @A 'X`6X"\d@ @:P"@@? @ Px#\|#`X#dThlpt@L"@TL`@@    @ '㿀'D'H'L'P!`ؐa@aL "!DH@'@>'@` P@ @!"@ @㿈'D'HD  @!H  @$#pDcpH@'cp *D@#p 'DD ;@''D 'D 'D'|D@['D* :` * :` | '|!|`*@*`* @$#t#td |@j'D 'xD@%'D* :` p* :` f'x*@*`*t *x*@*`*t * d't@'* :` ;t    * %#x * * *#t@ @x * * *#t@  d  @t 'tx 'x#t 㿐'DD@ 'D'H'L//!` #L@L#\!#`ڐx#dڐ#hH@hL#\!#`ڐ|#dڐ#hH@SL#\!#`ڐ#dڐ#hH(@>L#\!#`ڐ#dڐ#h0HH@)L#\!#`ڐ#dڐ#hPHh@L#\!#`ڐ#dڐ#hpH@#cȉ#$!`#ą$!hD#cȉ%$ƅ!p' @# "? @L  @ @ L#\!#`ڐ#dڐ#hH@L#\!#`ڐ#dڐ#hH@#cЉ#$!`#̅$!hD#cЉ%$ƅ!p' @ "? @L  @ @L#\!#`ڐ#dڐ#hH@BL#\!#`ڐ#dڐ#hH(@-L#\!#`ڐ#dڐ#h0HH@L P@KX@Fcp@E"!㿀'D'H'L'P'T'XL d @_' '耢 *@*`*L D@L n*@*`*L  d x@<` ha" hd@a"d"h"?H!@H@X@X@H@'P@P `H@\ T@T `X@ '{x'D'H'L'P'T @ @'   d@ #\#`D ` `@D@P@P@~'D@x'H@tH  D@nT L@dL  P@^㿈'D'D /@'쀢` 'D'a@2 @ 㿀'D'H'L'P'T'X P' ''"!D H@ 'D *`H ' *`: -  * :` "*`R LNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLN$NLNLNLNLMLNLNLK@NLNLNLKNLN8  *`:  ' 'D H@f*`H '@P@  *`:  ' 'D H@9*`H '@T@q  *`:  ' 'D H@ U*`H '@x'H  *`:  ' 'D H@,*`H '!@N'$!!`ؒ ' "!ؒ "! ؒ "!H@ @ L@4 'X"\"p'D'H'L   @!'쀢? b@?QD@'Ԁ  b @ ?B 7ؒؐ`@ @J7L  @@0@cp@ @? b@@?L  P@@cp@㽀'D'H'L'P'T'X bc"@' h\`@} @uD@P *`: $! @aP@! @!! @ND@(P *`: !! @:! P`#\LTX`@0!! @&D@cD @]ؐa@  @Zؐa@ؐa#!@PH"@Dڒ+@'쀢 6#@ *d`ڐcTXd@,'쀢 'd`H@ڒ@ 'H@@D@P'D'H'L'P'Tx ` x@'DH@j'D* :` 'xx @@ rx @@' *`:  '' ' Q'x *" * x *" *  @X@ 1x *" *  @F@'   ' *`:  '`LP@K ':x Zx Z @@\ +x Z @@' *`:  ' *`:  '@T"@7p'D'H'L'Pؐ ab @DH@'D* :` ' *`: ܒ ''@ 'Ԁ _'ܐԖ * * Ԗ * *  @ܒ@ ?Ԗ * *  @vܐ@''А *`: "ВД *@В 'В*@Ԁ   L@HP@BԒ 'p㿀'D'H'LD@3'L@/''" 䀢@DL@m H D @*D 'D '" 䀢@DL@N D 'D쀢 H D @*D 'D 'H *D8'D ax B@D@'!DB' @'''  @"@@S D@ @*: `: * D@ @ *`:*D *;  :@  *  D@ ` *`:*D *;  :@  *  D@ ` ?*`: *  ' '  @_"@'  @W  ,d D@ @*: `: * D@ @ *`:*` @ *  *  * < D@ @*: `: * D@ @ *`:*D *;  :@  *  D@ ` *`:*` @ *  *  * 㿈'D'H'L'P'T'XH@P@L@`'!@$#cHPL@cݒ@Xc@X@\@`'!@$#cX\@cݒ@7c@ݐc@T@ݐc@`'!@$#cݔTݘc@rcݒ@ c@Dݒ@] 'D'HD@X' @' D@9@' *`H  `@8 '㿐'DDD"`" DH"D;j" D&." D v" 㿀'D'H'LD 2` ?'DDL*`  " L*@DDD`" DDL2`@ "  @" 'L䀢 (`D  H@D D@['`?L  H D@K @'''`D H@ L" @㿀'D'HH @bH 2` ?'䀢 7 8"  x"@ 'HؒH {DH @@H  X@@'D'HD' D ' D ' D ' H @@`5کx  @ : @ @  '*`2` ' ':1V  @ : @ @  '*` 2` ' ' ې  @ : @ @  '*`2` ' '0os  @ : @ @  '*`2`  ' '=_  @ : @ @  '*`2` ' '*  @ : @ @  '*` 2` ' '*   @ : @ @  '*`2` ' '?Q  @ : @ @  '*`2`  ' '`&ؐ  @ : @ @  '*`2` ' '"=  @ : @ Ē@  '*` 2` ' '?֒  @ : @ Ȓ@  '*`2` ' '"W5  @ : @ ̒@  '*`2`  ' '"  @ : @ В@  '*`2` ' '?f  @ : @ Ԓ@  '*` 2` ' ')P  @ : @ ؒ@  '*`2` ' 'm!  @ : @ ܒ@  '*`2`  ' '=b  @ : @ @  '*`2` ' '0,@  @ : @ @  '*` 2` ' ' Q  @ : @ ̒@  '*`2` ' ':m  @ : @ @  '*`2`  ' '5Ē]  @ : @ @  '*`2` ' 'S  @ : @ Ȓ@  '*` 2` ' '6(y  @ : @ ܒ@  '*`2` ' '9Ȑ  @ : @ @  '*`2`  ' 'xs  @ : @ Ē@  '*`2` ' '0֐  @ : @ ؒ@  '*` 2` ' '=5C  @ : @ @  '*`2` ' 'V  @ : @ @  '*`2`  ' '*x  @ : @ Ԓ@  '*`2` ' '?;  @ : @ @  '*` 2` ' 'ِ  @ : @ @  '*`2` ' '#J  @ : @ В@  '*`2`  ' '?B @ @ @  '*`2` ' '!} @ @ @  '*` 2` ' 'gX" @ @ ̒@  '*`2` ' '?yN  @ @ ؒ@  '*`2`  ' ')/D @ @ @  '*`2` ' ' @ @ @  '*` 2` ' '=Ғ` @ @ @  '*`2` ' '/p @ @ Ȓ@  '*`2`  ' ' &ߒƐ @ @ Ԓ@  '*`2` ' ':I @ @ @  '*` 2` ' '5;̒ @ @ @  '*`2` ' '" @ @ @  '*`2`  ' '6u49 @ @ Ē@  '*`2` ' '9 @ @ В@  '*` 2` ' '蟒 @ @ ܒ@  '*`2` ' '1+e @ @ @  '*`2`  ' '= HD :@ @ @  '*`2` ' 'ʿ :@ @ @  '*` 2` ' '* :@ @ ؒ@  '*`2` ' '?$9 :@ @ @  '*`2`  ' 'V֒Ð :@ @ В@  '*`2` ' '#3 :@ @ @  '*` 2` ' '?} :@ @ Ȓ@  '*`2` ' '!aѐ :@ @ @  '*`2`  ' 'O :@ @ @  '*`2` ' '?9 :@ @ ܒ@  '*` 2` ' '(P :@ @ @  '*`2` ' ' :@ @ Ԓ@  '*`2`  ' '=ߒ :@ @ @  '*`2` ' '/N5 :@ @ ̒@  '*` 2` ' '  :@ @ @  '*`2` ' ':ᴒ :@ @ Ē@  '*`2`  ' 'DD@ " D  D@ @ " D  D@ @ " D  D@ @ "   @@㿈'D'H'L''L 5D  *H@ `*D  *H@ @2* D  *H@ @2* D  *H@ @2*  ' '㿈'D'H'L''L **`D H@ @ H  *@ H  *@ H  *@ " ' '㿈'D'H'L'L D H@ @* '㿈'D'H'L'L  D K* ' 'DD@w' j D|a D@wz @a@wr0b ##@wh'# *@ ' @wi 0'# #< ' @wLb8@w3b@@w/ @" P@w$" А@@wzh@w㿐b @wbzbvbrbnbjbfc(b'DD@wK'쀢  cD@v0   $@w7'` x@w%c D@vx @1a@v    #`@w'` pp @a@v㿈'D'쀢 D @vt '` @     @ @|@?㿠Jd b >"b"Ģ $" ,b,"͠ ,d?@ $b cL `0```  㿠i ز##L 2   L `2%`@  R  "`@c! 2  "` `@X!`Jd "`* @ @M$` @H ؔ# @B"l` Ā  @ @8 @Ԑ  *``* *"M 2   ށ?"`J$ @@7? 2  "R` `@!R`" R` @R``R"Jd @!`Jd "`h@  ,*@ " ,``,`"R 6 J  2 @} " ,` 2  " Д@ϒ  *`*  *``` * ؒ *"M @#* ` @ 3ؔc$ "c@ c$ "c@ W@ c% "@ M @ @uK , 㿠5ؒ J$@&*$ʰ*$ʁ㿠.` :  2 *` (*` @. (1#LR  !#!!i @r #L@u  , #L4`@ 㿠;%cL  @2  2  "J`? 2J 9"!i ,`"J 8 2 J @ "$ ,cLJ . 2  !i .  @0L ,`, c.Lޣ<`2 !S f!!_! )`\ Y"R`S`PR`@LT` 0  !i  @0c T!i  @ ހ)&`%`!@ c@g c@ mޒ@W hހ&X &Xޔ"R`6X`&XR`@6 X@ cX " p?@J cp  ! @? c!  !? @ &P!i @u ހ   @>  ޔ ?@  "2`"2  㿠#Lظ#  XR`D p"R`FR " !  @ @!i  @1  @ 㿠@ @[㿠؀#O#Li  &@@t)W LW bW h&@t"W NW `W h@@  4  @  @ b$@ %  @ aԔ@  @ a@ݒ   `T`t$  @В $   㿠T9#LR h@P #L@| #LR P! ! @@ #LT P @@/  ! @#@ @ H!i @  @!# 0!i @  @  @   @7  㿐#hذ#'L #T#l`l#L a耢 ށ!޴"R  *  D R` 8 u!b@   cT@sL@sHh$h $ #`l@s>@sG#`@sBT`R 6QL.` .&@J   "     ,3 @   8` @* :  @ O* 2T`JT`J 2 R @6   2T`J T`J`&@LL iT`d T`d  h&@ @ p!@   `2   `  @  !`#L ,`,     @ "@'``4  `_ ##\.`#d,`&@ 2  "  J3   , @   <` @* : $@ O*   @ il$'` \@{ '` `2 \R @6\d \@f '` @ Fl'``@ 㿠ض##L ``#Ta䀢 !􀢠"1!`( $ @r,@r5@@r0@r@r$  @r$@rW T$@rW H iW ^ *  W ^  &@ a@   ` `(@ ݒ $``4`(  ``@ ђ $4`` 㿈ذccL#d#laaަb`#\ #` @R#R#`  R#   R#쀢@  2#XR#X4`R#R#򀢀  R#  *  * R# & * :` `   !#, !@4#P* < ? 4b0 %!@q"` @q| "u\&`l" ,`$ 0` `, @ ` @%` ` R * < 4` "!   @q^l @q^"ء* bP`@"$`@"A `$`( "Ģ $" "Ģ`$" " |$"` R * d: 2`߀`"a2 ` R ?" #d`d 4 ! @a`$` ""` *```@* b*"M *` J` R` J`  J`  J` "J `* !ߔ  @Ta`$`` " *  J` R` 2; @p!캐`" 8!:  ` * :  #h!@pɐ @p '`!"   " h` '` `"4`;a, @p `$ `a *@ " $! "!䀢 !ߟa  @!`y$` `   `Ѐ   `` *`@ *   "1``   `̀   `` +  *`@ *   "``@p``2 ` *   @p ̀` 2` `*  `      ؀     *` `*  * `|   à  ` ` * @*`@@ * ` "` V "cT@ O`!\$!!$"!$!&`ؐ 2b0`&  㿠3cJ` ? J" "J`@?c`` 4`0 0`H ,a䀢 (& 2# J` 2 `P 2`<`t 2`T`X " `T " `` 2`<`0 " `<   ؁(b؂c`#`T`#`t`#a`#`<`#`P`#b$``0#`X `0`㿠…  !`"!"52@!N+@+?&  5ޢ `D @!Ȁ "` &``* "2 "`2`` &`D#LR 7` 㿠V  V *  D* G ޤ "@n$` "`@n'@`@0 ش `2b0  "`@n` " @ "@n$@n @n D`   @n@nɐ? 㿠. > @㿠倎  `" #L`,`"`#L ,@n ,` "`*  )3cL`,`"` #cL`,`"*`R#X 6   cL , `" cL ,@nρ ,` "`* @n`,㿠ذ# @n"' # 6Rl2t  "2"p "2"n "2"r   "*"w  ! n@nRl ! @n 㿠3cL#•  "&cL "&cL&cL@ (cLR` $a#R`$a#R`$cT#`$` #`$b#`$a&cLc`$##b##b##b###c* cL; +  ` +`@ (`` #` S 3`J `  K +  ` `` `  `"  "S 2  K` `K@+@  (  ` ށ `!  ` 82"  K K+ `ށ ` ذ#޲  `#R#?&`޴ؔ&޶P#"&`! "@mcĀ "!  &aa a "@mcȀ "w!  &a a` ad "@mlc̀ "a!d  &ahka 5ؐbTfbd"Pb bx^cXc`zd0%V `":  ` : @m.* A`.@m'&`@m.7` " `. @/ @m5c @m #` "cP@m, .`:"# R#@ 2# ?2#  R# @ 2#  R#@ 2#&"  $  "  &`ؒ 2#?&`J `J `` `" ?`(`?(`@?a@3'H`@l#в`N` #"#\?& &@l#ؠ-J )@l@l " \@l@l /*  N``*` /*`@ly@lĒ  "+ @ljc@lk N`,?@la@l    @lǒ   2c&Rc16##@lAV#\?b1@`@lN@lN$  \?b"@W`?b@!` y\?b@H`?b@B`?b@<`?b@6`?b @0`?J#b @``  %<@lS ؀I"c &@lL ؀?"c D@lE ؀5"c&,@l> ؀+"c *# ش"#!"##"#ߒ!؀x"#"2 \@kΐߒ!# "@k@k#@k#@k# \ 5?\ "ؒ " ئ#%@l  *%#""#""#""""""""H 2@k" 2"l@ 2$*$*$*$*$*$?"""""" $@kԔ 4@ؖ # 7b2btb2bpb2bnb2br  b*bw bnb  `3 ؔ?"cb"bb"bb"bb"b  ` `*& bb  ""#@k?ؠ# %$` L   *   "@@kv ؠ #? B$  66 6    ؐ$@2  : * @kT?J"L? E؂a@ h`@k;??a@`  ?؂a@#`?2 a@`?  ؂a#@`2 @j @j $` @jÐؐ c2`  @jؐ$c2`#f('`@  &``&``@ &:  ` : * @j @j1#b  * @"b J``   #"#""# "@@jc#3ؐ``("@@jxc#`(bl"@@jrc# $؞#pؖ#cK@ * # #  d"d#`` &K@ 4`2m\##R  J` R`  2   غ#pش# `L@*  "@j# @ "  * `2`@" ``* "$ش#  O* $    ` @i "$ 2`Ā " `@i $@* "$ `  *O\"# `h"e#`x"e#"e4#"%8R#2#@n6V@i ݴ?2# ?2# "# "#!2#2##@j 㿠ذ# @i"' # 6Rl2 "2" "2" "2"  @  bȀ *b  Rl`@iՔ `@iϔ 㿠ذ#3`  Rl@iĔ"# bnRbl@i` "t"" "p"" "n"" "r""  @  bw *b&  㿠cĀ 1! "c! , ,!@i <&?! d!@i t&?! !@i &?! !@i &?! !@i!&?!! @e3 >` N `  @6ƀO  㿠 ""N ``$2  N  <2  N ƀ N  㿠3cb  ?b?  @ @'c? @ c@@c"" 㿠3ؒ c @d"  ?c c"@d 㿠3؀ c"Ē ""c#*b̒ c c@d dc*"͐ c*d *bc*"͐ c*d㿠5ز" @dK@d!!@dv  $b  @d"?"b㿠7ؒ %4 2 *`3:  @ = @ 2  *  2 * :` > #R ?`* /@ / @# ??2%,??2%.@ @۔@ @ 㿈ش# b4 < #R b ' ؚ#p'*` &`& $ ` " `:` &` &`     " `@    & &2"4  !#\!#`! #d!#h!!! !@!] !ض?#b#"K  @S  @@4 @,@%$ ئ#p  2% ?.@`& @" Ē r ?@"S  ؤ#p @" $Ԓ ]?@ ` &S  $#" J `#"㿠. 1##:` , "4䤀 " e 1#e ?e  ?d ?d Q?6?6䴀 "*` " * R.V`@"V`堀 "  V`6 " 6ء*`c V`6#V`V@e " d V`6 " 6ء*`c ӔV`6㿠5L 2    #J$ 1 1#"`4 N` `4@"N` N` "# 2#@#R$!i 2`(# #\ "`( L@bH ,`(2` 2`   @L 4     N`  @*  L 2  " @@'D @ "N @N #p#LaR @ b R`R`#V V @ #tV #N * N  2 (N " (V t , (6 (V  ,  ( 6  (a`2 `2  (2`  2`! (*`* ( (2` " N ! (`@* (N a耢 " N  `*`N  . . N jtV @   @6& 4 " #x V    `" #L D`$#\*@#l*    #dD@#h"̒aJ  "#`2:?`2`<#`x' &#P"#|(`#`#R`#tp |W "p   W ? p p   W ? V`\\h `#`e + $ *` ``#``<``  @*` @ ` @$ @ *# 9  "`"@6*`   #  #  ####* ؔR @#4" #&n $%W #* @ " t!` @ @B#* @ " W t!` @ @1W ??V ?V 46 dP` d2 ?6 ! #R :2 :! #R <,2 <\h @`@& @`, l?" "7 ?6`#PR #` l `#ld`\ #d`h #\x#h@#`&p! J `* DJ *  㿐ސb   2 #h"hJ` "h  ! @{* ؐ#<  ޒb,d h " ` *`  ސ" J  a `*`ސ" R 2R 0bcL``8"`"R 2R 2`4#`" `2   ^•`i5 X#L  T  "`ؐ# !` !#D#L   2  ؐ# !ؐ# Jd * 1ؠ@ $1ذ#   !ؔ# "l  Ā   ~ #L *``* *"M! J  y#J  @ H#  "ض#i #J  " @  2` "$2` 2` 2   `,      ,`,   !̀      $    |`@& `2  2  `* *`  ̘  * `"` &`6 +  "   &" ` "`  2 3`* 6< @'#\  $ `  `&`   @WT @ 3` 3`  RZR` `@ ;`+`&@  * +`J@ 8`@-*@ b3`, @  c  @@ &`R" >    >`.`&J* ` @@  ``㿠ޕ. b>` `@ ;`+` &@   +@+`J@ 8`@1*@ b`, @  c 3 @@ &`R" "`>    >`.`J& .@ `@@   ``㿘޲"!V` D* R"" 0#L 2  o. #`       ؑ* c& R `#d,` $`"`45޷,` D #\R" 03``,  " i,`3 @" ,`#J  3* ~  ` 搠 ޴R",   慤V&dR"@ #J  @#L 2 `"i2  ޔ`ؒ #E #L `* " DR"* @ ``      ؑ* c'iR #`    &3a؀ 3cL `` 3첒 i` 3\5޶  ,i  ̀" ,ޣ,`V`$ D*` `4" 3`2>`3 >io`3 "" ,``2"bR⾷,  D*` ޴ "R" Z Ⱥ`V` D*`   "V"@& ޶"޴"3#J   . * `~ `夰 V` D*` ". V 唰 V` D*`   "`V& #J `J  v t 2"V` 6`㿠 a耢 `&`` .`@ b̰ @.``-@ Sb?*V""`V & DR 6"` D     *  6!"`&`&& " @6V`㿠. a`@ b̖`@ Rb S & `S` 3```@&S `@nޗ* b`@ Rb  `R a  &R`#J  @TR"i# <2"2"@"<1# D` 9!Ѐ`7J 9ހ 2W" 7GV⼵.`#>7"6J  "#@"#`D "aRbC"@Rbi"@"2`"2`@ "!R"@o 㿠#$`1#Re.`i` o$#?2%,?#2%." ,*@ " ,㿠V `@V :V @&  㿠 ( " @6  " @f  " @`  " 4@Z 4 "  8 `@P  4@OX 8 "   `@ON  8@OK @OE@OC㿠 ?@" @O/` *#""@"%4@O'  %4@O#"@O!"@O"@O"@O%4 "%8@O%8 @O 㿠V 8 ށ?"  " @V 2   @`2R`8V .&& D@N`  @N" 2`8`@`2R`8` @N @N D@N @NՐ af㿠@N$!ذ#8$$В +@V!!٘ '!ٖ &   *  &"#`4 #"HJ` J *` & J`2J"#"!؀ @N"#$$ؐ 2c? 3` 2` @2`&`"" 㿠ز##L#`J * ` `  Ѐ   @] ` @X А@6 < 6 <` `"  ̀    @G ` @B ̐@6 >6 >ٺ H @W` , @66  `  &W` 6``H/ @W` , @! 6  `  &W``   P@ 6  `"$@  6 `, `p` `p㿠 5ف!"#&pp㿠@M T. @Mx$D!"Ȁ  @N'$. @Mӑ/`$"Ȁ  @M@MDZ$ 444444 #LR  !   !@  , , (?, ,( (, ,( ( , @,( (, ,( ( `,(& 4& $0?4<$4 ,,,4$484:$,, $$@@M &` : ,P* : 2 *2,P?4H4J@Mtؐ 2b0 ""   `4" 㿠!#b$b#bĤ$b# D,#,b#,d?#$" 㿘3ؐ c H.cRdȀ   " 2dH ' NNʀ 2 H@'?Nʰ  .c' " NʐJ "Nʐ& @Nʑ/  : "@.ʑ/ 6 "  &㿀ؐc `HRJ#  ʀ#d R  6d , J 2 '` J "5`L` 2(  ,`@@* ""d`L`" ,`ؐ# R#פ&  J *`ΐ`' `R !Yؐb4  '#\' #`' ' '#% ?@??"?" " "D`""D2 8/"4 \"8    WR"@  * * @`ؕ*Rb>:@  W *` Rb<@  "  "bD` #d, J @: ' `L@ 2,ؐ# c RcS c S   * : 3 '* ""` @'*`* ""`"`" '4/`"`/``R $!cL2 d"D؀ "d!b8@2d4 "d " d@=d,d㿠ئ#`H &`@@. *`> &ʐ &ʐ& 0  0)` &`@@. *`&> #\ʀ P &ʀ R C  D T ? ` &`@@~*`. >&&p` $`& ^ 2-+"` "`? &`@@Y. *`> L&` $`& ^8E?@K@K&`ؔ"8 0\"0" R C D P"   R T" . 2@ . 2 .  2@ .  2@ . 2@ ? ށ(b㿘53"@Kr " @J.b@Ki  @J"@Ka Nb !   "?@Jؔ  @KJ  @KE @Jɔ  @K< @JNb `8'`@K3 Nb? 2?㿘ؒ# @J"? "㿠1"D1V"@ش `.5b4V>cL``. 45V< .@S!D S!F` S!$@  @ @    &S!$! `㿘 ##` 3 N N #d. . . P#T#\V V R#P   ?cT#\ J    od. . N     @fV &<6  6 N  . o l.`R#P.  Dy? dV V . . 6  D.`.  0 ,* ` ,`   " .`R &2  R 42  D .""Ȁ 3"  2   @2@ V 2G V &@@ْ ?2  V ?2:6 $76 ` 36 ` \@IV '@47?V `^+?" ? @$?2V ?V dV . . 6 6 N   @ !!N  . 㿠V "̀V "V $N N . . V $& V V &4V 6 6 " 6 6 V  @%V $ 6 V @6 !"̀2.  N  "N @yN  . .:  . ́ 㿠V V  "̴ V S?6 HR#P G* D*`  . P?2V ? D..&?(` "5'@ (`@  `#@6@(`        ؑ* cR @' ` D*`  D**` ' a 0!9"Ȑ"̀`V  &@"̀ |/`R & 2 " R & ?R ?2 &2 ? #L` "@#La 8 "p : *`:`   > :  + &+> * &+   *: * K :  @+  #L "9 * `@&*  ` *   `6& *: * K :  @+   /`R &2  2@ N  . N  "N @kN  " Á㿠 @N ."`&!?R 6?R @6?R @?R "2 ?2 H2 J `* J 2 `" 瑞?㿠 (2  "(?N 2$?V N N V $ . . V V &46 6 6 @+. N 6  6 ". @ . `" b㿠 @`/bV <(``@ ` @ V   K`  V :` +` V`@ " V V 46V@&6 `  &V` `@`2V < @`R R <@ 0`R R :@ 0``@`2R 㿠V## " `@@`@Gq &4`#` @Gg # @Gaݧ*`8`` * a߁ a* 㿠޲"V V 7V  V V "  `3, J` L N 5​  N   J` ~ J y !R  " @q !" k 4 "J!H c " * b2? 2@` R`@R` 2 Ѿ`4 `2,`L? ,` " ` R 42 ` R &2 `,!i `D@ "@`D@ "@` ,@ "L⚐`$ ,L !ؑ2 #  /  !i  L/  ,`, : L@F ,  . Hp"#|`"V #|""V V $& V V &4V  #t#tt"  #x"#"@ V 8"@ "`'@#x""@#?V 8 4 #h @ 2#h #h   V /`#\/`#$^x"`* : #l*`#p.`#`.`#d(`h(` ") D D" D"ސ" "#L 8 $ L`8"@L "ޔ$ cL`"@@F@pސ"\  &V6R@2@#L "l\62`@d@  4hx t"V " '@$N N #N V V #. . 6 6 Ɛ&@46 . 6 6 . N  . |!ހ " N t$"Ȓ @ @N  ސ"  b    ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @E1* ?''' `      & && 㿐@/D    @@*  @    2      2 *@ @ :  @@   㿈@/D$  "  @D&@ @`@D @J z- @D@@`  @D 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @DՐ ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @D[ ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@CŐ"@Cߔ"$&b""@Cؒ@CĐ0 ' @*!*@ * "`'0 &` @D㿐@/CP&`&`&@ &` @&`&`"@㿐@/C&`&` &` &@@&`&`"@㿐@/C  ` `"@  @Ck` 0 `@CXL ؠ =  @C"7j'?$   ؐ  J zo  '  @C."㿐@/B ? ???㿐㿠n㿠ETERMEscape character is '^C'. login: Password: GET/sysprop.htm%s:%s;%d,DatesysReadRequestsReads/ssysWriteRequestsWrites/ssysBlocksReadRblk/ssysBlocksWrittenWblk/ssysCacheReadHitsRhit/ssysCacheReadMissesRmis/s %6.1f %6sRrt%sysCacheWriteHitsWhit/ssysCacheWriteMissesWmis/sWrt%sysCacheRmwFlushesFRmw/ssysCacheReconFlushesFRcn/ssysCacheStripeFlushesFStr/s %s %s @Y%f%7.1f%*s%02d/%02d/%02d %02d:%02d:%02d%-*s%s %s Usage: %s hostname [ -l username -p passwd -P port -i interval -d -r] v.1.1sock errorhost errorTring %s connect errorConnected to %s. GET /sysprop.htm HTTP/1.1 Authorization: %s %s HTTP/1.1 Basic Digest username="%s" realm="%s" nonce="%s" uri="%s" response="%s" /tmp/T3stat.%dWWW-Authenticate:BasicDigestHTTP/,realm="nonce="ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=?%s:%s:%s%s:%s%02xMD%d ("%s") = MD%d time trial. Digesting %d %d-byte blocks ... done Digest = Time = %ld seconds Speed = %ld bytes/second MD%d test suite: aabcmessage digestabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz012345678912345678901234567890123456789012345678901234567890123456789012345678901234567890rb%s can't be opened MD%d (%s) = %02xeh TERMTERMINFO/usr/share/lib/terminfo/a//usr/share/lib/terminfo/.LINESCOLUMNSSUNW_OST_OSLIB/usr/share/lib/terminfo is unaccessibleSUNW_OST_OSLIBI don't know anything about your "%s" terminalSUNW_OST_OSLIBcorrupted terminfo entrySUNW_OST_OSLIBterminfo entry too longSUNW_OST_OSLIBTERMINFO pathname for device exceeds 512 charactersSUNW_OST_OSLIBmalloc returned NULLSUNW_OST_OSLIBterminfo file for "%s" terminal is not readableSUNW_OST_OSLIBSorry, . /dev/tty`ade[[zdx00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B S _ n S S,o,lo x  ]-, de2Kn,X `%K,XVMUJHLON     KI[RSPQT\]^_`abcdefghWijklmnopqrZstuvwxyz{|}~ @@e}#$" !+,&5MS7) `*a:f'g#o-q-s_x|~o,<+>.v-^h#i#0#4   liorkp|e  e G4 (H(L 8HtH HHTXI - etI - eJ - eK( - eL - ePxH - ePH - eQ - e8Q( - eSVR4unknownas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic 105405-01 September 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997@(#)SunOS 5.6 Generic Patch August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.plt.dynamic.data.ctors.dtors.eh_frame.data1.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstr ,   xo,l,lp-,,$ 7-- A//#@GSSMS,S,SS@S@[[[d]] i]] n``waa}dtdtd|d|ddTeeee.Pe r07070100007754000081ed00000000000000000000000149fde554000002c7000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/T3stat.sh#!/bin/sh # # This shell file contains env values needed to start T3stat collect... # # The key variable is "T3names" - simple list of all T3 hosts # T3names="name1 name2 ... nameN" # where "name*" is: # user:passwd@T3hostname # or # T3hostname (in this case default user & passwd will be used) # # DefaultUSER="default_username" # DefaultPASSWD="default_password" # # That's all! # LANG=C export LANG DefaultUSER=root DefaultPASSWD=root T3names="T3-3 T3-4" # # Don't modify anything below... # export DefaultUSER DefaultPASSWD T3names PATH=/etc/STATsrv/bin:$PATH export PATH cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.T3stat -Timeout $1 07070100007755000081fd00000000000000000000000149fde55c000000a9000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/TaskLOAD.sh#!/bin/ksh LANG=C export LANG exec /etc/STATsrv/bin/psSTAT64_10 -O -M t -e -o task,ntot,nact,usrtime,systime,rpcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1 07070100007758000081ed0000000000000000000000014a30e21700000071000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/Timer.sh#!/bin/sh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.Timer -Timeout $1 07070100007759000081ed0000000000000000000000014bb9814500000074000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/UDPstat.sh#!/bin/sh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.UDPstat -Timeout $1 0707010000775b000081fd00000000000000000000000149fde5650000017a000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/UserLOAD.sh#!/bin/ksh LANG=C export LANG tst=`/etc/STATsrv/bin/tst64 2> /dev/null` if [ "X$tst" = X ]; then exec /etc/STATsrv/bin/psSTAT -O -M user -e -o user,ntot,nact,usrtime,systime,pcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1; fi exec /etc/STATsrv/bin/psSTAT64 -O -M user -e -o user,ntot,nact,usrtime,systime,pcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1 0707010000775c000081ed0000000000000000000000014b9fcabb00044450000000200000001d00000000000000000000001a00000000root/etc/STATsrv/bin/WebXELF'(4>4 (#"44 44/usr/lib/ld.so.1   !"#%')*+,-.0259;>ABDEFGJLMNOPQRSTUZ[\^`bcfhiklmnprstvwxyz{}~     $&(/134678:<=?@CHIKVWXY]_adegjoqu|   6| /78t BRl M Z'(t a9` l9D vH}0\   1 Hd (   (\ $    j 4l $8(s( 3PP @ J, ILt QP@W2 _? mt}  V L< )0  H G \ = M4 L` 1< (T p!O$( ( 50, @FO5J` WL _(!g v n y8 )<  - s$OL0 K (N x |D$@ H F   &  /l6>Ud HhN\T,Y=| cG\ unh v d 4  2< :=@ 4=H, P  p|$( V  G RP@!Dt $+ ~|18T$ F8d W^9\D hF q{O  44  =t G@  8M4 0 ?D, :  <JP (x TD  K Gh0 "('Z a= 0D,:\ FXh P RMX \0 gO4 oC0l }("9H (h o 9 dx _ 4  -*lH LP 4L   d(! ) A G?pT QXm `Tgt(L t8 ^(X ~t (d x | p (D  xl  2< !'H 18< Fu R MT ]Nx fm$ `{Ƭ ^ @L Y)DL 0h  $ @ D-  t XN@ ( !{p , ZY4<i IP_( ]O|\ jrٸ z(    t` X_heap_freeX_get_cid_Q_addX_arg_string_sepstrncpyX_notfounddim_ORpattX_printfileX_startX_heap_newlowercasestrcpyX_exitX_CMPpattX_letAVL_removefmakewordX_while_loopyyparseX_CMPexecX_error_cidX_io_fputsX_check_dateaccess__register_frame_infoX_translinemktimeX_traceentX_io_fseekX_transvalueX_commandchchar__iobX_debugE_POST_parserfwritevfprintfX_htmlstrcat_Q_subX_optionstrncmp__muldi3X_signalX_avlcmpX_compilememcpyX_while_wordsX_get_valueX_finishgetlineplustospaceX_ERRMSGX_date_infofreadGETenvX_check_nameX_user_cmpTrace_Q_lltoq_Q_stoqX_fork_environgetenvX_io_fopen_Q_divDebuggettimeofdayX_io_fcloseX_str2dtX_errorX_actiondim_FREEpattunescape_urlyylvaldate_MONTHX_BASEX_stdout.udivX_usleep.divX_putcharX_add_valuestrcutX_unlinkgetpidTMP_DIRvp_SYMcmpsrandftell.remsql_errorX_free_cidX_todayX_includeX_sqltrap_DYNAMICX_while_valuesAVL_insertX_databaseX_io_pcloseX_select_sqlatoi_etextX_sqlatolX_ERRORstrrchrX_return__divdi3HTML_stringX_put_valueX_fflushX_add_Q_mulX_set_cookiesX_search_commandstrstruppercaseGET_pathlocaltimeshmgetX_get_baseX_take_stringX_io_popenX_noselect_sqlGET_parserX_chdir.umulGetDDTX_functionCheckEnctypeMethodX_heap_allocstrchrx2cdim_EXEpattX_free_all_end__moddi3x_BUFFERSX_user_icmpX_check_intdate_YEARAVL_searchX_cryptX_clear_valueX_HOME_edataX_get_intX_shmatX_fgetsstat_finiX_arg_stringX_shellmainvsprintfrind_PROCEDURE_LINKAGE_TABLE_X_cookieX_exec_callyynerrsatexitX_rowcountX_sleep__deregister_frame_infoX_setGetMethodmemsetX_shmdtputenv__dso_handlePOST_errmsgX_execX_PAGEX_replacetolowerX_trans_printfileX_dt2str_Q_qtosyyerrorX_valuesgetcwdStrLenX_headerX_BASE_holdX_user_fcmp_GLOBAL_OFFSET_TABLE_PrintTMfgetcX_sqlexecstrcmpX_heap_reduceX_io_vfputsX_sqlnamesdate_DAYCookieX_check_floatX_fpX_call_initmallocX_File_Q_qtollsystemX_xFile__flsbufX_clearisdigitX_quitstrlensscanfX_envEXPR_parserX_eofalarmescape_shell_cmdyychar__clz_tabX_io_fgetsX_found_Q_qtoiX_printvaluememcmp_lib_versiondim_LOADpatttoupperX_whileX_INSERT_ID_Jv_RegisterClassesX_ifrandomX_default_nameslibc.so.1SUNW_0.9/usr/sfw/lib =(0 ($(P#dp| F}) E$P0<H T`l^xKf'&-, ,c8DPr\bhat 3uoY(4p@XL/Xdp;|wAI*@ $W @D# @#@@M, @ J"@@@㿐#/X`  @  `@@`" `@$@``` ``@`  +㿐㿐/ͮ⠂` ` @ ```( `@㿐㿐`#8`cP @#`A@` c` (@D DJ0$ $$ ($ $ $ $ $ @$  `` @  N`/@@ /,* @@ 0/@r@s /,+ @o @c ?+ D"@C%`J0$`$$`$`$`($` $`$`@$` ! `@#@#@E'  `i)  + -/@"+`@L`-`@ ?` 퀤 #`8@cP#A@c``  @3@@4 ```7  +@m``d0 \@ " @.0@+0T@(c0@גȀ  @@@`@b @# : @ )'#`#8@P%A@``@D @D"Ѐ J/@-A@``!#"@F}c 2%J"@FPc/@Db瀢 @/0@"@ `toa H@ 0 [#$`8)` 8@#`H@ 6 +`)+@~  =(O8 #"+@w% @]@KtG` -@V@h@i@L +@X  =ܐ@^-@FP X"#`@3 J@+tGD#```%$`h@,@ "8x $`h@@  "8` $`h@@ "8'h$`@@ u8%p$`  @@?c#``2@CB@?@Ж @ې@`` #A@c`@@ 0@#A㿐! 'T'X'H'L'P`%;``?? ;BH#`@ː` -! p"1;` 7&D p@" ?0`@̐!`@7'`@ 35p@j`?; @`0a0㿈 @#``` `#`$` #`"+`$ . #+ @ , `"   #@ua$`$  #`'X'H'L'P'T`@;` 2 #! Ym ``W @O``F9 #` `'   " , #(`#*  .@  " a#@4' $ `@/H;` 909 a@@  @ 2,*@ݒ   '`$`9'`@ $ @97!@֐3@Ւa$`@` #`'H'L'P'T'Xϰ?9 `B;``5Ű `7 @ː``;9 #` `'   "+`$ (`#+  ,  @  " a#@' $ H@`@k``3`j9@b0b@t` @\  1 #`'`1"@```@G @i 8 @M@LbH5 `&`b(@@``@'  @I51P @.H@- !"$  k' 9;`9&ฐ"` @= f  D5p`(@/`@``(@'`@``(`?@V ;b@0}a  @`t㿐K l` ) + l` l    @@W @"` 2`@> d,  @= d ?R 㿐*   @: . *  㿐*   @֑: . *  㿐a   a` @x㿐#``#@  `$, @`&+ .:   @@4,``   X`#``'`)@x T@@M`@n K%@h 2`,  @   !+  @$ ,@ @`& +,;`  ,@9 Ғ@? ː`"  ;   X 5 "耤 ;`,ဤ @` `` ` ` @ @" .@ @ ``@``   @ <@  @  @ " `@ .@ @ @  @ `.@ @ \ '0Βސ [)7/ -/; "       !+  @$  * , 8`` &  `, ǐ@ Q@x`@ G+`@ 2`+  @  !+  @$ ,@ @ `& * ,8`  ,@X Ғ`@j `"  h   c `"뀤 `[値 `  Ѐ `  @ @2*Ж Ѐ`2 @@' ~π ? ~π`\"  @"]EX '  "u `o +~Ϛ +~!ښ 㿐 @a8 ?``!@   p̐ 0򀦠h0㿐@@ P 2 0``!x  00@& @=& (@ @> & @& 6 $6 6 "㿐  @u` @@ ` @&@㿐 1 T `%  " ,``,`2#`,  ,``,`2#`, @4 ?" $ ,㿐``G`T ) T C   " ,``,`2#`,  ,``,`2#`,`&?%``,@;8T T@;m@= (@/`2` &!@4D ?" $ ,㿐``.`T@; 5T` ``24`"24` `(@=@ @=?$`$`@ʒ 4`$`272 )T`"@`+ !W D ( 22` `"` @;J #`2 "B@?㿐 T@: 'R `2?R $`2   ` ( @`22@W @<ݐ&@i`  t "0 @<Ȓ &"㿐 T@:w "  ``bH i ` ?+``` ""L㿐c @, `   0 `"  㿐``  ı/```';`4` 5Ĵ`4 ``.`(``& #`  ĵ(``;`/`.㿐a܀` C! Ĕ *@a1 D``]A@0h`D``D` !@?`N#@`D`2 ` `2`A``*K"` ``DA``! `2@A݂`  ē+```# `4 Ĕ`4   ` `*` (``"  Ĕ #*@21`(`+  c`+ `D`: `Ac`@㿐 - `@<`@K`@4~.0|`.!܀`2"N/D``A`@bD "]!)!䀣 /` ؀`@` /)  4+ ``  +```#4`    ` `*` (``" %` + @"- D``Ac`@ ND,wbh )'A`㿈 @ՐK ʖ `   ""+ "+  @ +`& + `(`""`" p``"p @ ?,  0p`Ѐ`"@h b  ?@k @t00p`Ѐ`"@J b  ?@M @V00`Lp@2 G? @{   +7 -;   @@#b*`HO @` * :`@J@-M ` - ` 6"H"H @@bڪ` ?ނb@'`b@Ӑ @͐ b@ǐ !"@  )"@  ;b@  "c@  #@  )#@   @ݔ  -(@֔  c;c0@ϔ   + @ : <-@@ c`@z c -? :-@cx-? @x@}9? :-@w!?޴"'㠔@.@5#?ަb&@/?޺⤔@""\7?5/a <,  @E `1  @Ր@8aِ'`ؐ[/?ϐ#?, %@>?, ?@=!?,  L` V* @":`,@`L@  @? *  @=!?- `M` R (`     L  (`> ``7   K "+`'%?Y%?S#t #?T+?, L  * @‘;`,@`L@  @?4@L@L  (`c8@   @} : ,@b c@] c ;? :,H;?b@@db@`9? :,[?ު"Ȓ'@4@A5?@-@F @*@& B7? @n@ ``/??2 '?/5@   @@??#HM@ @Q (`:`@J@,L , ` 6"H"H"M @  _`p@  j x@    @  @  + +; :@ %?ހ @ ?' @*@  '`@-@ O@:@ @ @)?ޠ"@?*@@!$! J  ?8$! ?3$!c@ -?*@@ `'@k , ?, y)@Y /?  %`@Y@b#X-@? ,  V7@6 !?"1"`@6@?ِ`@`  b!?ޖ"N  ' ??   !?N :` +@N`'?@/?ހ4?#?b aN `:,,@ N #@@ ?ޞ@+??- @Ր?aؔ%@ِ(d,p0V"0d @  ])N    p ? (@ Nf+`< `:  (@ @?Y??ߠaM@ -@@ @9#ɒM@`  (`` ˢ    L (`: ` ``  0-+@F @] @  ?% -`?`:@ %??ހb@ ' ,  ' *  L :@ @ @)?ސ"?ߦa +"J `'c7?O@t@S  +9?N "' `:   `;?ߔa`  J@`: @` ?ނ(@ ``N' @?ިb+ d/?ޡ=`@. :`]#`T@4 "F @@ s ")?@@Ր{ ޒ0ܐ`' 1 @ 7? K "+"L'L    - 4-?L  +`=` `  -?->@@L`  (`@ L`@  "5#`   !@@ `@X 􀤠@9?߶! 1 #@  [%А@  M;`@: >`@{  .5@t  ) @m  /@f  5@_  !L Ԁ@7@t , @s?ޠ?c@C 9! @< t+a0@5 da@@.  $?'T'` @` &'b` @^1?ޘ#" aP@ؐ~H@  $5;?9b \'` @` &'9` @5+?ޤb@bP@^X@ =-B!h@ N`?޴#0%#J`?ޮX;`#T@2   *`+p+bh&5?ހ +)"H?ް#)` T?ޢ@x Jʀ`,-  *%$` #?ުcm;?ߤ`p @_`0!b '?ެ@?ߚ`x #@-ܐ̘"@+  @ -'@/  ̰ .  $"ϔ#@!? J@;@*@B/?@  9"h-?ޤ @)  !, V?! '?@7?߰@ c 2)?@ f 7?1!'L %@? ;?ߠ@?a`@@m@Ò e 7?ސ@ g 7?'L/@?@ R Ȁ`"R/?'xH?ߚ` @7?5?ޤ@T`P ?ca耣`N`  [ +`K ? 4%'A L.@` + 6`:  $`N  (` +``  8``(&`)& ,0 +``  ?*pB`"N@#@N2ʰ `"c%.@ޖܖ ̒ a܀`5#``2  +```# 4    ` `*` (``$ $`2 @ `"PD``"`@% `D``D`"``D`"<@ &#@`D`2``"``+@`e"`D +' &)A+a䀣 #/ @0`D`: `"`@ D * * `"ł`@ܐ#`?caȐ@  l?``?d ?  B3?`# @̐@1@]@@1N ! s!`   @@ $#瀤 $ j 0){!. t a u. . . . . . 3?`T@0d @0`T@3" (@]@ & ?cb@I  ?``s )? '`v+3?`# @U@1)@ @1!@8@1@0@@1@(@1 @ @1N  6 s` `  @ "\1瀤 `$5?`   +`` $B-`P @3`Ȕ  0}А"(.  t a u.`.`.`.`.`.`b;3?@#?. @ ?- $ )"h %T@/ '  @" 2 2 "'Ò T@/ @/͐ T@2T (@@` $` Bp B$ "  `  `@(  T `$#B!`" !@/f  @/T@2# (@^@` $` ?cbȐ@J  ?``Rw ?@  U?`@# @V@0*@@@0"@ߐ`@0@א@0N $ s     @ $ ! Ȕ  0)". t a u,,,,,,]?@@@  !֒?cc@ ?) `] ?  ``3? @͐@/@@^ @/@V@/N8 s`T@. d   "? %H@4 6#cP@. B5   ``@ M`(`Ȓ]#. t a u,,,,,,"Ȕ3?!A@M#`?䀣 #`' " 0)!A@;#p?3a䀦 #p@2) "H  @#?a䀤 2ؐ@Ԑ?ccX@  ?``R ?@  7U)?@ @@.@@ @.ڐ@@.ҒN - scH@ 7P@{ D   ` @k C`1) Ȓ#h. t a u,,,,,,)?!A@#`?1!䀤`#`' m 0!A@#p?!䀢#p@&@y?"1%䀤 2@ߐ?cc@W  ?``p ?  p)? # @c@.7@@ @./L R b@@ @.#L `w c@4@א @@.L ` ? s,  t a u,,,,,, @ /3`  ` @ F?`$'7Ȓ#,  f u- - - - O)?1?%AP@ +?@ 2*@ 2*  -  0 @ ۔?cc@ f?``B^ ?@ ̒ E%3?`@# @@-v@3`@-nL` $ s` ` ` @ $`Ȕ = 0 N#,` t a u,,,,,,칔3?@s$@ߒ?c` @% f?``B^ ?@ [ E%3?`@# @1@-@`@,L` $ s` ` ` @ $`Ȕ ̖ 0 ݐ 0,` t a u,,,,,,H3?@$@ߒ?c``@  z?``Yr ?  \?`# @@,@@Q @,@I@,@@A@,|N`+ s  `2`@ `@ )@@h @%$@, D 0U p. t a u.`.`.`.`.`.`?ȁ?c`@/  z?``Yr ?  e\?`# @;@,@@̐ @,@Đ@+@@@+N`+ s  `2`@ `@ )@@ @%$@, ᅱ 0А . t a u.`.`.`.`.`.`;?ȁ?c` @ >?#``#6 ?  ߒ`` !#1 d  3 `\"``&`X 뀐 ۀ`@J aq1?cha( @_ /?`Ȁ`!0?#ؖ ` 3` @+=@!E  :??b@aX @$ ?/`z ?  Z`}'?〒@+ @+Ⱀ@@+ a+L ^a3?c-T@) "|  l`]'?)?#@"@?, L@# c  @+@`L@ @@ @@@L@ ?1? +@  5< ꤐ!ha顒3?Ꙕ* "'?〔Ⱂ ! ! ꇔ)?`" ?#%{  2 bHq bH @a 6?``(`"P# %  @*A@@ "  5ޔ?bbx@  a?``OY ( XI`@*#b3?@ΐbp@.@ (?@ #?@N@ `; @ @ @ ,@ J @ ; @  ?bp@ , @/^@ ?bp@   0ː""A`?cbД @ }?#``]u ?  `c@)` W#1 T ) T `E   " ,``,`2#`,֒  ,``,`2#`,`3 1``,@(d T T@(@+ (@[`2` P"@!n ?" $ ,aB1踔?cc @* ,?``#? `  [1 " @) @  ??ccH @ '?``#X? ` #1 " ِ0?L0?cc@  &?!@# U#``" ?   `#@ !?* @( 쀖 0c葖܀1#@ g? *@( @ T@'{ `   @? %@2ϐc@] ##@V #@O #@H ##@A #c@: #@3 ##c@, 2y#%@% q?0硔#c@ $? *@( @+ T@' k`   @? @%@Ēa3c@ +? *@' @ " T@& "J`   @?@֔2#Y bH̒T c@ 5? *@' @Ґ " T@& v`   @? @1 "H眒 `2# bH璒 3c@ ? *@' @T@&| "H`   @?%"@a >@ , @'Z!?1, T@&W p` ` T@# T@&K [` `"1?3?@1? ! "H6 2# bH, c@ ?.@, T@& v` `?@~ ? @~͐@' `s!#@ 2*`T@& "`   @1?%`"1?H1? " T!"H T" 3bHגڐ c@~ɐ "!`* T@%Ȓ `   @~? #`N`" H汒 "?橐  ?" #bH栒 ?c`0 @~ 8?`` 8&?@  &  3?@@&k@~( @&cꪒ `?3?@?c`` @~J ;?`` h)?@  ) { 5?@@&&@} @&   ?5??c @~` -??@ % = !   @~2?1    0Y! ۰ ?c`ؔ @}Ƞ 6?``$. ?  21!!@} 3&`h5@}(  "`h 垐 ڀ !?ca8 @} ,?``!H? ` 1   @%f@}  d??cax @}N 3?``!"?  ! 1  5?3`@}A   @}w0 %?5??ca @} 3?``!Ȗ"?  ! @1  5?3`@}   @};0 ?^5??ca @|Р M?``E ?  21!"8@| 3&a/ 䯐"〦 %!bP@|  5& b`@| " 0  @|h ? "0 ?cbp @|w 6?``$. ?  21!"`@|Y 3&aܐ5@|Qh  "a M"xڀ Ô!?cb @|5 4?``", ? @ k21!"`@| 2&@5@|h  &@ @ "܀ ピ!?cb @{ ް?``yְ ? @ +'@{@ @#ؐ@@{@#ВL @ * @{;`.N`L` * @{:, L  (@{f ">'#8@{_ "7'!#@@{X JcP@{Q c0@{J "o)#x@{C "v1h@{< C0@{5 ]!# 0b @v"0@{$ )%$Q @{#x  ?1&!F  ה0x@{  53&`h7 (@{  #$`h, #@z =!#@z c@z #0@z " %!  #x@zԐ D '$0  &! @zŐ e50@z )%! @{?d@z   c,  -@{D@" а L`̒ @z%r@{3Pð @z ")5@z "1c@z~ '$P@" Ec  @@z@z > #$P$`0 @zŐ@{ 0c@z\  #c0@zU L!&@ 2`ᗒx@zC z #!o @z8c #0@z2 $`  0@z( )'| cx@z  1 &!L '?b @0E@zx 2'? $< #x@z  &@2 8@y O X@y )G  `@y 5? h@y 17  p@yې 3/ `x@yӐ 2' ?c? R@yɐ@`@"@0?c` @y 0?`` $  p5? ` @y@!Ґ@  …G?c@9N@`<2?N` @ ?   T*@ K``> ` M Jl+ + *ll  -@"ܐ`" 2 @!`d,`  `d@ Ѐ "'R `)8#+o(``@1 !8@yn ``O/g  C: `"] V`  O  F  =  4 ؐ# + ϐĔ " Ɛ|    L  Ȕ  @u  @   -@x % 2d5?װ (@xΔ  t%Y;ǰ '?㸢``+?!"3+?c@ @@ @  G@k  =@ x  3@ n  )@  { F r @ d h  @  ^  U % L  C ;c@x8 ' )1 -?ߪ` n#`1"ߝ@ @w cH@x  `  !?#`Fbv`  O   ܰ  `@wѐ wϰ )?#` #` 1+`<1 5߸@w?2 /ޱ `ؐ@w I`2Q ?מ` ْ "3%3a@w  `h!@wx!(  ;'`hx #a8@wo  1 ]h ? `쥒5/ࠒԔ@Q@wP q I "p@w>  %%7 !?#`t``"3'ࠒޣ3b`@w )%!+@wbh @ #$a 'x@w  #` + ?ϰc` @-"?5o?`@v  @w50!@v۔  %԰ ?Ǻ#`` +?'ࠒ@+?c) @vД  @w 0#b@v 2S1 L ?# ` /`ࠒ`@v 2&%@vh  &  |  va0o#h4#XaUbZaSMLc` 뇒7"bݶ`2 d  @u %!$\$ `#X! pݛ0@xـaH Ȓ.(lL pL(d<xPX0 |X4?a؝) `'H? /؀` ??H @v  +`D`+-?Ha`"&3`@u! 2a` @`  2a`< 0@ 2a @`L 2a` ]&``:3`@uY '`D!@`(?H 0`@`(&`&@0 &`@u` !@ux``D&a%`D@ `@uʖ@`+ `2` d`2@@u5ؘ %؀-? `T@J   @t  @t@u4 @u@u / 2*L ? /,,bВ e%? 1# `I``@  ``@$  @ @`&`*`,@8` ` ,`H/ 2)`\`" )% X#`\ت?%%&`  X`` `"߀` Ҕ؀````  H ܿ ܺ?!0۶! 6AP@t c!A#a䀣  +a] [r?+#ܓa? `T@ 2B `+; }``̐c`@'᠔ @t;@nbH'  g!0 -d! Aa@tB "A䀣 `  !?`D#`c`@s0@s0`#b6``?c(#``'H? #' -`" 3`       $ ` +`.@;` & ` `0,`e3``2 X`2 H( `(@s  Mb0@sٔ  "$X`" "@X` X  ` ̀```30'"`@s   `$X%\``" ِp2` H`X`\ۙ"p ?cHbؔ @s ?+`` 1?;5?#`d$'`d 趒?#`"!?#@a@s3 ( 2*#`\@Z   "  1@J T T @~`" `,2? @s ( c@J @s )?㬘 @ "* P!?#- 0 " @T`5 :``z@ @r@`@ ݔ@r0 "ִ@sM , Д*  " @_T`" c8֔ ` "+ #@`T`T@@~(@r2?㬢@. 7@'T , !?"`#'`d%;/$\'`X%`( ڏ" ڊ#h7!?@CӠ+` "1u#cr`rcP@r?#`*. @ K  @r ``!  #  0 ?ٷ`0B`1` `P?c# $"T0"`P?c# "T@q` #   t11 8%L`7L +` )!`` $+`1  *?"@  *%B#` 7@r`0  P?`b"T#` @#"  P# `T@ x  m&X`T@ r `L ` ``T@ } J` @L @1BL`p@qN %0 kP? "`T`#@q;c 2H1`!1##@q-+%  #F` @  @q<$NzB ఐk '`` `  4#ՐH/w *"H~ #%cƐ` "H}  ?c!?)% T`ؐ@qL` * @p:,@`L@  @? @p %a쀦 `@p  \? @pؔ  T!!@pє  M @ F ?@` ?+``` "#$`L5  @ِ0'B1`!H@ptP?% T?#!@pf#` %ؕ#  ?!׌B?ca @px F?#``)> 1?@ 宒 -3h` !5L @p .`   I!Հ "   #a=ސb׳0с?cPa@p'  ?1 `nf? ` Z`i%?@@oڒ ( 2*) \@+ Z`l$$$ @oǒ ( "9  +)-b @I"(`'@o .@&@o @@o& 0`&b @$"(`ݐ   0&ײ!@$ "#%? (@@o[ @@om$$  \@㿈``<`T'#$X$`\@  ",R $2( `"$ '' `@$ $& 7 `\ 23@`$X3``$`$ $X % \! 0L"P ?c``?`T)'% X$\@6  . R $2+ `"'?   & $\ % X@{ `@ #`` $% X$\Ԕ 0 "xʔ # 㿐``#%$X$`\ &  `\`"$X` $X$\֐"# ?bbȐ@nŔ  z?'`2?7? ``V7?@ 2〠 @@@ $,3c@nL ?7@nE 250<W8 ր"}0, 2$#3!$ X&`\ & ; `\"$ X1 `2 $ X$`\"ה7?0bQ3?c``'D'H'L'P+?`.? 'L $%#`$X$`\"@  +?`D H@: f?/219 ?@L@ " 4 +#?c`%7hh`U@ @m: ,  *  @ `OP@  Ζ Uܢ` p9P ' L@H7\ 2z +?;`'`X D H@ך  ?)"\#`Xn% #`܀ LCP@m: ,  +` @ `$ #h@՘ @  | 4 ?@mG ;-@@+?`@mA@cHe?#0x[9q#0+?= 0\-?/  M9P ' .L@HH7\ +? ?3)&`"\#`X% ? @g0/B%?/B-@l'P | `T#9#@lc7 3+``)#ԙc  b#cc+ ?c`@m  ?+``?# `6```) @lOЀ  Г* @l̑:`, L  )J1% & T`0@l  8@ly X@7??\p    @ƚ V@ΐ! 0`2})BaH @li`P?`v& Tg 7?p? \@ @L- @l6,  o  o Fj o r@l`@ ?cT 2 - @d @ #`% c @k,  .  . 'H4MАӪ0@!+!@k#` 2 +  ~c#)  $ ?c``@k  ?``c[?@ `2o@@k b#%  ` ` @k "@`$'!?@ ` `  `) @k A3@k #$7?@+ҭ`#!`D!$`D$!q $!$`D- j( ӓ p'#!`D!$`D$!U $!$`D`ҁ%`v?ca @kc  G?``0(? `(#@I%@k $'1! D! & D$! $!@k& D  ,!(΀bҢגP#1?b'Lax @k  a@k  -?*  +` c@j`  ,@ %?@-L/  <@ܒ`̶ a@j '@jḀ |!@j} #@jwaȀ Вa@jp #@jja؀ a@jd " @@jd@@@j\`@#?'c`@jcX@j@@ &`  "  2  ?"%` nb0@jk "  +%`X  @j]  2 .L LWZ@j " @H@j@@@@i@8@   @i #@iߒb 3b @iِ " ``#0@` "@! T@  x` `` PbX xLtr a@i " @@i`@ߐ@@i @א@i@i@  J `?L  %?@ 7 ``2U   $ ` +`;,@ &` ` ,?)瀤`X@? -@i  #`?ÔL "`(@i{  0@it &2$`X )"pm`X``"d`X]` "`;`T`b`@iH   '$\$`X  "`А"b@i3  1"w` rLq`'Ф "E <,@@hݐ@h@hא@``8 b 3X`2  "1t"А`X 2 L̖   )"`@hِ "  -5%\m&X@h #@hb 'b@hz " @@hz @ T@ Φ   "b@h] %@hW )"@hQ 3@ǐ   " #bHЍ cϊb(@h6 #@h0c @h*c " `@ (@h #@hc0 c0@h " @T@h  ͦ #8@h #@gc@ c@@g " @9!?#x@ @h   < @ @  H@gې #@gՒcP ?cP@gϐ " @%?x@@hk   )<@ @ @@@g@@@g`@@> @T @P ``"3 Hޒ- 㼈't`221% kX@gp@hp ~?1<  w?`i!  Ә#2#`$t%ϥ1 p`^t@gq@g / r / x . e o** * * * * * * * %5@gޒ耢 ><  80!  Z##`)& p1#g0#ccX@g%"#hUP#hːK#!#F!㼨@f`!x@f`@g1 g@g`!@g @g!` !@f @g @fԐJ   ' + - * L` (`;`@`/*@f  4 L` ! `27'@g>  1< ) @/ ```@f . 0`(@f`!``Đ#0@fr̦@@`(@ft @`(&`@f0hήɐ`"`!#Υ`@;``@f^`0 @ff@f` :   9+`P @fM! `@fL "/)+ '/-a8@f- p@f$ - p d@f7 x pa8@f9M p   p`@fࠒ 8    2 @f$#@f a`9a`  %  /@f "%1 `  Ma8Sa8! $ |@eِ`?#/ |$`x ` ;-Ѐ` И  , @ ` ` J@ ", F@ , @ `#c@ `T % p $t`T#@ c  p # p pt q%0U!a0Ԑ!8@e`0 ;@@e X#%@eX T')!p@e 9+`P @e{! `@ez 1)/h@e[ 1) p@eZ M p+ B pa̙`>`͐09`ؒa8`x͉ pq-̇0P@e; :- 8 0***axu)aPh?c!Ȁ .?@'/-+@ S@e `Ґ JH@db0  <@@ 6!Ѹ" N#?/-+)@ !?@d Ѡ J`*@d0`"`@ 0!~@ƒ@@dn@j@@dڠ?(`9J?B' ` Ȧ  !@25% ;#@ N`#/`@@d  A@ @@d۪,@d֔`@d?@`J   `$' a #  1!#pJ@ - @`/  $@,  ? Q?-`l   `/`3B` &`%p#8 "W ??UK``1J  @ J` >`>  d  `0?#J$`᠀2l?? @ ?А  ! -"&  %=MU ؀`1> cpL /J0  2?`@@c0ᜀ8 #a!$!x"#axJ`  !x#!xJ` axL !%!% `Da' F 8 @ c J?' ` >`> f` -x %x@d !x!xM 0;ax$ax!`$!xax@dJ@ !xaxK@ .y$ax#`@cJ:ਂ!%᠀`"a?????^% 2z??@ QC #a 2??@ Gc 2??@@?a`2??@6?,?a`"M ??(% 2s??@?!`2M??  @ 3a 9??! c8 T JN%`#!x `$!xax@c|J@ !xax$ax-@c #a J`;;{! ޘ` ? #@????@cX?p????@cO ??@cH #@''@cB?T????@c3 ??@c,@b̐#@'???@c  ??@cҠ? ??#@??Ȑ@c? ????#@@c? #@????Ȑ@b} #@@bk@bM "M!x` $!xax@bJ@ 2!xax$ax#Ȓ`??@bАJ;`ʂ!0axMxax@bM axax $ax! $!xax@bJ@ 2!xax-$ax3 7??>> <<dT㿀 ##!@a .@ ,"!a@`&@??@b}&㿐``cT` cT @a `,` 200 ڐ!€ % `!X#`@at !?@ @ @x3  @a 2 *0ɢɞ0#``:@aD` >?@  @@ `- - @a7 (?N@   "@(`;N@ ` @ +`< @ 2 .@  N@ `@   Y!xS0с!  `!-a@` +?@ 6@ 3@ ؀ͳ  @`@`"@`  00 @ 6*@ ?Ђ`` ( *@ `2*@ J`-2 ?*@ `@ & *@  㿐@`   N Ѐ`.`` (   2 N-2 ? &   ?@` d?N `-`?N  -\X  ?В ` ( * `2* N-N?* ``& *  h ?Р ` (* `"3J* ``& *  x ?Ж (,@ `"&J,@ ``& ,@ @` ? ?@`, #ct@  ?2@ ` `-"* ?`-",@ ?㿐@`# @6  Ђ `` ( ```N-2?@&  `@`o@`͐   lb@` @_ @ @` 㿐'  @_  >  #, ` 8#a<2` ?$+`ᤘ$a@ a*@` a*`$a*@_Ɛ@` $@ !%+`@ $ * @ @_ʒ(``@Á@`@$a'㿐#b0@_Ґb8  , | ?, @_  ,? & ,?㿐``[b`@_] Qh@_W ?p@_Q T"x@_K V@_E Cb@_> <b@_7 "5"@_0 b@_)  @_" 4@_: &0`{  v?8o@?P"@@^2 ` h8X` Đ S @^ @^׀"@^ߐ @^ْ:` @^Ӑ  b@^̐  @^ƒ?@0`% b@^ " "@^  @^82  @^ @^` 1"㿐``;b@^  @^ m k?@^ "@^y "@^r b@^k b@^d E@?ƥ#< :?"@^O b@^H  @^A  # !? ` @^3  "@^,   ?@^! 1#(i㿀``?'B'b@^  4@^ -@] &"@] 0@] )1"@] "3b@] 2"7De c? \ #H;M K?@]  9L? =?"@]  b@]  -* (?b@]  "@]  ) ?b@]  X ?hŒ@%;/-+)'$%!%a%%'a$@*`X#8`?`1 9(`#c@]    c@]  #  $a jЖ   +/?#@]`;(. ?$' . ` $a@@*` ". $a $ac@]N    c@]F  $  $a qА 8  /?+#@]C`;(. ?$' . ` %! @\ @]9@]. . .  .  .  glN6c@\    @\  #  $a qО   (+#@\`(. ?$' . `  k%a㰠 @\ Ȑ@\   А@\   #ؐ@\    @\  $  $a bВ `   **?c@\ (.  ?$'. `  %# @\F 9#@\r    c@\j  $  $a +Ж   +ظc/?ؐ@\h (.  ?$'. ` %c @\  @[ @[`@\%   @\    @\    @\   (! $a Ђ ``   *К+c@\ 6`= 'a @[ @[   (@[ؔ    0@[Д    8@[Ȕ  ! $a nЂ ``   *њ+є?W$@. F$a @@[   H@[    P@[    X@[  2@ $a Ђ ``   *Қ+Ҡ €`Y  `y `A`ay  $aЖ  /à a+Ӡ mà i||||||||||㿐a6a6@a63a61!7a7@㿈'D@[D/ / / / / gl74 ` ,8'''''''@[_&@[Y 쀣@q&㿈 &  @ C@`2   @ ?+`:8+ `?''耢 "8 `*; *`    J&^$#""$` `"N `"I`T`":. d ``2  ` `+`< `#T ''耢 "%`(`;``.`?C @  J$/$"# +(`/ ?+ + . & % .` * . "#. (`2. *  , . # ` `"$@&@"㿈"@@ @ & @ _'耤 $ڐ ``' '耢 "`* ?; .` Ð ?J`2&"# *``?+ `2 ```2\&&?`"V&N`` c @`2&@ &` .`&N``  '耢 #@`, ;  .`?o? l  J`"%&`":&# ` `"&##J `"%`1`"* K?I??+ ** "# ?* @ ^+ ```2+  , * "# *(`!?2* *  . * #@ @"& # $&"#+(`㿈`   € " @耢' '    耣 'h`` '@ /  ` `@ % `€ "@ @`' `'Ԓ  @`'`'̒ȁh! ``' 6? € `",?( `` x  @`' 'Ԓi6 ? ' '̒ȁh! `` `'@ &`&@.`9 ` h  ` `'```@ `€ @ ?0 @@`'`'Ԓ 6&`@ '`'̒〢 J` # +`8` +` J ` +` "*@ *@ J ` " *@  J ` *@    +` 㿐N` J/`>` /` N/`>`^ >:`{`'" C`[`"   /`.` .>`+@N N`>` @`?`?+@ O`\2>`. Ѵ }`{`~``2˴ ɵ>2Ǵ ŵ>2ô  ]㿐CN`"@NN ` .8`(`8`@`N`/`  `+@N  (`8`/`8`@  N`N ``+@N`v tN` /`>` /` N/`>`^ >0/`>`^ >0`{`'>M`[`"2  /`.` .>`+@N  N`>` @`?`?+@* (ڴ }`{`~``2Դ ҵ>O`\2>`. /` | N`dr2 >2  ]㿐@V  !@V&  ! &@V`R ɐ  Đ`@V 㿐%`J`X a7`@T @!  2T @V \!@V@$$@!T @ @@ `B4 T @ '   "@ /4 @V =@Vw 4@V `&6 $`0 `i "`_R`"a!0Va*aXN:Δ*ax;`F!C А 㿐`` 2! 20@V-$ 2   @V"$   2@V0?㿐``  ! @`20`  " $ @U$   2$ ??㿐``!??㿈@d!@Ua `a@Z0@U@ U!@R"h@U'G'쀢  : A#P ` 4+ c +)@ @3  &@Uz = "*`"$ A쀢,` 2 &#P@,$ `ِbx0դ&$ ~߀#xb"J#`?㿐@#@Uc @ 㿐@#H@UcX c` @U` 㻘-`#@U ch ( %AP0) /!*/@B@Tݺ @Uc@T#x@T@T'!@' 2u/` yc@U  J "   +@`K "  -@@T@T /`&@Tǒ \c@T "bJ  `"   *@`K "  +@@U5 /  @T@U- \  @T/ O0`!@ʔ O`!@!@" `!@ /`' `& #cc@T 2J   @T !@ O2 @TЖ @T   # ``)#Vcؐ!@a`7K0 0 @T )@T #x!A@T) !#P@T ` @Ta  % @Sch ڲp-(  8<`P O0`"L@S`@SƐ@S@S $ @S˒)@S p!@ O2 @TA@S@T  @T4 @T   @SsĐc@@S#`xJ##?@S@Sߐ  @T  ;@S$   @Sؐ  @S 8+㿐@SX  `  @@S:  , @2@ +@# $@@ #`$@  @"` 㿐@ @S` 5@S)ఢ 6 L@`', c &@S,@S&`L@@ @/@ @``&@S = * &`L`2 &,"&- J#`'?@R %L`  (`= &L` @S& @S ,& & &㿐N`  .`8`L@`@2 @R @R.?ς`8.`?0`cO>`  @Sf,* & L")? &`$ @SM,* &L2 )?Ϟ@ +@R@@Rٔ'%0L)?Ϥ@ +@R@@RŔ'%0@R@P J ?߀`@ɚ?J +` ߛ;`@ @?ɘ@?Б(`: 㿐N`  *N "/`>`%.  O ߀`@ɺN/`?` ߲ @ɂж.N .㿐N`  #% `` ` А@  `.@`N  .@` @@@Q `.@J`  0J ` (`8``+2` * `J ` 㿐@Q?? .`8`L??2L?㿐 N`? `? 2.@". @Rg* : ` .@R^.N`? `? 逦@. 4  J`  *`8`+`8`@  K` ?㿐@QiN` 1H H+ ` *8`;`@ ?  @ (``;`N ` 0"    . ?   \. N ` 㿐@Q9 a`㿐  @Qd 㿀@Q '@`*`?`!@QK  $ " "" `\5* `@ n`[  `^`y   `-D v@Q%  $ "" " * ` ۰ @6٢` ]2 ?  `* `\ɀ`!`\ŀ`[`\`]`\2*  `^`\2*  `-`\2*  `\2* * ` A@P  M$ "" " *  * ` @PӐ  =$"" " @Pɐ  3$ $ $$@P  ($ `   @P  $"" " * @P  $"" " *  * ` {   &$ @P 㿐/H P? `L(` ,@ H B  0>=?H`9   04 H 0? `,  ֒ 0'H @t   H@n    H0H @b  H @\   ? `  HS0S8SSXSSԝ㿐 D @O `%9?@ 4? ",  `&@`$   @?@    @ @? 㿐bȀ` #b1@O#  a#  *  @ @ @ &@  㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ @O@O㿐/O  & #C   € $D` €  $$` $:  `   ?cW?c@` ``$2@  @  @K#@@@ `?@  ؖ 2 @O  @ $@D@`@  $@$@@` $@:  € $D` €  $$` $: `8`y?8 2 6 ,4  *@ @ € #@ C@ `@ €  #@ #@ @ ` #@ : *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 `? @ @"G D   㿈/N`  &"N   $D`  $$` $;   =耤@ ??耥``?c@\`?c@` ``$4@  @  @P#@ @@ `?@d Ӥ= @N  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; w``p?  64,  2,@  @ #@C@ `@  #@#@@ ` #@;  * . :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ `? @ @ c "B肦 d ,0@ @4 4=㿐/M\`@?㿐㿠X㿠#. WebX v.7.9 (c) Dimitri KRAVTCHUK (dim) 1995-2010X_PAGE==> WebX: started...Unknown http method-V-X_PAGE ==> X_values(); ==> X_action(); ==> EXIT; Content-Type: text/html X_HOME%s/x.envrTMP_DIR/tmp/WebX%s/x.config/etc/WebX/opt/WebX/apps/WebX.TMP_DIR=%sX_exit( %d );%s/X.%dX_exit: exit...X_ERRMSG: %sREQUEST_METHODERRMSG: locked= %d :: msgfmt= %s

 %s 


Usage: WebX script [-Var Value [-Var2 Value2 [..]]] ERROR: %s %5d.%06d [%6d] %s/X_DEBUG%s/X_DEBUG.%da
%s/X_TRACE%s/X_LOG%s/X_LOG3%s/X_LOG.%dw%s/X_LOG3.%d

 hp: %d  mb: %d m_used: %d =====
áéíóúýÓÁÍÉÚÝàèìòùÀÈÌÒÙäëïöüÄËÏÖÜâêîôûÂÊÎÔÛãñõÃÑÕçǺas;&questi;optioncompilehtmlsqltrapsleepusleepchdirsqlnamesquitshellsetaddincludeerrorunlinkclearcookieforkfilexfilereplacewhileifeliffunctioncallexecreturnsqlsqlexecfopenpopenfclosepclosefgetsfputsvfputsfseekshmatshmdtendcontinuebreakX_fgets:OUT fp->size= %d fp->offset= %d
X_fgets:IN fp->size= %d fp->offset= %d
X_fgets: return( %d )  buff={%s}
cut_cmd: IN= {%s}<@----@>cut_cmd: OUT= {%s}cut_cmd: No more memory...<@quit>X_quit: buff= %s; compile= %d ignore: %d 
%s 

==> MALLOC ERROR! no more memory?? ==> EXIT; 
X_clear_value: name_patt: [%s] X_put_value: name: [%s] value: [%s] fixed: %d cookie: %d  ** %s := %s 
## Fixed Value: %s  ** %s add:= %s 
X_get_value: not found {%s} 
date_YEAR: %sdate_MONTH: %s%.2sdate_DAY: %s%02xX_transvalue: [%s]\t\n\rsh:call:txt2url:url2txt:trim:lower:upper:crypt:dt2str:str2dt:### dt2str ==> %s 
Bad format for dt2str: %s 
Too long name(s) for dt2str: %s 
%ld
	==> call: CALL: [%s] ==> call: OUTPUT: [%s] 
trim_buff: IN= {%s}trim_buff: OUT= {%s}year:Bad format for str2dt: %s 
Too long name(s) for str2dt: %s 
month:day:len:cut:str:word:%dint:printf:ftell:expr:-1env:todayX_ROWSX_DTX_UDTX_DDTX_RANDOMX_SQLCODEX_VERSIONX_INSERT_IDX_NVALX_NFUN%d [%d]X_ERRMSGDIRX_transvalue: no value for: [%s]%ld.%06dEXPR error: %s 
%f<@shmdt>X_shmdt: {%s} compile: %d  ignore: %d 
%s // %s 
0<@shmat>X_shmat: {%s} compile: %d  ignore: %d 
## Reached MAX SHM list value## Cannot get SHM...## Cannot attach SHM...## Cannot assign SHM Variable...<@fseek>X_io_fseek: {%s} compile: %d  ignore: %d 
<@vfputs>X_io_vfputs: {%s} compile: %d  ignore: %d 
stdoutstderr<@fputs>X_io_fputs: {%s} compile: %d  ignore: %d 
<@fgets>X_io_fgets: {%s} compile: %d  ignore: %d 
stdin<@pclose>X_io_pclose: {%s} compile: %d  ignore: %d 
<@fclose>X_io_fclose: {%s} compile: %d  ignore: %d 
<@popen>X_io_popen: {%s} compile: %d  ignore: %d 
<@fopen>X_io_fopen: {%s} compile: %d  ignore: %d 
<@return>X_return: {%s} compile: %d ignore: %d 
X_return: {%s}<@exec>X_exec: {%s} compile: %d ignore: %d 
<@replace>X_replace: {%s} compile: %d ignore: %d 
Bad syntax in REPLACE: %s ...X_replace: NAME: [%s] NEWVAL: [%s]X_replace: NAME: [%s] VAL: [%s] replace: [%s] by: [%s]X_replace: NAME: [%s] not exist or NULL value<@fork>X_fork: {%s} compile: %d  ignore: %d 
<@cookie>X_cookie: {%s} compile: %d  ignore: %d 
%s=HTTP_COOKIE<@clear>X_clear: {%s} compile: %d  ignore: %d 
<@unlink>X_unlink: {%s} compile: %d  ignore: %d 
<@error>X_error: {%s} compile: %d  ignore: %d 
<@>=>+=X_let: {%s} compile: %d  ignore: %d 
>*=>;=>$=>/=>%=>-=>++>--X_let: ### ERROR : did not find a command!!!<@add>X_add: {%s} compile: %d  ignore: %d 
<@set>X_set: {%s} compile: %d  ignore: %d 
<@shell>%s // %s
X_shell: {%s}
Cannot run SHELL: %s 
<@sqlnames>X_sqlnames: buff= %s; compile= %d ignore: %d 
lowercaseuppercase<@chdir>X_chdir: buff= %s; compile= %d ignore: %d 
<@usleep>X_usleep: buff= %s; compile= %d ignore: %d 
<@sleep>X_sleep: buff= %s; compile= %d ignore: %d 
<@sqltrap>X_sqltrap: buff= %s; compile= %d ignore: %d 
OFF_TRANSACTIONSON_TRANSACTIONSOFFON<@html>X_html: buff= %s; compile= %d ignore: %d 
<@compile>X_compile: buff= %s; compile= %d ignore: %d 
<@option>X_option: buff= %s; compile= %d ignore: %d 
fflushoffflushsql_namessql_transactionssql_traponsignalalarmlatin_htmlignore_empty_linesoff_transactionstranslatesigtermon_transactionsdebug## Wrong or unsupported signal name: %s !!sigintsighupUnknown option: %ssigalrmsigpipesigusr1sigusr2sigchld<@include>X_include: {%s} compile: %d  ignore: %d 
rFile SIZE: %d
X_ROOT/X_printfile: %s compile: %d level: %d
X_printfile: DIR-new= %s
Cannot access file: %s 

Cannot access file: %s


X_printfile: DIR-curr= %s ./%sLAST 100 CHARS ===> %s ===> Cannot open file: %s

Cannot open file: %s


Reused, File SIZE: %d <@end><@continue>X_notfound: [continue] ==> %d <@break>X_notfound: [break] ==> Continue= %d X_notfound: compile: %d ignore: %d ## Continue: %d Break: %d <@call>X_call: {%s} compile: %d ignore: %d CALL: Unknown function name: %s ,X_call: add argument name: %s value: {%s} X_call: analyse arg_string: %sX_call: no more values...<@call> %s( %d ) ==> SIGTRAP call: CALL: [%s] <@call> %s ==> SQLTRAP call: CALL: [%s] none### SYSTEM ERROR: more than 10 DB Session in proccess!X_BASEX_USERX_PASSWD### Cannot open database: %s ERR: %d SQLERR: %sc%d### Database name was not specified...%24sdisconnectbegincommitrollback### DATABASE Query ERROR: QUERY: %s ; ### ERRMSG: %s ### DATABASE Query ERROR: QUERY: %.200s ; ### ERRMSG: %.200s <@sqlexec>X_sqlexec: {%s} compile: %d ignore: %d X_sqlexec: query: %s <@function>X_function: {%s} compile: %d ignore: %d ,)%sX_function: add argname: %s X_while_values: name: %s compile: %d X_while_words: name: %s sep: {%s} compile: %d X_while_loop: compile: %d <@while>X_while: {%s} compile: %d ignore: %d wordsvaluesUnknown option: %s in WHILE...Fetch: %d values ** SQL fetch row: %d columns Name: %s Value: %sX_found: cid: %s compile: %d X_sqlnames### DATABASE QUERY ERROR: %s ### DATABASE QUERY ERROR: %.200s <@sql>X_sql: {%s} compile: %d ignore: %d selectshowexecuteX_sql: query: %s <@xfile>X_xfile: {%s} compile: %d ignore: %d X_xfile: file name is too long: {%s} aX_xfile: Cannot open file: {%s} X_xfile: outpass MAX open for file: {%s} <@file>X_file: {%s} compile: %d ignore: %d X_file: Cannot open file: {%s} <@if><@elif>X_if: {%s} compile: %d ignore: %d cmp!cmpicmp!icmpfcmp!fcmpfmt%lfX_if: try as line command: {%s} filled!filledEOFFilled... Filled? {%s} NULLafter VAL{%s} = %s X_if: [continue] ==> %d X_if: [break] ==> Continue= %d <@else>X_if: {%s} <@else> !fmtintfloatdateUnknown option in FMT: %s !EOFexist!existisDir!isDirisFile!isFile%s/x.pageregular_file: %s ==> ? regular_file: %s ==> OK. X_PAGEdef: X_PAGE: %sX_ERRORdef: X_ERROR: %sdef: X_PAGEInvalid %s value: %s ///./...%s/%sHTTP_HOSTSERVER_NAME%s/x.configrshell:00%s%s%s%sX_ROOT ===> {%s} X_ROOTX_HOME%dX_PIDX_PROGholdX_BASE==> Server: %s Root: %s Base: %s Hold: %d ### Not found X_PAGE value...WebXX_values: entry shellSERVER_PORT00%s:%sCannot open X_HOME config file: %sNo X_ROOT configuration for SERVER: %s X_ServerCOOKIESSet-Cookie: %s=%s; path=/; expires=31-Dec-2037 23:55:00 GMT Set-Cookie: %s=%s Set-Cookie: %s=NULL; path=/; expires=Wednesday, 21-Aug-1996 01:21:36 GMT Del-Cookie: %s X_SessionCOOKIESSet-Cookie: %s=%s; path=/;                       ! &%lld%Lf%llo%llxstrcutchcharstrlenX_exec_call: name= %s args= %s EXEC: Unknown function name: %s cutstr: fname= %s args= %s cutstr: name= [%s] str= [%s] chchar: fname= %s args= %s strlen: fname= %s args= %s strlen: STRname= [%s] LENname= [%s] %d%04d-%02d-%02d### No memory...||&&X_user_cmp( %s, %s, %s )likevlike!like!vlike>=≥>=<=≤<=!===>><<=Unknown CMP operator: %s X_user_icmp( %d, %s, %d )Unknown ICMP operator: %s X_user_fcmp( %f, %s, %f )Unknown FCMP operator: %s SSss%dMImi%02dHHhhDDddJJjjMMmm%04dYYYYyyyyAAAAaaaaYYYyyyAAAaaaYYyyAAaaAVL_search key: [%s] AVL_remove key: [%s] AVL_insert key: [%s] X_heap_new: hp: %d mb: %d m_used: %d X_heap: NO MEMORY...X_heap_alloc: hp: %d size: %d X_heap_info hp: %d mb: %d m_used: %d WARNING: heap_alloc( size= %d ) rmalign ==> mb: %d m_used: %d rmalign: mb: %d m_used: %d X_heap_free: %d X_heap_reduce: %d X_select_sql: REQUEST_METHODPOSTThis script should be referenced with a METHOD of POST. CONTENT_TYPEapplication/x-www-form-urlencodedCONTENT_LENGTHfmakeword: [%s] makeword: name= [%s], val= [%s] POST: CONTENT_LENGTH= %dThis script can only be used to decode form results. CONTENT_TYPEapplication/x-www-form-urlencodedREQUEST_METHODPOSTGETTMP_DIR/tmpw+%s/post.buff.%dTAKE: %s name="filename="NAME: %s VALUE... VALUE: [%s] NULLSEP: %s SIZE: %d %s/post.inputE_POST_parser: END: %d values FILE-src: [%s] FILE: [%s] %s/%s..%d.%dwBroken Input...PATH_INFOREQUEST_METHODGETQUERY_STRINGThis script should be referenced with a METHOD GET.
WARNING: Value value size is over %d!!! [cut]...
%%%02x&;`'"|*?~<>^()[]{}$\ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqrstuvwxyz{|}~ݬ4,($ 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00 ^ _(  X o $o#o#\#  oo4_0bbbbbbbcccc c0c8cHcPc`chcxcccccccccccddd d(d8d@dPdXdhdpddddddddddddddeeeee e(e0e8e@eHePeXe`ehepexeeeeeeeeeeeeeeeefff f(f8f@fPfXfhfpffffffffffffggggg g0 g8 g@ gH gP gXg`ghgpgxgggggggggggggg g!h"h#h$h)h %h(&h0'h8(h@(hP( hzR|P V - zR|P Z -  X(## #D#\'( ^ _ _(  44 $( !"(  ()4_( CS' n(\ N(P zi( ,($ ) %.:?DKRV[gHmPw(\à@и0 d4B\ `@0A\  dh0L5;TEBX PX`^ellsX|`: 8(`p  Ɉp2 82    "ɜ,ɠ7ɘA F KɀxU \gT lxͤɤt0  ͼͨͰʹ͸ͬ0T , ) $/8?JT\ckkkkCu^ ^ z  6| 8t Rl  '(t #9` .9D 8H?0\ F P V1 bHd k( x  (\ $   j 4l 8s( PP   , aILt P@2 !? /6? FMT ]eV pLw< )0  H G \ = M4 L` 1< (T pO$(  0, J` %L -(!5 8 < GNTa8 m)< v ~- A$OL0 K (N x |D$@H F     l Ud h\",'=| 1G\ 7<h D Nd X4a  p2< {=@ 4=H, P  p|$( V G P@!Dt  @| T$ 8d % ,9\D 6F ? I*O  P44 ^ i=t xG@  8 M4 0 ?D, :  c < JP x TD  K Gh0 ( Z #= D, \ Xh nP MX 0 *O4 2C0l @ (9H G( Nh Xo `9 hdx m_ s4   *lH  LP 4 L    d (   ?pT  m #T * 7( CL Jt Q8 ,( [ cX ~t u(d ~ x Z | Ap   (D  x l  2<  H  < u  MT Nx ) 0$ f` > CƬ J^ P W@L )DL ^ b0 g nh v   $  @  D -  t  X N@ (  {p  '  i  _( O|\ - 5ٸ =(  I ]  bt i` ../bin/WebXcrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1chp.0__JCR_LIST__WebX.cX_checkpageprinted.0lib_ACT.clib_ENV.cbuff_env.0lib_MSG.clocked.0lib_TRACE.cfp.2fp.4Init.3Init.5F.0tp.1lib_TRANS.ckey_pX_sqlFUNCSignalFUNCDO_fflushc_freeContinueBreakTRAPfuncx_OPENX_sqllineX_lenX_get_cidHTML_tablevel.6Init.4scan_treex_SHMX_sqlTRAPX_USER_newHTMLReturnX_sqlcaseIgnoreEmptyX_get_basestr.2X_sqlcodecount_treeX_linesx_CMDinit.0init.3init.7ContinueMY_fflushX_sqlTRANSHTML_char.1tp.5cut_cmdlib_VAL.cbase.1pid.2X_ROOT.0EXPR_parser.cyydefgotoyydefactvalue_floatyycheckyytableyystosyytranslateyypgotoEXPR_INITEXPR_FLOATEXPR_BUFFyyr1yyr2value_intyypactlib_EXEC.cExeclib_check.ccurr.1cache.0daylong.2FMdate.cSETdateHoursOkMinutesYearMonthSecondsDaySkiplib_AVL.cavl_searchavl_removeavl_insertlib_TOOLS.cX_heap.clibNoSQL.clibpost.clibEpost.clibget.cutil.cdim_PATT.cdim_CMP.cASCII.1Init.2Alpha.0libgcc2.c__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START__Q_addX_arg_string_sepstrncpyX_notfounddim_ORpattX_printfileX_startX_heap_newlowercasestrcpyX_exitX_CMPpattX_letAVL_removefmakewordX_while_loopyyparseX_CMPexecX_error_cidX_io_fputsX_check_dateaccess__register_frame_infoX_translinemktimeX_traceentX_io_fseekX_transvalueX_commandchchar__iobX_debugE_POST_parserfwritevfprintfX_htmlstrcat_Q_subX_optionstrncmp__muldi3X_signalX_heap_freeX_avlcmpX_compilememcpyX_while_wordsX_get_valueX_finishgetlineplustospaceX_ERRMSGX_date_infofreadGETenvX_check_nameX_user_cmpTrace_Q_lltoq_Q_stoqX_fork_environgetenvX_io_fopen_Q_divDebuggettimeofdayX_io_fcloseX_str2dtX_errorX_actiondim_FREEpattunescape_urlyylvaldate_MONTHX_BASEX_stdout.udivX_usleep.divX_putcharX_add_valuestrcutX_unlinkgetpidTMP_DIRvp_SYMcmpsrandftell.remsql_errorX_free_cidX_todayX_includeX_sqltrap_DYNAMICX_while_valuesAVL_insertX_databaseX_io_pcloseX_select_sqlatoi_etextX_sqlatolX_ERRORstrrchrX_return__divdi3HTML_stringX_put_valueX_fflushX_add_Q_mulX_set_cookiesX_search_commandstrstruppercaseGET_pathlocaltimeshmgetX_take_stringX_io_popenX_noselect_sqlGET_parserX_chdir.umulGetDDTX_functionCheckEnctypeMethodX_heap_allocstrchrx2cdim_EXEpattX_free_all_end__moddi3x_BUFFERSX_user_icmpX_check_intdate_YEARAVL_searchX_cryptX_clear_valueX_HOME_edataX_get_intX_shmatX_fgetsstat_finiX_arg_stringX_shellmainvsprintfrind_PROCEDURE_LINKAGE_TABLE_X_cookieX_exec_callyynerrsatexitX_rowcountX_sleep__deregister_frame_infoX_setGetMethodmemsetX_shmdtputenv__dso_handlePOST_errmsgX_execX_PAGEX_replacetolowerX_trans_printfileX_dt2str_Q_qtosyyerrorX_valuesgetcwdStrLenX_headerX_BASE_holdX_user_fcmp_GLOBAL_OFFSET_TABLE_PrintTMfgetcX_sqlexecstrcmpX_heap_reduceX_io_vfputsX_sqlnamesdate_DAYCookieX_check_floatX_fpX_call_initmallocX_File_Q_qtollsystemX_xFile__flsbufX_clearisdigitX_quitstrlensscanfX_envEXPR_parserX_eofalarmescape_shell_cmdyychar__clz_tabX_io_fgetsX_found_Q_qtoiX_printvaluememcmp_lib_versiondim_LOADpatttoupperX_whileX_INSERT_ID_Jv_RegisterClassesX_ifrandomX_default_names@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic 123647-02 Feb 2008as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.489% : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; I 4: ; I.1@ 41 .? : ; ' I@ : ; I .? : ; I .? : ; I< 41.1< .: ; ' I@ 4: ; I .? : ; I< .? : ; I< !.? : ; I< "!I/#.1$1% U& U'1( ).? : ; I *.? : ; I +4: ; I? < ,4: ; I?  % $ > $ >  I.? : ; I@ .? : ; I< 4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; I@ 4: ; I 4: ; I 1 41  U U.? : ; I<  I!I/.: ; I .? : ; ' I@ : ; I .? : ; I< .? : ; ' < I!I/ 4: ; I? < %  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > .? : ; ' I@ : ; I  4: ; I4: ; I .? : ; I<  .? : ; I< 4: ; I? < I!I/%  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > I !I/ : ;I ' II : ;  : ; .? : ; ' I : ; I4: ; I.1@ 1 41 .? : ; ' I@ : ; I 4: ; I .111   .? : ; I< !.? : ; I< ".? : ; ' I #.? : ; I< $ U%.? : ; I< &4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ;  : ; I8 ' II : ;  : ; : ;I8 .? : ; ' I : ; I4: ; I .1@ 1 41  : ; I.? : ; I< .1< .: ;' I@ !: ;I ": ;I #4: ;I $.? : ; I< %1&1'1( U).? : ;I< *!I/+.: ; ' I ,.? : ;' I -: ;I..? : ;I< /.1< 04: ;I1.: ;' I 2: ;I34: ;I4.? : ;I< 5 6417.? : ;' I@ 8.? : ;I 9.? : ;' I :.? : ;' I@ ;.? : ;I <.? : ;I@ =4: ;I >.? : ;' I< ? U@.? : ;I< A B.1C.? : ;' I D.? : ;' I E.? : ;' I< F.? : ;' I< G.? : ;I@ H.? : ;I I4: ; I? < J4: ; I K4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; ' I@ : ; I 4: ; I 4: ; I U.? : ; I< 11 U41 1 .? : ; I< !I/ .: ; ' I !: ; I"4: ; I #.? : ; I< $: ; I%.? : ; ' I@ &.? : ; ' I< ' (.? : ; I< ).? : ; ' I< *.? : ;I@ +4: ;I ,.? : ;I< -.? : ;I< .4: ; I? < % $ > $ >  : ;  : ; I: ; I: ;I.? : ; I .1@ .? : ;' I@ 4: ;I : ; .1  4: ;I 4: ;I.? : ;I< 141  UI!I/  I.: ; I 4: ; I.? : ; I< .? : ; ' I@ : ; I 4: ; I !I/!&I"4: ;I?  % $ > $ >  I : ;  : ; I8 I : ; I .? : ; ' I@ : ; I 4: ; I .? : ; I< 4: ; I.? : ; I< I!I/ 4: ; I? < % $ > $ > : ; I : ;  : ; I8  I  : ; .? : ; ' I : ; I 4: ; I .1@ 1 41 .? : ; ' I@ : ; I 4: ; I .? : ; I< 11  U1I!I/ .? : ; ' I@ .? : ; ' I< I.? : ; I< U!.? : ; I< ".? : ; I< #.? : ; ' I< $ %.? : ;' I@ &: ;I '4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.: ;' I@ : ;I 4: ;I 1 1 U41 1.: ; ' I : ; I4: ; I4: ; I.? : ; ' I< I .? : ; ' I< I!I/ &I .? : ;I@ : ;I .? : ;' I@ 4: ;I !4: ;I"4: ; I % $ > $ >   : ;  : ; I8  I: ; I ' I I .: ; ' I@ : ; I U4: ; I 11 4141 11 .: ; ' : ; I4: ; I4: ; I  U.: ; ' I .: ;' I : ;I4: ;I  !.1@ " #.? : ;' I $.? : ; I< %&.1< '.? : ;' I@ (: ;I ).? : ; ' I@ *4: ; I? < % $ > $ >  I.? : ; ' I@ : ; I 4: ; I .? : ; ' I : ; I 4: ; I  1 .: ; ' I .1@ 1 41 11  U.: ; ' I % $ > $ >  I  : ;  : ; I8 : ; I .? : ; I@ 4: ; I .? : ; ' I< I .? : ; I<  .? : ; I<  .? : ; I< .? : ; ' I@ : ; I  U.? : ; ' I< 11 U41 .: ; I : ; I4: ; I.? : ; I< 4: ; I? < % $ > $ >  I : ;  : ; I8 : ; I : ; .? : ; I@ : ; I .? : ; I<  .? : ; ' I@ .? : ; I@ 4: ; I? < 4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; ' I@ : ; I 4: ; I 4: ; I.? : ; ' I< I.? : ; I<  U.? : ; ' I< &II!I/ 4: ; I? < 4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; I@ .? : ; ' I< I &I4: ; I .? : ; ' I@ : ; I 4: ; I.? : ; I< .? : ; ' I<  U11 41  UI!I/!I/ &.: ; ' I : ; I! "4: ; I? < % $ >  : ;  : ; I8  I: ; I.? : ; ' I@ : ; I 4: ; I .? : ; I<  .? : ; ' I< I&I4: ; I.? : ; ' I<    4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; ' I@ : ; I 4: ; I 4: ; I .? : ; ' I< I.? : ; ' I<  &II!I/&.? : ; ' I : ; I.1@ 1 41 .? : ; ' @ 1 11.? : ; ' I@ .? : ; I< !% $ > $ >   : ;  : ; I8  I: ; I .? : ;I : ;I .? : ;I<  .1@ 1 .1< .? : ; I@ : ; I 4: ; I 4: ; I 4: ; I U.? : ; ' I< I1.? : ;I@ : ;I : ;I  .? : ; I@ : ; I % $ > $ > .? : ; I@ : ; I 4: ; I 4: ; I I I !I/ % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U.: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; II!I/ &I4: ;I?  -(GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)WebX.c/SOFT/WebX/WebX/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned charlong long intFILEJblong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _5 ino_t Jblkcnt_t blksize_t long double mode_t mJ gid_t y dev_t J nlink_t Jtimespec&tv_sec'#tv_nsec(#timestruc_t> 1 statst_dev#st_pad1#st_inoa#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksize~#Pst_blocksn#Tst_fstype#Xst_pad4!#h     'name%Y#val&Y#entry'heapblock&m_next'#m_used(#heapblock_t*_heapalloc,smallreq-_#bigreq._#X_heap0(avlleft#right#balance#key_# data _#savl_t"savl_tree%root&#cmp'+#+c__avl_tree_t)qX_varinextjq#valuekY#CX_varmC X_USER0pavlq#namerY#varsw#fixedt# cookieu#"cleanv#$hpw #(nextx#,eX_USERzX_FILEtextY#offset#size#stat1# path#next#  &X_FILE&"X_FUN(avl#nameY#file"#offset#var(# next.#$wX_FUN ,files"#functions#x_USER#freelist# vtree1#ftree1#ctree1# hp #(4X_BUFFERSA scprintedtc ,()0n eX_avlcmpc)0)D^v1_Xv2_Y X_startcbuff err X_envc  c e)D)n z   fX_checkpagec)*lnpageYhbuff f} 9accessc LUc )*!Uc w"+ mainc*l-nargcchargv iic]shellcd#  X_trace#c X_debug$c GetMethod&c 3X_valuesec PX_set_cookiesgc# [ $ sX_actionkc X_exitnc$ e*t*x z % z & *( CheckEnctypeMethod)c GET_parser3c  +cGET_path4c& Ppage>ccbuff? f|%x iUc +p+ Gc'+p+'++( -- E_POST_parser+c! +c% POST_parser/c! +cY)X_startc*sc Ab +__iob 1+POST_errmsgY,Tracec,X_INSERT_ID"( "',ent ,Debugc,Cookiec,X_eofc,X_fp ,X_BASEY|,X_BASE_holdcx,X_PAGEYt,X_ERRORYp,X_HOMEY,TMP_DIRY ",X_ERRMSG,DIRY,x_BUFFERS D[O--GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ACT.c/SOFT/WebX/WebX/srcintunsigned char)long long intlong int)charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleNX_actione--^X_printfileeX_PAGE}1-GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ENV.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned char6long long intFILEJelong int6charshort intshort unsigned intlong long unsigned intlong unsigned intlong double !X_env'f-0\n host( dir( name( chp( env( buff_env)! buff*2h len+fc fp,Cb I-- ]e ]eputenv=f040Tputenv=f2C }getHOMEf fname}accessfAX_exitTf0\1ncodeSfh buffUA iVfX_traceXfX_finishifgetpidjf/unlinkkfexitfRbe__iobRTracesfX_HOMETMP_DIR; 2<1GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_MSG.c/SOFT/WebX/WebX/src__va_listieva_list5g__FILE__FILE_cnt##_ptr$#_base&#_flag'# _file(# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intunsigned char Clong long intFILEJlong int Ccharshort intshort unsigned intlong long unsigned intlong unsigned intlong double ERRMSG12<n fmt7l apxlocked lenX_trace  X_header* X_printfile> X_exit4 12X_exit4 TracesX_fpx;X_ERROR~7cX_ERRMSGRX_stdout; Nd8d2timeval 1tv_sec 2#tv_usec 3#statst_dev#st_pad1#st_ino{#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atimJ#8st_mtimJ#@st_ctimJ#Hst_blksize#Pst_blocks#Tst_fstype#Xst_pad4#h      Lheapblock&m_next'L#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#RX_heap0e avlleft #right #balance #keyy# data y#avl_t"Mavl_tree%root&M#cmp'h# hyySavl_tree_t)X_varXnextY#valueZs#X_var\IX_USER0_avl`#nameas#varb#fixedc# cookied#"cleane#$hpfI#(nextgO#,X_USERiX_FILEtexts#offset#size#stat# path#next#  cX_FILEc_X_FUN(avl#names#file_#offset#vare# nextk#$X_FUN ,files_#functions #x_USER #freelist # vtreen#ftreen#ctreen# hpI#(qUX_BUFFERS~ cPfp cFtp]tv] )2<2n ;X E N Xh ~X_debugT24nfmtSshapUzfpV cInitWbuffX ~   c D )3P3 |3P3 X d4 4 access&44!e/  c"P X_trace48dnfmtsiapzfp cInitbuff ~# PB @ )5\5 |a$ X6<7% _access& |67 !e/7H7!e/&Traces&Debugt&X_fpx c&X_HOMEs&TMP_DIRs&x_BUFFERS uE8dGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TRANS.c/SOFT/WebX/WebX/src__FILEuh__FILE_cnt#h#_ptr$o#_base&o#_flag'u# _file(u# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intuunsigned charlong long intFILEJglong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _: ino_t Oblkcnt_t blksize_t long double suseconds_t 9 mode_t mO gid_t y dev_t O nlink_t O'timespec&tv_sec'#tv_nsec(#timestruc_t>ntimeval1tv_sec2#tv_usec3# ~ statst_dev#st_pad1#st_inof#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim'#8st_mtim'#@st_ctim'#Hst_blksize#Pst_blockss#Tst_fstype#Xst_pad4n#h     ' "^#^#len h#X_val"iheapblock&m_next'i#m_used(#4heapblock_t*4heapalloc,smallreq-#bigreq.#oX_heap0(avlleft(#right(#balance#keyd# data d#avl_t"javl_tree%root&j#cmp'#.hddpavl_tree_t);X_varij#k^#X_varmaX_USER0pavlq.#r^#vars#fixedt# cookieu#"cleanv#$hpwa#(xg#,X_USERzX_FILEtext^###stat~# path##  {X_FILE{mX_FUN(avl.#^#filem##vars# y#$ X_FUN X_CMDavl.#code#X_CMD S,filesm#functions S#x_USER Y#freelist Y# vtree#ftree#ctree# hpa#(mX_BUFFERS 3fp0 #1 #  X_OPEN3 p $>< #shm=^#  X_SHM> vcmdt^#codeuh#cmd_tv  WQhtmlN^#textO^# HTML_codeQ - X_search_commandh^initcmd hpanh i8d9n h l Y c8|8 b /lowercasehstr^ J 99\n #h nuppercasehstr^ J9\9n bh X_fflushhfp  99n X X_fgetsh^hfpmnhh M 9:n ` i j h  cut_cmdh:@n!fpmh"oi#ih[#nhY#in }$ h%  :<& (& /& 6( `(0) f ;h' >H?& & >H?aY' >?$& (& /& 6(H ` u*++cut_commenthfpm^first^last^,X_quitWh-V^-Vh-Vh$hh)|_h.K]h@A\n1`=ZIj/U/h| }X_USER_new YA\Bn!hpXah"^i"^j0nh#p^h#hpa`0u YA|A$kh.K]h1count_tree%h2a$j2len$0n&hh}BB\naiX1Oscan_tree5 Y2a4j2patt4^0curr6 Y36 Y0p6 Y4X_CMPpatt;hB\C0n`ih"X.]8,6X_clear_valueYh2name_pattX^0uZ Y0prevZ Y3Z Y$h5&O6[&66&b&i66"6.1vX_USER_delh-^0u Y.h1X_USER_extract Y-^0u Y0prev YoC0DnhQ6a/%)CHCb`&i(`a"X.]'6DDO`(x6['vD D&(h67kX_put_valuehDFn"^h"^i!fixedhj!cookiehk0nh#hpa`#u Ya$h)_h%@kDD&DD6()Yh._h1X_USER_get Y-^0u Y7AX_add_valuehFG n"^`"^j0nh#hpai#u YX#vsk)_h'kFF$&FF$6,X_get_value^-^0u Y$h&6AG Ghn\h6h/r'kGG &GG 68gh0ihGhG^]9C h2id^0i heGGn-h8`,HTML_string^2ch0inith0HTML_char0str0chp^0ih ^   CeGHn_mHHm,}X_putchar wh2ch v&66CHJn\\%eHIh(](]:uChJM4n!val^h!out^i#lenha#ih`#chb%C KK X'eL L&(]L0L];GetDDT 0Init 0tp :0tv :0D uM4Mnh69?!h2date ^0i"h0n"h3#?h O MN n`66#P/9/h2date.^0i0h0n0h31?h N Nn`66P9YB>h2date=^0i?h0n?h3@?h NOn`6)63=PI<X_get_base^OO^,X_crypt;h2in:o2out:o0key< 0n=h0len=h&'&2&>1Kcrypt_char1u2ch0u2key0^2len0hOPPnhiP`a'OP$'a&2&>:& hPPin" ^h!out ^i0i h#n h}= &0env ^0val ^$/h>MCh^^?#format Z&~#val Z&~0chp Z^#dt [}) ;h@X_dt2str oh.C hARR.C hARR.C hA/RR.C h?0= K'}0pos L#i Mhb)uC h(P.C h?p)Ph.C h?0#fmt $'}0val $^#chp $^Y#f %'/})C h'ASS&(6hANSS.C hASS@|escape_shell_cmd h.C hAST#url &~@escape_url h.C h? )C h' T$TX BaA(TXT.C h?m)EC h''8TUP&'P('\`'faAUU)C h' JUU a?,(#format x&~#val x&~0chp x^#dt y}) ;h@X_str2dt h.C hAW$Xl0crypted L^B]'oo)qC h'WPXl&^&eWPXl~a`'WXl'a2c&>? '@B'^)C h'Z,ZX&b(X66#~? pB ?'^) SC h'ZtZ&(66~? B '^) C h' [[\&l(6)63=~?!9#string &Ȼ~#s1 hc#s2 hd#m ha\d\x.C hA!h\x\#len '~.C h?!= '}.C h?"B#string &}0no h#m h\#n hX)!C h'']^P&'&''d(0( [(\''8]^P&'P(P'\`'fa?"|p#fmt '}#L }.C h%"k`p`&`p`6A"``.C hA##c|c#init = '})#C hcc4getpid hA#d@d= '}0u Y0n h#len h})#zC h%#}dDdHa&(X?##tv :}= '}.C hA$fdel= '}0fun S0n h#len h})$:C h%$X}dda&(XA$ee.C hA$ee= '}.C hA$ee= '}.C h%%&Aef &(6h'kee&ee6A%Ufxf= '}.C h%%uff}6(}6A%g8gt#T }= '}.C hA%gg= }'}.C hA&.gh)&C h4X_today vhA&Lhh .C h?&#i ^h}#sst ^h`#f _'/}= `'}@&EXPR_parser bh)& ;h.C hhi0.C h &* ' c ' ; '/ Ofloat1'trim_buffh-^0ih0nhhCX_crypt;hD!hD/hDB>h ' '1(getwordh-^2noh2word^0ih0nh7(mX_printvalue hij^" ^XE h^^:) hjmn" ^X!out ^i" hj#chp ^h= )_#fullname )#i h\#n h[?). hA)7kk.C h%)Ckm&'ekl\&(H]klH]' mmd X )*7+X_shmdt hmon" ^h" hi" hj#io &0i h0n h0key h3 h3 h0len h#chp ^`= +=W ^h$*h)*_h)*Ph%*+-nn&+C(`+O`'6o`o&Oo`o6['vo`o&o`o`6 +-*1+ZSHM_del 8h- 7^0i 9h7-X_shmat qhosn" p^h" phi" phj#io r&0i sh0n sh#key shd= shc= she#len shf#chp t^`= t+=W t^i$,@h),T_h),hPh%,+-qq<&+C(x+O`%,-q<q-j&-&-&-&-(. X.]6.%,krXrh&rXrh6%-G6rr&Orr6['vrr&rr`6%-k+-ssD&+C(+O`'6s\s&Os\s6['vs\s|&s\s|`61.)SHM_att Ih- H^2key Hh- Hh- Hh2len Hh0u J Y0i Kh0id Kh:/9} hsun" ^h" hi" hj#io &#i h`0n h0sz h3 h#chp ^`= +#mode ^c= ^d=W ^b0fp  $/h)/(_h.Ph:0r huxn" ^h" hi" hj#i hi0n h0sz h#io &#chp ^a= &~= ^`=W ^c0fp $0 h)0_h)01Ph'Avv&(6h'kvv&vv6:1g hx{pn" ^h" hi" hj#io &#i hi0n h0sz h#chp ^`= &~= ^d=W ^c0fp $1Bh)1V_h.Ph:2x ^h{p~tn" ]^h" ]hi" ]hj#io _&#i `hi0n `h#sz `he3 `h#chp a^a= a+= a^d= a^j=W a^c0fp b $2Sh)2g_h.Ph:3I :h~t8n" 9^h" 9hi" 9hj#io ;&#i <hi0n <h#chp =^`= =+=W =^c$3$h)38_h.Ph:4 h8n" ^h" hi" hj#io &#i hi0n h#chp ^`= +=W ^c$3h)4 _h.Ph:5w hn" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$4h)5_h.Ph:68 h$n" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$5h)6_h.Ph96Nnh-m^-mh-mh0ioh0noh0retp&$6|h)6Nh._h66$Ln6%`61i6=j66I66S6]/66i/66|6,7X_exec[h-Z^-Zh-Zh0i\h0n\h3]'0args]&$7xh)7Nh)7_h)7Ph4X_exec_callgh8J6L8n7a7 i7,j67867B7LH7Xȿ/87e/8)7x/857/8A77:9h8Ln"^`"hi"hj0nh#ihj0oldlenh0newlenh#out&#chp^a#cmd9ؿ=&#old&#new&$9:h)9NNh)9b_h)9vPh)9 ;h'A 8`(6h'k(&(6 9 7:X_fork hLLn" ^`" hi" hj#pid :~#nm :|0sst$:dh):xNh):_h):Ph4forkh : :;hLn"^h"hi"hj=:~#nm:|#v&3^#ih[0nh$;kh);Nh);_h.Ph7<X_clearh n"^`"hi"hj=&$<h)<&Nh)<:_h) < n= a=i=$j=0/==</==O/==c/>=w=,>X_errorh-^-h-h0msg&$>dh)>xNh)>_h. ;h>> n>!a>-i>9j>E/>>Q/>>d/>>x>7CdX_lethn"^h"hi"hj#let&0ih#nhi#chp^X3^=&~$?h)?Nh)?_hA?|.Ph?@X#val^Y.Ph?@qx)@4Ph'A&(6h'k&(6?@.Ph?@)@Ph'A&(6h'k&6?A(.Ph%AGA\|&(H6h'k\l&\l6?A`)AdPh'A<&(x6h'k,&,6%AA&(6h'k&(6?B0valx^#name2x^i)BPh%B^A&(6h'k&(6'A&(6h'k&6%BAtx&(06h'ktx&(P6%C#A &(h6h'k&6'A&(6h'k&67DJX_addhn"^`"hi"hj#add&#iha#nhb0chp^3^=&~$Dh)D%Nh)D9_h.Ph7E0X_sethn"^`"hi"hj#set&#iha#nhb0chp^3^=+$Dh)E Nh)E_h.Ph,EX_shellch-b^-bh-bh0outd&)ENh)E_h$Eh. ;hF"E0nEG`ESZE_jEk/FEw/F E/FEE,FX_sqlnamesFh-E^-Eh-Eh0outG&$Fh)FNh._hFF"nF<`FHiFTjF`/FFl/FFF,GX_chdir4h-3^-3h-3h0n5h0out6&$G[h)GoNh)G_h)GPh4chdir?hHFnGaGiG&j6G2G</GGH/GG[/HGo/HGG,HX_usleep"h-!^-!h-!h0n#h0out$&$Hh)HNh)H_h4usleep-hI$HnH2`H>iHJjHVH`/IHl/IH/IHH,IX_sleeph-^-h-h0nh0out&$Ih)INh)I_h4sleephJ,I$nI;`IGiISjI_Ii/J Iu/JI/J#II7JX_sqltraphn"^`"hi"hj#cmd&0val^$Jh)JNh._h,KKX_htmlh-^-h-h0cmd&$K&h)K:Nh._hKJnJ`JiJjK/KK/KK&K:,LX_compileh-^--h0cmd&$Kh)LNh._hLrKnK`KiKjK/L]K/LiKL7MX_optionVhn"U^`"Ui"Uhj0nWh#sigWh`#cmdX&0chpX^=X^h#valX^b$M!h)M5Nh)MI_h)M]Ph)Mq ;h%M  Bj%M $ B`?M. ;h<P4alarmh,NpX_trans_printfileKh-J^-Jh3L&0fnameL^)NANh)NUPhEa h^hNMnMhNiNN`/NN-/NNANU^h:Om hn"^a"hi"hj$O%h)O9_h'Mp&N&NpNNa7VX_commanduhn!fptmh"t^i"tj"thk=v P#nwh\FPX_leth^hh?T.FP4X_seth^hhFPYX_addh^hhFPX_ifhm^hh>P'h^hhFPX_sqlhm^hh)P1hBPV^hhFQ'X_Filehm^hhFQSX_xFile=hm^hh>Qv ^h^hh>Q h^hh>Q h^hh>Q} h^hh>R8 h^hh>R%w h^hh>RH h^hh>Rk :h^hh>Rrhm^hhFRX_whilehm^hh>R h^hhBRV^hh>Sh^hhBS7V^hh>SZh^hhBSsV^hhFSX_clearh^hhFSX_fork h^hhFSX_shmat qh^hhFTX_shmdt h^hh' |&Z&%Tk6X&66a&6(66I66S6]п%T6P&77`&7(67867B7L{7Xz%T<&==a&=( =0}%U> (&>>a&>( (>Eп~%UOE0L&EEZ&ELEk~%UF"L&FFa&F( @F`п}%UF&GGa&G( X6G2G<{%UJ&K^Kea&Kl( pKп{%V*Hl&HH`&H( HVzH`|%VgI$l(&II`&I( I_zIiп|'K(&L2&L9&L@( KzDNnhCX_errorhD^hCX_exec[h:Ya h8n!fname ^c" h#level h#file mi#fp  b= &= &#oldpath ^c#newpath :0t h0n h#sst ~= m$Wh%X:Yd&Y4YBb( 6YR'A`( 6h'k&( 06%Xj  (`& /& 6( X a?X pE h^^h?X )X ;h)XK]h' T” X( )X ;h)YK]h' Ü X1Y`new_dir h2fname ^2newpath ^0root ^:ZYl{h8Ƭn!fpzmh"zh"zhj0i|h0j|h0n|h0sst|h3}=~&=~&$Zh%ZB |  (`& /& 6(  i( .Nh:\1hƬPn"^`"hi"hj!ret^k=l0ih#nhX#argsh~#out&='#val&~#chp^X#sym^X#oldReturn^~#fun Sb#vsj#u YY#x_USER Yc#hpag$[h)[Nh)[_h)[Ph)[ ;h%\v`k6( )\8h'6 O` 6['v&k67\X_signalhP$n!sighh= \}( $\h._h ]*+;]MX_error_cid^0cmd]M)]; ;hh ]^*]]$n]|/]]'( ]<G_LX_get_cid^иn#iha#user^`#passwd^Z%^ ]͠]|( X]|( @^,X_databaseh%^nA`( 6h'k&( 6%^A,P`( 6h'k4@&4@6%^AlΌh( 6h'kp|&p|6( #msg:{)_#h']P]|( 8]| `jX_sqllinehиn!query^c#cmd&@_X_noselect_sqlh%_  BaA`@_X_finishhB_`j']])`;h)`O ;hphHgh:aJ'h0n"^`"hi"hj#query&#cid^h$`h)aNh)a_hBa)aJ^'Ӑ&V( X8jD h:brh0n!fpmg"^i"hj"hk0ih#nha0argsh#out&='#chp^X0sym^#fun Sc#hpab#vsk$bEh)bYNh)bm_h)bPh( p.>h:cRRhn!fpQmh"Q^i"Qhj#uS YX0nTh3Th=Ub#srcVh#varVs`#vVsi$cIh)c]l'h%ck&( 6Ac@t.l'hװ.l'h:e 4'h(n!fp&mh"&^i!sep&^j"&hk#u( YX#n)hQ=)hf=*a0src+^#val+e b#chp+^i=+&$dh)d>h)dl'h%dk&( 6?d .l'h.l'h^9el'h2fpm-h3$eYh.l'hee(ٸne#he.ie:`/eeFX|eZ7gX_whilehٸn!fpmh"^i"hj"hk0ih0jh#nhX0ssth0linesh3#out&#chp^i#cmd9ؿ=&#sep&$fh)fNh)f_h)fPhBggmh>g-4'hm^^h>gPRRhm^h)gd ;hAg.l'h'eۄ&e&e( e:kD'h7iX_founduhn!cidt^!hpta!fptm"th#valviQ#iwhc0jwh#nwh#sstwhm#lineswhd=x=y&=y&$hh)hh)hl'h?i1 )h_h)il'h)ih' J 0 `%iJ @d B`)igh)i{ ;h<)i_hE1h^hh^ i'*7kX_sqlhn!fpmg"^i"hj"hk0noh0ih#nhܐ0showh0ssth#cmd?P#query&п#vali#cid^b#hpac$jh)jNh)j_h)jh%k x B`?k ()k5h)kIh( H)kbh)kv ;h)kh)kh'&V8`' &V( `8`7mX_xFile=h@n!fp<mf"<^i"<hj"<hk#fp_OLD> c#fp_NEW> d=?&#i@hb#FF@hb$lh)lNh)l_h)lPh)l ;h)ll'h.l'h7nBX_Fileh@n!fpmd"^i"hj"hk#fp_OLD c#fp_NEW k= &#FF!hb$mh)mNh)m_h)mPh)n ;h)n'l'h(<.l'h7r]X_ifhn!fpmj"^d"h"hk0u Y0ih0jh#nhi0ssth#Nothk#i1ha#i2hZ#linecmdhh#f1r]#f2r]ؾ#out&#chpcmd^f#chp^a0name1^#name2^`#op^a#v1^`0v2^#f_sst~$oh)oNh)o_h)oPh)p ;h>p4l{hmhhApZ04X_user_fcmph?pt x.hAp\.l'hAp.h%pA&( 6h'k&6Aq04X_user_icmph%qJ  (`& /& 6(  aAqh8l.l'h%qA<&( 6h'k,&,6Aq4X_check_datehAq. ;hAr|4accesshAr:HX4X_check_floathXh4X_check_inthdouble rwg I__iobrgITracehIX_INSERT_ID8IDebug*hIX_eofhIX_fp IX_ERRMSG&IDIR^Ix_BUFFERS _JHTMLhJX_lineshJX_lenhJContinueBreakh`JContinuehXJBreakh\KX_stdout DJReturn^dJX_sqlcase hhJX_sqlTRAP!h0JX_sqlFUNC"hPJX_sqlTRANS#hJX_sqlcode$hTJIgnoreEmpty%hIX_rowcount)h tb Jx_OPEN5tR t Jx_SHM@tv` t ?JTRAPfuncCtàJDO_fflushDhJMY_fflushEh t +Jx_CMDyt u&  JSignalFUNCu uN W 4#HTML_tabUu>4 u{   #cidue uh  #c_freeu#base^L#key_p.hH xGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_VAL.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned charlong long intFILEJelong intoff_ttime_t@  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _+ ino_t @blkcnt_t blksize_t long double mode_t m@ uid_t u gid_t y dev_t @ nlink_t @timespec &tv_sec '#tv_nsec (#timestruc_t >{statst_dev#st_pad1{#st_inoW#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksizet#Pst_blocksd#Tst_fstype#Xst_pad4#h       'name%O#val&O#entry'heapblock&m_next'#m_used(#heapblock_t*cheapalloc,smallreq-c#bigreq.c#X_heap0,avlleft#right#balance#keyU# data U#wavl_t"wavl_tree%root&#cmp'/#/fUUavl_tree_t)uX_varXnextYu#valueZO#GX_var\GX_USER0_avl`#nameaO#varb{#fixedc# cookied#"cleane#$hpf#(nextg#,iX_USERiX_FILEtextO#offset#size#stat%# path#next#  *X_FILE*&X_FUN(avl#nameO#file&#offset#var,# next2#${X_FUN ,files&#functions#x_USER#freelist# vtree5#ftree5#ctree5# hp#(8X_BUFFERSE fnrootOhu {chpO  Omf bof ,   z $ @ y$h ofmf  )regular_filef!uOsst%mf f|nrootOhuiu {"chpOQ Yf# X_heap_reducef T $ 0` ;` F{ Rc _h T x z iroot_levelf$rootO!uOchpOname ilevelfif y c% X_values>f|Tnprog=Oh"n?f`No?fMax?fv@,"ServerA i"ConfigA i~"httpA i}"holdA }"chpAOY"S_NAMEAOX"S_PORTAOX"fpB `"X_ROOTC p"baseC 8"pidC `hpD"uE` mf Yf# chdirmf of# getpidqf& fO' :(X_add_valuef' W4Hf' ~dx)fO Yf(getcwdZf      '*'X_set_cookiesfTxn+buff'+namelistOX+chpOa+nameO`+valOQ+cookieOh+nfb,{f-f,{f-f' @,f-fPp-f 8.Tracesf X'.entoG.Debugtf.X_BASE{O.X_BASE_hold|f.X_PAGE}O.X_ERROR~O.X_HOMEO.x_BUFFERS xGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)EXPR_parser.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intYYSTYPEt_intt_floatlong doubleYYSTYPEyyalloc yyss yyvs short intyysigned_char  <signed chari Kx^ Fyyparse li n yystate nic yyn oib yyresult pih yyerrstatus rii yytoken ti[ yyssa F| yyss ]e yyssp ]d yyvsa cc yyvs sj yyvsp sh yystacksize m yyval c yylen ig yysetstate  yynewstate =( yyexhaustedlab   yyabortlab  yybackup  yydefault C yyerrlab p yyreduce M yyacceptlab  @ yyerrlab1 u yyerrorlab j yyreturn  fy yysize bl yyss1 ]h yyptr `@ `@T | Ei4ccfccfVVsViyylexdiieffvalgchphisdigitpicharEEXPR_parseri  nexprXv_intEiv_floatKjiihiQfloatvalue_intɀvalue_floatɈEXPR_BUFFɘEXPR_INITiɜEXPR_FLOATiɠ V!p yytranslate (!V yyr1 x(!=V yyr2 P!-eV yydefact |!UV!& yydefgoto !V yypact !V yypgoto !V1 yytable .8!CV1 yycheck Yp!3nV yystos !^"yychar Mi("yylval P("yynerrs Si GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_EXEC.c/SOFT/WebX/WebX/srcintunsigned char long long intlong int charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleC name#functionN#NfC X_EXEC  X_exec_call0f  n name/h args/i n1fa 3f MstrcutKf n fnameJh argsJi nameLM strLM~valLnMf=3f Sf]c chcharjfn fnameih argsii namekM strkM~valk ch1kQ ch2kZnlf3f Sf StrLenfn fnameh argsi nameM lenM~valch1ch2nf3f SfTracesfT Exec'T 9GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_check.c/SOFT/WebX/WebX/srcintunsigned char<long long intlong inttime_t@]tm$Etm_secFg#tm_minGg#tm_hourHg#tm_mdayIg# tm_monJg#tm_yearKg#tm_wdayLg#tm_ydayMg#tm_isdstNg# <charshort intshort unsigned intlong long unsigned intlong unsigned intdlong double heapblock&m_next' #m_used(l#heapblock_t*Zheapalloc,smallreq-Z#bigreq.Z#X_heap0#` patt#dimPATT#pattCACHEt X_get_intg buff val leng ig #$^XYZ]zX_check_float*g$nbuff)hi+g\ len+gdot+g[X_check_date?gXnval>hdaylong@tbuffAdayBgXmonthBg` yearBgc_dayC~c_monthC~c_yearC~ spaceDg iEg nEgaatoiNg8 [8]8[ 0]X H]g] d]c"d] jX_check_intYgXnbuffXhiZg] lenZgX_todayi(nhphnhtmjXTkDbufflHchplhd]'&g(npatthvalicacheɤcurrgͤig`amalloctIgdim_LOADpattg0g `!0gxdim_FREEpattg"freeg]X_CMPpattg0npatthvaliop` sstg#s&g$!&g!&gEX_user_cmpg0\nv1hopiv2jPgIg$/p!g!g%X_user_icmpg\ln&v1 gh&op i&v2 gjPg!Ig% #X_user_fcmp8gln&v17 #h&op7j&v27 #` Pg!Igdouble'Tracesg )GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)FMdate.c/SOFT/WebX/WebX/srclong inttime_t@k1tm$Etm_secF1#tm_minG1#tm_hourH1#tm_mdayI1# tm_monJ1#tm_yearK1#tm_wdayL1#tm_ydayM1#tm_isdstN1# intunsigned charcharshort intlong long intshort unsigned intlong long unsigned intlong unsigned intPlong doubleub1 ?ub2 vTdatime year #month #day #hour #minute !#second "#datetime_t $}SETdate -1(n v ,}h  ,i  ,j  ,1k count .1] T /w tm 0X ,H     `h pb h x    ``   ! 4 ? J U `i`rX !"     $`-P <##     `HT$,%, h s ~  (`@TGTOsecond /1v .} . . .1i 01n 01{ 1G n 1WWd)X 1W` 1WWWP8]P TOminute N1v M} M M M1i O1n O1{ PGn 1WWdX 1W` 1WWTOhour m1v l} l l l1i n1n n1{ oGn 1WWdX 1W` 1WWTOday 1v }   1i 1n 1{ GZn 1WWdyX 1W` 1WWTTOmonth 1v }   1i 1n 1{ Gn 1WWd6X 1W` 1WW TOyear 1v }   1i 1n 1{ GX 1Wn 1WWd 0 g W` 1WW o Rg W` 1WW  g W` 1WW g W` 1WW oX_date_info m1((nyear l ohmonth l oiday l ojhours l okminutes l olseconds l omX X_dt2str x1()<ndt wk  wY  wZ v yTh tm zX RX_str2dt 1)<)n  h  idt  Rj v Th tm @!tmp k"Ok *1ͨ"Skip *1ͬ"Year *1Ͱ"Month *1ʹ"Day *1͸"Hours *1ͼ"Minutes *1"Seconds *1 44)GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_AVL.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublenavlleftn#rightn#balance#key# data #avl_t"avl_tree%root&#cmp'#t e  avl_tree_t) favl_insert@e),n t?f` a?i HGh^l**}**Q****]Q hih*+hl++}++ ,,$,,$:,d,t,d,tQl,t,},t,]Qavl_swlrootabavl_swr'root&a(b)avl_nasty1root0 avl_removee,0Tn tfh aive` Wssteh ssteh-t--t--.L7@XKi....Q(l..}..]QA./HXll/H/T}/H/Tl//}//l/0}/0Q00$00$]Q0$040$04Uavl_removerootetfssteaavl_search"t!fa!x#etree3 tree)!U0T0nn`xiX"00hh#oAVL_search@t?fkey?aAt$Ie%  e !01ni Y,X&6%U110`X"1t1P0H'AVL_removee12n(tfh(keyia$Ne%12<H,XU22<`hX"22PH) AVL_inserte244n tfa ai$ e% b330Y,XU3 30`X" x33PH*TraceseoՄ9`44GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TOOLS.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublepX_take_stringg444^buffXvalYig\ng[X_arg_string=g buff< val< i>g n>g ch?  stop_char* ch)2p46|nh]lkk505p AX_arg_string_sepeg6|9`nbuffdhvald]sepdjifg_nfgi chgA66 S ]66hmA77TSQ ]hlp79  lkk78( stop_sepYg chX sepX iZg=@9`GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)X_heap.c/SOFT/WebX/SQLintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleHheapblock&m_next'H#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#NX_heap0a UX_heap_new#9`: n hp$h  w  5_'99(_9: C(_free0_IX_heap_alloc>: <ncurrheap<asize=_i mb?` cp@h 5_  w I::]@gQt]/;;H w;<(_rmalign_mbbegin_end_5_ )X_heap_free_<<nhp` mbX 5_free0_ggetenv?ggetlinePgstrlen  <getpidUgunlinkWg8strcpy   <]memcmp g E E LAAdAApXmemcmp g E E  memcpy   E  memcpy   E .?+Kstrip_nameg namechpstrrchr  < g strcpy   <!f"__iob"POST_errmsg"Tracegu<HFGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libget.c/SOFT/WebX/POST/srcintunsigned charunsigned intlong long intlong int'name%#val&#charentry'qGET_pathdFG@nentqanamei id` pathb Tgetenvd strcmp d w w}GET_parser2dG@Hnent1qhname1i i3db x3dccl4dno4d query5a path5` chp5X3strcmp d w w Igetenvd GH qstrlen | w strchr  w dHLHmalloc  | strncpy  w |POST_errmsg^mOLHGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)util.c/SOFT/WebX/POST/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned char(long long intFILEJblong int BmakewordBHILn lineBa stopHi xc` wordB mallocPstrncpyBBRHcharXH fmakeword)BILJn fp(h stop(Hi cl(j ll*cb out*cc word+Bh buff+%| mallocPmemcpyPP=c6H6S(Cpx2cHHwhatGB digitIHDJK^VXb]unescape_urlTKKn urlSBh xUc_ yUckDKTKXjKhKbmQescape_urleKLn urldBh valuedBi xfc` yfcaplustospace{LL^ strzBX x|c] rindcLM4n sB` cHi xchstrlenR +getlinecM4Mn sBh nci fpj ic`YindcsBcH xc+MN@^=\FYOXescape_shell_cmdN@O$n cmdBh xcZ yc\ lcX strlenR+NlNlYsNlNO\GETenvBO$OLn nameBh vBX getenvc! >UdOLGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)dim_PATT.c/SOFT/WebX/PATT?long intunsigned charcharshort intintlong long intshort unsigned int?long long unsigned intlong unsigned intlong doubleq5 )PATT_NEXT *q#PATT_OR +q#ch0 ,u#ch1 -u# PATT_OP .# 5 0 dim_FREEpatt  L  free w OLO|nh dim_LOADpattO|RnbufhLw`TbOR_patt`ialenStopdop_TESTeop_SIDEfmallocRR`u#dim_ORpattRTDnLhchuST$ vp_SYMcmp2 dim_EXEpattTDUdnLXbufii`lenStopTh!*VUdGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)dim_CMP.c/SOFT/WebX/PATT^long intunsigned charcharshort intintlong long intshort unsigned int^long long unsigned intlong unsigned intlong doublevp_SYMcmpUdVns1`s2injAlpha#ASCII*Init+i0\j0m0Xt t a"`VVGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintklong intunsigned charlong long intkcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charSItypeIDItypeMfloatdoubleDWstruct%high%#low%#2s0ll1 DWunion2 __muldi3VVn uhi vjk uu vv whi __w`a#.ZVGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintxlong intunsigned charlong long intxcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeNGfloatdoubleword_typez3DWstruct%high%#low%#R2s0ll1 DWunion23 __divdi3VZn uhi vjk cb uuRhi vvRjk w\] iWWa0XY h`]*Z5[@]J_U\]Xer[Y8Z\[__udivmoddi4ndrpnnddrrRd0d1n0n1n2q0q1bbmww__xr__am1m0R__clz_tab*$^ZGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeNGfloatdoubleword_typez3DWstruct%high%#low%#R2s0ll1 DWunion23 __moddi3Z^n uhi vjk ce uuRhi vvRjk wh }Z[pdhpbcXak `]"\-]8_BYMx\[]j[__udivmoddi4ndrpnnddrrRd0d1n0n1n2q0q1bbmwww__xr__am1m0R__clz_tab*%e^^GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDfloatdouble__clz_tabW ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hWebX.cdata.h(((())))))))0)0)D)H)T)\)` )d)h)l)p)t)x)x))))#)q)#)q))))))))* ** m*!**0*4*8*@*P*\*l~*p*t}*x*|}**}******************%*o*%*++++-+(g+4+P++Pi+X+hE+hO+pE+xK+xI++++G+7++++++"+++t,,, m,4g,<7,L,X,da,t,t,|,b,,),, ,!,3,,,,p,----- D-,-8-@O-`-l?-tP-D-P---N- ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_ACT.c-+-- ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_ENV.c-:-t-(....0 .D .H.P .X.X .`.`.l.l.t.t......... .../////4/<m/Le/&/n//%/o//$/p/0#0q0$04=0L0\0h0|%000000i0)01 ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_MSG.c1.11 1 1$1(101@1H1P1T1`1p1p1x1111111a11/111t1112 22r2,2< ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRACE.c2<2@2L2`2`2h222E2233333$383@3P73\333b34 i4(4@4X4h4h4x44444444555(5<05P5\_5`5d5l5x5|5556 66$6(6(606<V6P6l6l6t6666666 6667777 7 7@7@ 7H7h7|77777_7788@8dt ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRANS.c8d8h8|888888888888888899 9909\9t999999999::::$:L:`:`:h:l: ::::K::O;";r; H;Z;, ;,;4 ;D;D ;Lj;\;;;;;; ;5;_;5;;;b;;<<<0<4u<4>>>,>4>4>< >@)>@k>H)>T">Tr>\]>dE> >> >> >j>>>>???$ ?(5?(_?05?<b?<2?Db?H?H?`?h?x?|u?|?u?r????????@ @ @0@4@@@D@Dz@L@T@h@lu@l@u@y@@@@@@@@@@AAA,A8A@AHA\~A` AtAt A|AAAAAAAAAAAAAABVBBBB$B$B,B8BLB\B`BlB|BBB BBBBBBBCCkCCCC C0/C4CHYCPC\CdCdClCxC|C| CCCCCCCCCCCCdC=CWD^D DmDD D$D(D(D0D8$D@DHVDLDLaDTD\ DhYDpDDDDD]DD~DDD~DкDDD DDDEEE E(E0E4$E@EH_EHEPEd E|~EE EEEEEEEE EmFF5F~F$F(~F,F,~F4FDFTF\F`F|FFFFFFFpF#FF FFG !G~G G$G$~G,G4GLGTGhGpGxGGoGGGGGGGGGGGHHHH,HPH`HlHpHtHtH|HHHHHHHuHHHH HHHIpI0uI JJ(J8JDJHJLJLJTJXJ`JdJppJp$JxJJmJuJ JJJJK KKKK$K@qKDKHKHKPK\K\KeKKKeKKKeKK L L(L(uL0LLLlL|LLLLLLLLLpL~LܕL~LeLM~MeMMM4M8MDMHMLMPMdMMMMMMMMMNNN N N$N0N4N8N<NHNPNTNXNdNlNlNtNNNNNNNNNNNNNNNNOOO O4O<OPOXOXO`OmO'OnOOOOOOOOOOOOOOOPP$P4'PDPPyP\PpPPPPPPPPPPP PP$PpP$QQQ Q(Q( Q0QDQD QLQ`Q` QhQ|#Q|qQ#Q.QfQ.Q2QbQQQQR R RRRR R,RDRDRLR\R`RdRhRlRtRtR|RRRR~RR{RRR}SS 2SS0S<SLS`SlSxSoSS}SSSSSSS|SSSSTT}TTTT$iTXT`TdThTtT|T}TTTTiTTTTTUUU UU$U@UPU\iUhUt\UUAUUUUUiUUiUVVV$V81V8cV@V\V`VV VVVVVVVVVVVVVVWWWW$AW,W4W8W@WPW\zW\WlWpWWWWWmW'WnWWWWXXXX XXXXX$X$X8XPXdzXliXxXXX XXX XXX XX XtX Y YtY YYYYYYYYYZZKZZ,Z<ZPZX|Z`ZdZhZtZZZZ~ZZZ~Z}ZZ^ZZZ[[[[[$|[,[H[T|[\1[p;[pY[x[[[[[[[[ [[$\\\ \ \\\\$\(\,\0\4\4\<\P\\\\}\d\h\l\p\xL\\\\\~\\\~\\\"\}] 5] _]]T]\]`]d]d]l]p]t]|]]]]]]]]]g]]d]]^ ^^$^0^0^8^H^P^`}^d^h^h^p^K^%^o^_0_L_T_X_`_d_l__]_;_Y_```0`<`@`D`L`T`X`\`pk```~` ```m```&`j`~``Kaaga a a(a0a0daHahahapa|aaaaaaa|aa|agaaabb'bmb,b@b@ bHbPbTbpbpbxbb$bpb$bb bbb bcc c c c tc( c< c<tcD cXcX c`ct!ctsc|cccc cdd ddd d$d8'd8md@dDjdHdLjdPdTjdXd\jdddldxdddddad'dmddjddjddjdejeeee,e<ed~eleeieeSe ejeff~f f ffkffff4fDfLkfPfPkfhfpfx@f|ffff ggg8sgHglgt|ggg gg]h.hhhh sh@h@hXh\h\hdhhFhhhhhhhhi(,i0bi<i<iTiTi\i`ihihii)imiimiiiܭi{j{jjjj$j4j@jgj1jjj3jajjjjjjjjjjjkk k$!k(k0k4kDkPkTkTkhkpdkp0kxk|k|kmkkkkekkjkkk kkukkll$l0l4l8l8l@lHlTlTl\plul lulhmNmnmmnm,m8m8m@mdm,mhm,m mmumnmmmn nn4nHndnpntnnnnnnnonnnoooo!oH oXo`nopopoxo$ooooEoooopp$p@pLpPp`pppxp|ppppppppppppqqqq q(oq(q0q<"qPqXq`q`qhqt2qEq\qq1qfrr Sr r r(r8r8 rDrXorhrlrlortrrrHrnrrrr$rrrr&rrrsbs sss0os0s8sD:s\osps|$ssssNsssst t t<tHtLt\thtlt|tttttttttuu$bu8u@(ulou|u)uuuuuv vv4vHv`vlvpvvvvvvovvv~v vvvqvww ww$w0w4w8wTwTw\whwxSww$wsww(wwwx$xx sx4!x4sx<xPxXx`qxxxxxxxxxxyyy0yDy\yhyly|yyyyyyy yyzzzz$z$z,z8zHVz\zd$zszz$z)zkzz%zzr{{{{ {({0{<{<{D{P{P{`{p{|{{{{{||||(|4|D|H|X|d|h|l|x|||||||}}}(},}D}D}L}P}P}X&}hJ}|} } }}.}}"}r}~~~0~<~L\~\*~t~~~~~~ ,8T`dhg   " $8@Ddx$(,P\xg  "(<Hdx8@@HXX `ptx|^(o1<P\x0LTT\ll t^(o 1$}0@@Thtu (0<L`Xhh|  (8zDTTh| |~(,,~4 8<<|DPht|!s!s   % $(,0DT\Tpx|X 2{LP``t$ ,4<LVXx!s u (@DX`jf,@Lh||Y  <@DHdX^\ `mdptxx$Va |2Y g,<<Pt i 0Tlxx~ (4Pdtt|p,#}}~  8{@DDPHDLJX`~p pt t t t t t t4 4tPP \$lt)}~  b,,48<H\}lpp~x |ؔ},00~8 <Thtp|| ~ 4L`%`ohx|||~ ~|~ ~~Xhhpt|x||~ ~,n||~  $8@~DD~\d~h~h~ |~  ~D\d~40HTdxqY  @\hxq|8TpxY(Hlt e((0LX`h pxd,Hdltt|d (D`hppxb(0 DL\db0<Xl f$8D`t ~$8D`t~~$88TT\ppx  ,h f(0$@@PyXp|w(rqD4  008LL\'dhdpecq!F( 48<Dddlx7%o$(,04X<fD.DfP%``h||U+&L00@<PPd lM$$4DDTddt$HTpyy R,G088@TXQXC`h|pt||j{ 88@T`t||Y;  Z,:4XP<XWt=|^6]7\8[9 P(D0QPCX ppxt $<HtP`pBx`4OENFa3j4*<V\>dU?uf.t ,8T``|{ {(`D0LMhGpLH DXLddlu44<P\x +~ <HHd~ 4Plg (B@@~H\h ! (0kDLx`hq|z\6   8DDTptx][   $&$n,@@HTT\hhp|| 3a   08<P\lu~ s~    (0HPcPdclpxxn   n 44<HnH\dhllxnuun U C0Todx”œ¤E´¼u~ s t  Pe4<uP hixÜoìøøoo(8|DPP|rĄĄĠ  r 8PrP XppxŌŌŔŜŤrŤ Ŵżruu r  $$,,<DrD XrX prx ƬƸ   $(48<@DHLLTlDŽǔǠǨǬǰǴu#o u  u 0:0Z8DP`ddpȔ'ȤȨȬȰȼe3a$$,DTT`lptxɄɌeɌ/ɨeɰɰɸ3"ru $  (u( 0LXdlltx|ʀʐʨʰ:^V _-g,-4N@PTd|ˌː˘˜˜ˤˬ$(4<HLPT\hllx̴̠̤̤̬̀̄̈̌̔ ((,88@HHX\hhpxx̀͠Jʹͼ7i~h~  4~@DD~L P`lip~|΀΀~Έ ΌΐΐiΜΨμ^ 4HPlπϐϐϘϠ=N(i$08j`ltjРШиspp$DD LTT\xѐѐјѴ%or  r  4PX\``hp҈ҔҔҬui,8ThpxxӀӐ ӔӬӬӴӸӸs  s 0}<P T`t|ԀԀԈԤԸ #,.,f<dlppxՀՄ ՈՈՐ՜ՠմոոn%n *$8@DLTUdl#|֐ְ֤֔֔֜}yyy  (,048@DHLPTdll t || ׄ"׌אהטללװj yy yy$((88HH\`hllt||؄؈ ؜بشm y(G,@DLPX\`ltt|ٜs٨ٸZ 4LPPXdhpڌڨڼڼq*g'(,48@DT\\dۄ_۔ۜ۰ۼ~  $(48<@l4l`t܈ܜܨܬܴܸܼv0 DXlppx ݌#ݐݐݘݠݤݬݴf/e/e4 $$@vd xބބޠ޴޸ ޸t  ( <DHPcpt|߀߈ߐߜfߜ.ߨ߬߰ߴ߸߼ $,044<Thtt   4HPXX`xp <)<kDL`|   sM0DL#\5\_d5|    s08L$\d| l  (DXd (488TX\`dhl|X("b $%0@@L`dp (o<PXhp|     ,,<Xddlt"$($(p0Hh  $88@TG\~~*$ ,@T%To\tw~  QC Q C(M0~Hh 0s@@Hpx|  s r    (0DLrTTpxuu r  $$,r, DrL `dd ԱF 8b@0@dHL1Lclo5_x,00x8 <H\\dtt|hydF 0Lt tt|; d t ((@ D'DTi|#|q$0HPX `hy  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_VAL.c ~,DLTTlxx~$<DLLhnt~ԧ~7,,4Ht^  $,,8<-<gDuT~hxx~ q30<~HPTT~l|~  $((0H`t|(@T\`t|/4@H\\dlxQO4Pl|%%<MX(!4< DT`ppx q  ((88@tt| rj#q0 08 @*@"HrPXh x U /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeEXPR_parser.csys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hEXPR.yEXPR.tab.cx (+q!$1c1c1@T\\dlpx |'9  ~ <@@`Ghhptt|%m  $ $(|08@@ HTuhx t#q#r  } (4u@ @x\   " #   u4@B@RHLT*Tj\*IN(<Pdx_Cq(<SHHP`  h}pytF|F@ \ T-  b (  Lq # l ( g -    u @d L Lu T   7 d  u  u  u  $ ( , 0 4 8 @   Hu               ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_EXEC.c C  , H X X ` l l t u    %     $@HLXpux'  Xddlpo)$@T`lr  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_check.c-   $(@HL PP X\ \dh h ! RBU $,,48 @DTT\hltt| >,N00DDXM\t!(O0<<HHPP Xddlpp x(@pD$PXhp|O  054H\\dtt | ,,HHPd!pX2[1,Z7\$((0DTT\h"tu((0D\`t-d$$,@@HXqlt|'t#q  (<LLTlp|,,4HHPh'pc,c+p44<T\ ll  /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysiso/time_iso.hmachtypes.hint_types.htypes.htime_impl.htime.hselect.htime.hFMdate.c  !D7Xad}d}&n  ((@DHmLL}TX#llt|h"}'m      $ ( , 0 @ H H ` d hl l l} t |}          ~  !'!m!!$!(!,!4!L!T!T!\!`!d!h!x!!!!!l!!~!!~! !B!!" " ",","L("Ll"T"\"`"d"l"""""""""""""k""~""~# #C#(#(#H'#Hm#P#X#\#`#h#############l#ܿ#~##~$ $ '$$ $,#$D$\$\$|$|$$$)$k$$$$$$$$%% V% %(%,%0%0~%8%@~%LT%T%\E%p%p%%%%%*%j%%%%%&&&&&$|&(&,&,&<&H&\&\&|&|&&&)&k&&&&&&&&'' ' $'$'$'0'0'<'<'H''Hm'P'T'X'X'`'p'p'|'' 'U'(((((((((((())))u)$)()<)@)T)X)\)`)d)h)l)p)t)x)|)))))))))  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_AVL.c)S))))))9)[** * *0**06*@E*D*H*X$*Xp*`*|*|****Y*;*N*****************+Z+i+++/++8W+@8+Hl+L+P+`$+`p+h+++++++^+++++h+++++X+,,,r,, ,$<,,,46,<,@,@ ,H,\,dq,h,l,p,ts,x,|,,,,,,`,4,,,>,V,,6,,,8,`,------$-@-@-L-L-T-l~-l-t~-x-|----------{------.. ..$.0.4.L&.T.`.h.l.l.t......~..~..~.....s......$.////// /0~/@/Hh/L/P/T/`/l:/t////h/////9//~// ///g/0000 00000$0(0,00040<0T40X0\0`0h0t0000000000 0000 00111 1 1a11 1(1021<a1D1H1P1h1t111111 111_11A222a222t2 !2<.2HZ2P2X<2ha2pr2/2 2222222~23333333 a3(3(30~383<3H3P 3d3h3l3l3a3333.3~33r3 33333~3344$44{ ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TOOLS.c44,444L4X4X4t44444444444 4444455j5*50j5<5<5P5P5d5d5p5|,5555555!55566 66 6,j6, 6L6T6\6d6l6|D66666X6<66q66666'77 7 7k77707<7<7D7T'7l7p7p77J7j7*7j8 8 t8(84,8<8X8\8d8h8p8!8888a8 8 8t8388 9999098H98t9H 9Ht9P9` ../WebX/include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hX_heap.c9`69d9t9t 9|9|99 99999s999:: !::: :(:4:8B:8R:@:D:L):Pk:\:d :d:l:x:|:::::: :k:::g::h::g::::::::::; ;5; ; ;(;0;8;<;@;HD;`;d;d;;;;;t;;d;A;<6< <<< <8<<<<=-===============><>D>L>T>`>`>p>x>x>>u>>u>#>q>>>>> >>>? ??s?(?8?DC ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibEpost.c?D8?H?`?p?t???????????????!?s@@@@@ @(@,@4@8@@@D@H@L @L@T@t@@y@@@@@@@A AA,A4A<A<ADATATA\<A`AdAAAAAAAAAABBBB B$B$B,B<BLBT4BlBluBtBxB|BBBBBBBBBB<BXBBBCCCCCC$C8CPC\Cd CtC|HC|LCHCCCpCDDHDXD`pDlD|D|DDODDDDDD!DEEE$E8ELELETEXEXE`EtE|EEEEEEEE!EEEE]FFFF F0FTF\#FlF|FF- ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibget.cF,FFFFFFFFFFGGG GGG G0 G@$GDG`G`GhGt*GtjG|,GGGGGGGGGGGGGHH HH uHHH #H(H,H4SHDHLH\H\ HdHxHxHHHHHHHHHHHHHqHH@ /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hutil.cH.HHHII(I4I@ILItIIIIIIIIIIIIII IIsIIIIIJJJJ JJ(J, J0J<JHJ\uJdJdJpJxJ| JJJJJJJKKKK4KLKToKX%K`oK`%KhrKK#KlK#KKKKL0L4LL"LTtLXL` LhLhLp Lx"LLLLLLLLLLLMMM M M(M4M<MDMdMdMpMpMxM|MMMMMMMMMN N N4N@NDNLNlrNNNNNNN"NoN)NOO O$#O(O@OLu- /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_PATT.cOLOPO\OdOlO|~OOOOOOOOOğOOOOOOOO~P P~PFPNP$>P4P4 P< PHPL:PLZPT:P\%PpPtPxP|PPPPPFPNPPPPPPnPPPPPPPPPPPQQQQQ,Q,Q4Q\Qd'QxQ|QQQQQQQQQQQQ%QQQQQkR RR)R R$R,NR@RDRHRLRPRXR`QRtRxR|RRRRRR6RRRRjRRRRRyRRSS$S$+S0S8]SHSL0SXmSlStStS|S%SuSSSSSTTTTTTTDTHTTTXTdTlTp)TpkTx)TTTTTTcTT*TjTTTTTTTTTTTUUUU$U0U0U8U<U<UDULUPUPUXuUd /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_CMP.cUd2Uh'UtmUt'U|UUUUUUUUUUUVV include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.cVVVVVVV include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.hVVVVWWWW~WWWrW W$W$W,W0!W0sW8W<WW*WjW*WWWWWW'XX 4X `XX(X(X0X45X<~X<XDXPXTXXXYY &YY(Y87Y<YDYHYLYPYTYXYYYZTZXZXZZZ<ZG include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.hZZZZZZZZ~ZZrZZZZZ!ZsZ[D([H[L[L[T[`[d'[dm[l [p[|[[[4[`[[ [t[\\\ \ \9\~\\$\0\4\8\\\\]]:]]]$],]0]4]]]^0^P^P ^X^d^p^x^^^ include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c^ | (D -  )0)DL - ) - *lH -  |  - | - - 0\ -  | 1< -  | $2< - $2 - $4l -  | 8d - 9D - 9\D - 9H - 9 - : - @ - A\ - BX - B\ - C0l - Dt - F - G \ -  Gh0G\ - G - H - J` - M4 - MX - N x - Nx -  O O4 - PP -  ij - m - o - s( - u - x - {p - ~t - 8 -  -  - $( - L - 8 - L - L - $ -   -  -  -  -  -  -  -  -  -  - d -  -  -  - X -  -  -  - 8t - Ƭ - P - $ -  - и0 - H - 0 -   - H - ( - ٸ -  -  - h - @L -   -  |  ` -   -  | -  T$ -  |  x   -   t -  |    -    -  , -   -  |  ph p$ -  p -  pXh -  ph -  p(\ -  p -  p0, -  p\ -  pl -  |    -  (T -  (d -  )< -  |  ) -  , -  0T -  0 -  1 -  2< -  |  44 4 -  6| -  | 9` - :  - < - < -  |  =@=H, -  =t =| = | = -  | 4?D, - 4?pT - 4? -  | F - G@ -  | Hd - ILt -  JPK - K -  L`LP - M4 -  MTN@ - O$( -  | OL0 - O|\ - Rl - TD  -  | Ud -  | V -  | V -  | Z -  X_header ,X_avlcmp X_start wmain eTrace yX_INSERT_ID ent Debug Cookie X_eof X_fpX_BASEX_BASE_hold5X_PAGEJX_ERROR`X_HOMEuTMP_DIRX_ERRMSGDIRx_BUFFERS_X_action#=*X_envX_exitLERRMSG2g iPrintTM X_debug X_trace#$_u X_search_command /lowercase nuppercase X_fflush X_fgetsX_quitX_clear_valueoX_put_valueX_add_valueX_get_valueX_free_allCX_free_cidHTML_string}X_putchartransvalueGetDDTOdate_YEARdate_MONTHYdate_DAYX_get_baseKX_cryptX_transvalue(X_printvalue(mX_transline)X_shmdt+ZX_shmat.)X_io_fseek/9X_io_vfputs0rX_io_fputs1gX_io_fgets2xX_io_pclose3IX_io_fclose4X_io_popen5X_io_fopen6X_return7X_exec8JX_replace9X_fork:X_cookie;X_clear=X_unlink>X_error>X_letCdX_addDJX_setEX_shellFX_sqlnamesGX_chdirHX_usleepIX_sleepJ,X_sqltrapKKX_htmlLX_compileLrX_optionNpX_trans_printfileNX_includeOmX_commandVX_printfileY`X_notfoundZYX_call\X_signal]^X_error_cid]X_get_cid`xX_sqlexecaYX_functionbX_while_valuescX_while_wordselX_while_loopeX_whilegX_foundiX_sqlkX_xFilemX_FilenBX_ifsX_stdoutR9X_default_names )X_check_name yX_values X_set_cookiesXXyyerrorgyyparseEXPR_parseryycharyylvalyynerrs?bX_exec_callstrcut]chcharStrLen =X_get_int#X_check_floatzX_check_date"X_check_intjX_todayX_CMPexecX_CMPpattX_user_cmpEX_user_icmpX_user_fcmp8 X_date_info uX_dt2str X_str2dt; oAVL_searchAVL_removeAVL_insertFԆsX_take_stringX_arg_string2X_arg_string_sepPX_heap_newUX_heap_allocX_heap_free)X_heap_reducekܜX_databaseEX_select_sqlX_noselect_sql/sql_error_X_finishX_rowcount.? POST_parserPOST_errmsgE_CheckEnctypeMethodGGetMethodE_POST_parser*^GET_pathGET_parserLbmakeword]fmakewordpx2cunescape_urlescape_urlQplustospacerindgetlineYindescape_shell_cmdGETenvOdim_FREEpattdim_LOADpattdim_ORpatt#dim_EXEpatt: vp_SYMcmp$__muldi3b__divdi3pb__moddi35__clz_tab(-=-41<g2<($_8d49 x   @ ) hԆ44,9`ܜ=@L?=_?D`^FDLHdOL:UdVVpZT4x4Plx(4 h $@(<lP00L<8 0 l l4TXL"l"!!x)*<$P$`x**<$P$`($(8081P'H(p(8181P( (,$0   <  $`$t!!$t$!!$t$!"l$$""l$$""%%""%%#$(p('',%&$H$P//X.8.$%()%X%)X)()T%X%)d)((&8'((+++,4,T,d..,,,,---..8.//X/081P1x2 2055`3P4303@2H33`3505D6D667<88:4:t89,:t;89:$:::;8>X>x?@$PPRRV$WHWdWV<VWdWVVWW4VVWW$Z$Z,bb$` `lZ|Z]L]tZZZZ]L]tZZZZZZZZ__^x^ZZ\,\^ ^4\L\l^ ^4\\^4^\\]L\]^4^\]^ __]]__^^__^^^^^^__`a$_(_,aa$_0_L_(_,_0_<_`_|`a``bb$``4````$``a$aHahaaapq,spt0rrr,rPvw$w@xy<ty<y{|4|4| }~Xt~XXt|L<XL<Xt <T`hXdd\`h`dd\`ht`ddp0tt@``p(@,4H0< $<xdt<Lt (<X<L<L,dt|$8D L`dX\HLDpthlX0XXlx|HT<LT`XxLp T,0D@0D<DX0dx X P p X h X  4 0 pp (,8`(4@\Ll000L D(tLpl|<p|L |( (| HP|pxTd0p $<p $ $ H d ` T d `  ( 0 ` \$ @\`Pdt$`hdXT|dX 8px0<H,@(HX08l\<|8l|X_add_valueERRMSGX_headerunsigned intunsigned intunsigned intunsigned intPrintTMunsigned intgetpidX_notfoundX_io_popenX_heap_reducenextX_cookieX_debugX_io_fgetsX_io_pcloseX_io_fputsfoundX_io_vfputsignoreX_select_sqlX_transvaluevaluebuffoffsetERRMSGdate_MONTHcompileX_sqlexecX_callX_io_fopentransvalueX_returnstatusX_unlinkX_free_allX_functionX_io_fseeksizeX_arg_string_sepX_arg_stringX_free_cidsql_errorX_heap_freeX_io_fcloseX_translinedate_YEARnameunsigned intX_user_cmpX_includeX_replaceX_traceX_while_loopX_while_wordsdate_DAYX_exitX_while_valuesX_printfileX_tracefnameX_arg_stringX_check_nameescape_urlunsigned intX_default_namesERRMSGX_debugX_put_valueyynewbytesunsigned intyyerrorX_traceX_arg_stringunsigned intX_get_valueX_CMPexecdim_EXEpattunsigned intERRMSGX_tracesprintfsscanfstrcpystrncmpdatebuffformatdatestrmodeunsigned intright_subtreeX_traceleft_subtreeunsigned intunsigned intX_traceunsigned intERRMSGmallocunsigned intunsigned intunsigned intunsigned intPATT_LISTunsigned intpatterncurr_pattunsigned intunsigned intunsigned intunsigned intunsigned int.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab p  X X"((o## -B# # $  7B#D#D AB#\#\ K'('(7Q^^W__]_(_(32,F44 e44nt{d  $$<(((  ya C&H L0( "A %A9 % =/07070100007762000081ed0000000000000000000000014b9fcb34000550d8000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/WebX.mySQLELFG4K4 (%#44;;;;AA/usr/lib/ld.so.1 !"$'),-./01235789;<=?@BCDEFGHJMNOQRSTWX[]^_`abefilmnoprtuvwxyz{~  !"#$%&'()*,-.0124578:;=>?@ADEGIJKLMNPRTVWZ]_`acehjlnqrtwx{|}~  #%&(*+46:>AIKLPUVYZ\cdghjkqs|}    +/369<BCFHOQSUXY[\^bdfgikmopsuvyz@ @5 ( 1A<4H EA4N V0 ^e ny0T rt}T @ P d  O, ` L $  , Q`<  *j, =À EӬ  U ^ yD     (@! cl t X Jdt OTr "cp /^ >F\P= P>%>W@_?gh qhT }p =Aw  @\   @tOPlUIL   8h 1h J  #tt - 5>:I H>O@,Z?c@ k wxT ?Of@D NOH > >|> y  8 ? 2 -J><EN, KUQ>XI@Xh gD qX >~  ( U(O$ P <  8 = ( <!h'?`/A(Lfp X QT ALh  (@$R4-t @?G4 Ng0 Z@_4` oYD y \$ -t $ zh( O BhV Ҁ, ̈́p ,D ` =8d x  ., '1 5θ J8 \ gx {=L ` Zl Ɯ$ UXl =,UL$ >T ;  < ?k (R 0LH :  C ASSO0eop  pT  Td @ $ (r$ U  p 4 ? <` Og I T 0 Hp T a< iO< td ~H0 l, .   , Bd < 7O`   k4` z\ ] Y?T ZH = %D 6FX ItD Ut <@ `\ g$ s@H  nx 6| Ad @h 0$ =P  a ! = , h, d 9 g\ $ \4 +P 8` HSX< S? \U dN p  m vD ~0  Od F !    `>d   jT t ?H ? $ h O4?$  , ( <i FILD OU TH MO e nY yn(X = ?l = > L >4 XT F`L > x $?< <J OhX 0 HH  <h 4 #AX,nx Ap5NG U@8c $t,d m4 U0|O D `=hd8 vT , 6, >@H gl\ p  4 h @  @A@T )4\ 3p =U,D! Lt P@Yd cT qJ ( =@ORD   OX=\?U ,  xl XD %HT 1@f=D7 ?0?>FFmx(P L@ QOL_ @g3h s8  AH8 Oe4 <NPO(F@(  a #p( 1U$=7F@8 M=U=\ qT zI8d =| O8Ft ZH , ` m bvP q >0>Gt  @P@ J8` O@t\h xx  H.P := @Bz0 OT YYxD c  tO%}a xH ?>p\X $  w` <O < ;  SH my_reallocgetrusageX_CMPpattX_io_fseekX_io_popencheck_scrambleendpwentX_shmatmy_openyylvalint2strrindX_rowcountX_stdoutload_defaultsmysql_data_seekalloc_dynamicsystem_filenamesf_malloc_prehuncmysql_escape_stringmysql_optionsbchangemysql_pingX_shmdtX_ERRMSGlocal_thr_alarmCheckEnctypeMethodmy_readinit_alloc_rootX_cookiemysql_read_default_optionsmemdup_rootmy_ltoamysql_connectX_exec__iobX_io_fcloseX_clear_valuetest_if_hard_pathX_search_commandmy_file_infoX_put_valuemy_time_to_wait_for_lockGET_parserX_select_sqlX_noselect_sqlnet_buffer_lengthstrchrgeteuid_Q_qtoiX_get_cidHTML_stringfind_typevfprintfbcmpunescape_urlset_dynamicbzeroX_while_valuesgethostbynamemy_have_got_alarmyynerrsX_BASEX_startmysql_field_tellX_xFileX_get_int_finifmakewordX_shell.divX_avlcmpX_io_pclosegetsockopt_Q_qtollstrnmovX_error_ciddelete_dynamic_elementsystemmy_disable_flush_key_blockssocketX_signal_my_signalssf_max_adressX_fork__flsbufshmgetmy_fdopenescape_shell_cmdpop_dynamic_Q_divX_check_datemy_stream_openedgetcwdX_envX_eofrandominsert_dynamicX_commandX_check_namedim_EXEpattX_returnerrbuffTracemy_once_root_blockget_salt_from_passwordX_exitaccessX_unlinkmysql_row_tellmysql_list_fieldsmy_fopenX_io_fputsstrcmpmy_errnostrrchrgetpwnam_etextmysql_get_client_infomy_umaskmktimesf_min_adressnet_real_writeX_usleepX_setmy_mallocmysql_fetch_lengthsstrxmovmy_multi_mallocsrandX_add_valueX_trans_printfileAVL_searchlstatmysql_get_server_infonet_write_commandto_upper_latin1X_exec_call_Q_mulstrendX_free_allfreadmysql_fetch_rowuppercaseX_sleepX_clearEXPR_parsermysql_debugGETenvsoundex_mapTMP_DIRX_arg_string_sepstrdup_rootunpack_filenameconvert_dirnamenet_endputenvX_translinemy_net_initchcharX_check_floatmy_message_no_cursesmysql_fetch_fieldX_io_fgetsmy_net_writeX_heap_freemysql_infoX_finishX_heap_allocmy_messageX_tracestrcpyX_BASE_holdmysql_dump_debug_info.remmy_filename_GLOBAL_OFFSET_TABLE_mysql_errnolocaltimeE_POST_parserPrintTMis_prefixX_callsort_order_latin1sf_malloc_endhuncX_get_baseunpack_dirnameX_chdir_edatadirname_lengthmysql_killX_set_cookiesatexitmysql_errormysql_stat_Q_addmysql_shutdownmake_typeX_printvaluemysql_real_querybmove_uppmain_Q_submysql_num_rowsfatal_error_handler_hookgettimeofday__deregister_frame_infox_BUFFERSX_functionmysql_eofX_arg_stringX_while_loopdim_ORpattX_cryptmemmoveto_lower_latin1X_htmlsscanfX_PAGEX_transvaluenet_flushmysys_uses_cursesX_str2dtmysql_thread_idmake_scrambled_passwordPOST_errmsgX_printfilevsprintflMaxMemoryX_sqltrapdelete_dynamicstrcendstrcutmy_setwdmysql_affected_rows__dso_handle_PROCEDURE_LINKAGE_TABLE_X_whilemysql_list_tablesdim_LOADpattX_heap_reduceX_fgetstouppermysql_use_resultmax_allowed_packetmysql_closeX_notfoundmy_endmysql_queryX_while_wordsmysql_fetch_field_directdate_MONTH.udivinet_addrstrmovgetpidmy_strdupX_quit_environfwriteX_letfreeze_sizeX_user_icmpX_free_cidmysql_field_countmy_net_readctype_latin1X_default_namesAVL_insert_Q_lltoqX_ERRORX_actionmy_closestrmakeStrLenmy_disable_lockingcurr_diryyparsemysql_real_connectmysql_fetch_fieldsGetMethod__muldi3fgetcX_sqlinit_dynamic_arraysf_malloc_quickX_valuesmysql_drop_db_Jv_RegisterClassesX_putcharX_headerX_fpmysql_field_seekmy_getwdX_heap_newdate_YEARisdigittolower__register_frame_info.umulX_Fileatoimysql_select_dbclient_errorsatol__divdi3X_fflushgloberrsmy_memdupX_sqlexecstrlenmysql_row_seekrealpathdate_DAYmy_dont_interrupthash_passwordgetservbynamemy_fcloseinit_glob_errskey_cache_initedstrlengthintern_filenameold_randominitmysql_create_dbX_user_cmpftellmy_errorX_get_valueX_io_fopenX_addX_todaygetloginX_iffcntlfputcX_includeX_CMPexecfree_rootX_HOMEyyerrorrndgetpwuidfn_formatX_take_stringmy_file_opened_lib_versionmysql_free_result.uremmy_default_record_cache_sizeAVL_removemysql_list_dbsX_replacemy_abort_hook_Q_stoqCookieX_foundnet_clearmy_printf_errorX_date_infofloormy_itoamemcmpmysql_portpRememberRootmy_initX_check_intcleanup_dirnamemysql_num_fields_DYNAMICget_typemy_disable_async_iomysql_insert_idstrcat_my_sig_remembermy_once_extramysql_unix_portfree_defaultsmysql_get_proto_infomysql_refreshDebughome_dirdirname_partstrncpystrstrmysql_list_processesX_optionX_dt2strmysql_get_host_infolCurMemorymy_prognameX_INSERT_IDX_io_vfputs__moddi3GetDDTx2cGET_pathmemcpyvp_SYMcmpsetsockoptselectX_errorcNewCountgetlinehome_dir_buffget_dynamicstrncmpdim_FREEpattX_compilelowercasemy_no_flags_free_dig_vecX_databaseyycharinit_client_errs_Q_qtosmemsetmysql_initmysql_store_resultplustospacegetenvdefault_directoriesX_sqlnamesX_user_fcmpX_debuglibnsl.so.1SISCD_2.3libsocket.so.1libm.so.2SUNW_1.1libc.so.1SUNW_0.9/usr/sfw/lib zt) zt8 ='BK =(U<=< <I3(hyY>>J>(>4L>@l>L>Xe>d/>p>|Z>>[>1>O>2>L>>>j>J?R? ??$:?0?<Q?H4?T?`z?lG?x?4??_???$?N????6@@t@ @,M@8_@DT@P@\<@h@t>@3@r@|@ @f@@@@@@AA9AA({A4A@uALAXZAdAp\ @D# @) @%@l>, @ |"@@@㿐#/؂`  @  `@@`" `@$@```$``@`  +㿐㿐/ͮ `, ` @ ```( `@ց㿐㿐a4 `a @#a4t@ǐ8 `` (@D R$ $$ ($ $ $ $ $ @$  a` @  N`/@@ /,* @H@ 0/@@ /,+ @ @ H?+ "$@C%a(R$`$$`$`$`($` $`$`@$` ! a@!P@!P@G  a(i)  + -/@"+`@L`-`@; ?a4 퀤 #a4@'a#t@'b8a(  @3@@4 a(a4`7  +@ma(`d0 \@ " @.0@+0T@(a0@ሀ  @@@`@b @!h : @ )'#a4 @֒%t@֐8a(@GM &&@Gg! |/@ؐ-t@Ð8a(!&#!@I6aH 2%|!@I aH/@Fa瀢 p@/0@p!@ a wb H@! [#$a,8)a,!@#b@ 6 +a8)+@  =(O8 #"+@% @~@KtG` -@w@@@m +@y  =ܐ@-@g "#a0@T J@8+tGD#a0b %$a,(@M@8 "88 $a,(@@@+ "8bH $a,(@3@ "8'X($a,@&@ u8%hp$a, "p@@#?c#a(`2@C@?@!0@@a(` #t@ېb8@ǐ@"0@#t㿐!!('T'X'H'L'P`%;a8`?? ;tH#a8@cp!(-!!"1;a 7 &!@" ?0a8@̐"a8@7 'a@" 350@cp?;"@cp0b㿈 @#a<a@` a<#`$a@ #a@"+`$ . #+ @ , a@"   #@cx$a@$  #aL'X'H'L'P'T`@;a$ 2 #!!H Ym aH`W @pa<`F9!@#a< `'!@ !@" , #(`#* !@.@  " cx#@U'!@$ aH@PH;a$ 909!,c@@   @  2,*@   'a$$aL9'a$@ $!H@97#0@3@c$aH@aH #a,'H'L'P'T'Xϰ?9!T`B;a(`5Ű `7 P@a<`;P9!@#a< `'!@ !@"+`$ (`#+  , !@@  " cx#@ϐ'!@$ H@aP@aP(`3`j9@P0c@a( @}  1 #aP'a(1#ؐ@a,a(@h @ !0@n@m`5 aP&(a,c@aa(`@H  @j51!0@O@N !"P$!( k'!T9;a9&P  @^ f  50`(@PaP@aP`(@@HaP@ aP`(`?@V ;`P@;0}c  @;aPt(㿐 K!` )X +!`!    @@W @"` 2`@> ,  @= ?R 㿐*   @: . *  㿐*   @: . *  㿐`H   `T` @㿐#a(`#@  `$, @`&+ .:   @@4,a(` "H"a(#bp`'(`)@" T@@n`@" K%@ 2(`,  @   !+  @$ ,@ @`& +,;`  ,@(9 Ғ@` ː(`" H ;  " 5 ("耤 ;bp,ဤ @` `` ` ` @ @" .@ @ ``@``   @ <@  @  @ " `@ .@ @ @  @ `.@ @ \( '0Βސ"[)7/ -/;( " H      !+  @$ ( * , 8`` &  (`, ǐ@Œ" Q@`@" G+b@ 2(`+H  @  !+  @$ ,@ @ `& * ,8`  ,@( Ғb@ (`" H h   c (`"뀤 bp[値 `  Ѐ `  @ @2*Ж Ѐ`2 @!@' ~π ? ~π`\"  @"](E( ' ( "u bpo +~Ϛ +~"ښ 㿐 @(b ?a(`# !$ 0̐ 0򀦠h0㿐@Ð@ P 2 0a(`#8  00@& @=& (@ @> & @& 6 $6 6 "㿐  @` @@ ` @&@㿐 1 T `%  " ,``,`2#`,  ,``,`2#`, @4 ?" $ ,㿐a(`G`쀤 ) T C   " ,``,`2#`,  ,``,`2#`,`&?%``,@;8 @;m@= (@P`2` &#h@4D ?" $ ,㿐a(`.`@; 5T` ``24`"24` `(@=@ڐ @=?$`$`@!$4`$`272 )T`"@`+ #ȒW ܒ ( 22` `"` @;J #a$2 "tؔ@p?㿐 @: 'R `2?R $`2   ` ( @`22@x @<ݐ&@$`  t # @<Ȓ &"㿐 @:w "  a(`` i bl ?+``` " "㿐 `x @', `   0 bl"  㿐aX` !\/```';b` 5\b ``.`(``& #aX !\(``;a`/a`.㿐`@`X C!!\ *@a1  ܀``]t@0h `܀``܀` !@?`N#@`܀`2 `!`2`t8`*K"`!``t`8!!`2@t݂8 !\+```# b \b   ` `*` (``" !\ #X*@21 a`(a`+  b8+ `܀`:!`tb8@㿐 -D `@]`@lD`@4~.0|`. @`2"N/ ܀``t8@܀ "]!) H D/T` ؀`@D` / \) "+!`aX`  +```#`    ` `*` (``" %aX + @"-!`܀``tb8@/ N,w`(! )'t8㿈 @dK!b `   "d"+!bd"+  @ +`& + `(`"d"`" pa(` 0 @ ?,  0pa(Ѐ` @@ `P  ?@ @00pa(Ѐ` X@k `P  ?@n @w00 `p@S G? @   +7 - ;   @@D`h*`O @ * :`@ J@-M ` - ` 6"" @@`hڪ` ?ނb@'(``@ @ `@ ! @)  ) @"  ;`@  "`@   А@   ) ؐ@  @  -@  c;`@  ( + @ : <-@@ c`@ c -? :-@a8-? @x@9? :-@w!?޴"'`@ϐ.@5!h?ަb&@p/?޺⤔@" p\7?5/a <,  @f (`1  @Ր@8aِ('`ؐ[/?ϐ#?, %@AX?, ?@@!?,  L` V* @C:`,@`L@  @? *  @@`!?- (`M` R (`     L  (`> ``7   K "+(`'%?Y%?S!xt #?T+?, L  * @;`,@`L@  @?4@L@L  (``@ϔ   @ : ,@ c@~ c ;? :,;?b@@b@9? :,[?ު"Ȓ'@4`@b5?@-@F @K@G B7? @@ ``/??2 '?/ 5@   @@5h??#M@ @r (`:`@ J@,L , ` 6"""M!@8  _b0@1  j"8@*  "@@#  H@  + +; :@ %?ހ @ ?' @*@  '`@-@ O@:@ @ @)?ޠ"@?*@@!$ D J  ?8$ D ?3$ Da -?*@@ (`'@ , ?, y()@z /?  %P`@z@!-@? ,  V(7@W !?"1 P`@W@`ِbP@  b!?ޖ"N  ' ??   !?N :` +@N`'?@/?ހ4?#?b aN `:,,@ N #@@ ?ޞ@+??- @?aؔ%`@d,00V @0d"X@  ])N    p ? (@ Nf+`< `:  (@ @?Y??ߠaM@ -@@ @(9!ɒM@`  (`` ˢ    L (`: ` ``  X0-+@F @ِ]"h@  ?% -`?`:@ %??ހb@ ' ,  ' *  L :@ @ @)?ސ"?ߦa +"J `'c7?O@p@t  +9?N "' `:   `;?ߔa`  J@`: @` ?ނ(@ ``N' @?ިb+ d/?ޡ=`@. :`]#`@4 "F( @@ s ")?@@{ ޒ0ܐ`' 1"`@4 7? (K "+("L'L    - 4-?L  +`=` `  -?->@@L`  (`@ Lbx@ה  "5#ax   !@@ `@y 􀤠@ڐ9?߶! 1 !`@  [%@  M;b@[ >b@  .5@  )"@  /⸐@  5@  !L!l@X@ ,!l@?ޠ?a`А@d 9"@] t+b@V dc@O  $?''` @` &'b` @^1?ޘ#" c@~@&  $5;?9b '` @` &'9` @5+?ޤb@b@А^@ =-t#(@ Nbh?޴#0%#|`ct?ޮX;b`#@2 (  *(`+0+`(&5?ހ +) (p?ް#) b` ?ޢ@ Jb`,-  d*b%d$` #?ުcm;?ߤ`p @`0#Xb '?ެ@?ߚ`x !`@Nܐd"@+  @ -'@/  d .  $"dϔ#@!? `!@;t@*@c/?@#  9 (-?ޤ @)  #h, V?! '?@7?߰@  c 2)?@ f 7?1#'L %@5? ;?ߠ@?a`@@ߐm@ e 7?ސ@ޒ g 7?'L/@`?@ R"`"R/?'x?ߚ` `@7?5?ޤ@\` ?c`L`N`  [ +`K!\? ☬%'t L.@` + 6`:  $`N  (` +``  8``(&`)& ,0 +``  ?*pB`"N@D@N2ʰ `"c% .@ޖܖ ̒ `@`5 #aX`2  +```# ☀    ` `*` (``$ $aX2 @ `"P ܀``"8@F `܀```"8`܀`"<@ &#@`܀`2``"8`+@`e"`܀ +' &)t+`H #/T @0`܀`: `"8@ D!`*!`* `"ł8@ܐ"8?cc@  l?a(`?d ?  $B3?`# @@1@~@@1N ! s!   @a $# $А j 0){#. t a u. . . . . . 3?`@0d @0`@3" (@~@ & ?ccؐ@j  ?a(`s )? '$`v+3?`# @v@1)@ @1!@Y@1@Q@@1@I@1 @A@1N  6 s `  @ "\1 `$5?   +`` $t-cp @(3b  0}А#.  t a u.`.`.`.`.`.`c;3?@#?.’ @ ?- $ ) ( %@/ '  @" 2 2 "'ÒА @/ @/͐ @2T (@@` $` t0p t$ p H  `  `@I  쀤 `$#t!cp ` !@/f  @/@2# (@@` $` ?c’`@k  ?a(`R€w ?@  $U?`@# @w@0*@@@0"@`@0@@0N $ sx     @ $ !"  0) . t a u,,,,,,]?@2@@. !֒Ё?c’`Ȑ@ ?)!(`]€ ?  $``3? @@/@@ @/@w@/N8 s`@. d!(  "? %’@U 6#’a@O B5x   ``@@ M`(b] . t a u,,,,,,#Ȕ3?!t@n"8?H "8'Д " 0)!t@\"H?3`H "H@2)    @D?`H 2ؐ@Ԑ?c’a@"  ?a(`R€ ?@  7$U)?@ @/@.@@ @.ڐ@@.ҒN - s’a@ 7’@ Dx   ` @ C`1)"!(. t a u,,,,,,)?!t@"8?1 H`"8'Д m 0!t@"H? H"H@G@?"1%H 2@9ߐ?c’aX@x  ?a(`p€ ?  $p)? # @@.7@@ @./L R b@@  @.#L `w c@4@ @@.L ` ? s,  t a u,,,,,, ’@Ր /3ax  ` @ F?`$'7−!h,  f u- - - - O)?1?%t(@ +?@ 2*@ 2*  -Д  0 @ ۔?c’a@ f?a(`B€^ ?@ ̒!$E%3?`@# @Ð@-v@T`@-nL` $ sax ` ` @4 $` = 0 N!,` t a u,,,,,,칔3?@$@ߒЁ?c’a@F f?a(`B€^ ?@ [!$E%3?`@# @R@-@`@,L` $ sax ` ` @ $` ̖ 0 ݐ!,` t a u,,,,,,H3?@Ð$@ߒЁ?c’b @Ք  z?a(`Y€r ?  $\?`# @@,@@r @,@j@,@@b@,|N`+ sx  `2`@ `@ɒ )@@ @%$@,Д D 0U"0. t a u.`.`.`.`.`.`?∁?c’b`@P  z?a(`Y€r ?  e$\?`# @\@,@@ @,@@+@@ݐ@+N`+ sx  `2`@ `@Ғ )@@ @%$@,Д ᅱ 0А"p. t a u.`.`.`.`.`.`;?∁?cb @ʠ >?#a(`#€6 ?  ߒ$`a( !#1     3 `"`&` 뀐"ۀa(@k bq1 ?chb @ /?a(¤Ȁ`"?#ؖ ` 3a$ @+=@!E  :??b@c @E ?/(`z€ ?  Z$`}'?〒@+ @+Ⱀ@@+ a+L ^cX3?c-@) "|(  l(`]'?)?#@Đ"@?, L@# c  @+@`L@ @@) @@ @L@ ?1? +@  (5< ꤐ#(cX顒3?xꙔ* #'?〔Ⱂ !˜ # ꇔ)?(`" ?#%{  2 `q Ð` @ 6?a(ä`(` # % !$@*A@`@' "  5ޔ?bÒ`8@A a?a(`OÀY ( X$I`@*#Ò`x3?@bpò@.@ (?@ #?@ӐN@ `; @ @ @ ,@ J @ ; @  ?bp@ , @2@ ?bp@   0ː H#A`?cÐ` @Ԡ }?#a(`]Àu ?  $`c@)a( W#1 쀤 ) T `E   " ,``,`2#`,֒  ,``,`2#`,`3 1``,@(d  @(@+ (@|`2` P @!n ?" $ ,chB1踔?cÐ`Ȕ @K ,?a(À` ؖ? `  [1!$# @) @   ??cÐa @ '?a(À`!? ` #1!$# ِ0?L0?cÒa@@  &?!Ð@ג!H U#a(`"À ?  !$`!H@ !?* @( 쀖 0aX葖܀1Ò!P@ g? *@( @ @'{ a(   @? %`@SϐaP@~ #Ò!@w #Ò@p #Ò@i #Ò!@b #Òa@[ #Ò@T ##Òa@M 2y#%Ò@F q?0硔!HÒa@8 $? *@( @L @' ka(   @>? @2%@`a3Òa@ +? *@' @# " @& "Ja(   @?@=֔2#Y `̒T Òa@ߐ 5? *@' @ " @& va(   @? @Ԑ1  眒 `2# `璒 3Òa@ ? *@' @@&| "Ha(   @?%"`Ò@ >@A, @'Z!?1, @&W pa( ` @D @&K [a( `"1?3?@"1? !  6 2# `, a@@ ?.@, @& va( `?@  ? @@' `s!Ò!@! 2*`@& "a(   @/1?%``"1?1? " !  쀣" 3`גڐ Òa@ "!a(* @%Ȓ a(   @? #b`N`" 汒 "?橐! ?" #`栒 ?cÐa @ 8?a(â`!&?@  & $ 3?@@&k@I @&cꪒ `?3?@?cÐb  @k ;?a(â`"()?@  ) {$ 5?@@&&@ @&   ?5??cÔ @%bP -??@ % =$Ò"`!!(À"p @S?1Ð"   0Y!!(۰ ?cÐb @ 6?a(`$À. ?  $21!Ò"@ː 3 &a5@Ò耢   "a 垐"ڀ"`!Á?cÐb @ ,?a(À`#? ` 1!$À"` @%f@Ր  d??cÐc8 @o 3?a(À`#H"?  ! 1!$À"`5?3b`@b   @0 %?5??cÐcx @0 3?a(À`#"?  ! @1!$À"`5?3b`@#   @\0 ?^5??cÐc @ M?a(`ÀE ?  $21!Ò#@Ӑ 3&`P/ 䯐#〦"`%!Ē`@  5&P Ē` @ ""  Đ@( ? "┰ ?cĐ`0 @ 6?a(`$Ā. ?  $21!Ē @z 3&`@5@r(  "`@ M 8ڀ"`Ô!ā?cĐ`h @V 4?a(`"Ā, ? @ k$21!Ē @8 2&@5@1(  &@ @  x܀"`ピ!ā?cĐ` @ ް?a(`yĀְ ? @ +'$@@ @#ؐ@@@#ВL @ * @ޑ;`.N`L` * @Б:, L  Ē@ ">'Ē @ "7'!Ē!@y JĒa@r Ē`@k "o)Ē!8@d "v1Ē(@] CĒ@V ]!#"b @v @E )%$HQ @;!8  ?1& HF "`ה0x@+ 53 &a7 @! Ē # $a, !@@ =!Ē!H@ ĒaP@  Ē @ "@ % P  !8@ DĤ '$  & P `@ e5Ē@ߐ )% L @9?dĒ@ΐ   `x,  -@e@" а L`̒ @%z@Tð x@ ")5Ē@ "1ap@ ' $@" E`8  @@@ܔ > #$$b @@& 0a@}  #Ē`@v L!&@ 2Đaᗒ8@d zĦ # @o @Ya Ē @S $$` Ē!@I )'| a8@A 1 & LL '?Ēb"0E@08 2'? $$< !8@& Ĥ &@2 @ O @ )G " @  5? (@ 17 "0@ 3/ b8@ 2' ?c? R@@`@"@0?cĐb@ @ 0?a(Ā`"P$ !$05? ` @@!Ґ@  …G?c@9N@`<2?N` @ ?   T*@ K``> ` M  J+ + *  -@"ܐ`" 2 @!`X,`  `@ Ѐ "'R `)8#+w(`a\@1 "@ a(`O/g !$C: `"] V`  O  F  =  4 ؐ# + ϐĔ " Ɛ|    L  Ȕ  @u  @   -’@ %( 2d5€?װ ’@  t%(Y;€ǰ '?㸢`a$+?!#3+?c@ @@ @  G@k  =@ x  3@ n  )@  { F r @ d h  @  ^  U % L  C ;Ò`Ȑ@Y '( )À1 -?ߪ` n#a$1#ߝ@ @ Òa@1  (`À  !?#`F$cv`  O   ܰ Ô bP@ wϰ )?#` #a$ 1+Ðb`<1!(5Ðp߸@ ?2 /Ðޱ Òb@Ĕ Ia(2QÀ ?מ` ْ!$"3%Ð`3Òb@  a!@"耢  ; 'ax #Òb@  1!(]Àh ? `쥒5$/Ð`Ԕ@Q@P q I Ē 0@_  (%%Ā7 !?#`ta$`"3'Ð`ޣ3Ē` @< )% @+Đ@4`( @ #$`@ 'Ò8@+ #a( +À ?ϰc` @-$"?5Ð`o?b`@   @V0Ò#x@  (%À԰ ?Ǻ#`a$ +?'Ð`@+?c)"`@  @*0#Ē`h@͔ 2S1!(LĀ ?# ` /$`Ð`Ē @ 2&%Đ@(  &  |  vbo ؒh4!aU`xZcHSMLc` 뇒7$"(cݶ(` 2   @  % !  $$ #! 0ݛ08ـc .Pڈ@|֬πլՈX4ӜxP(ҰѸѐlH$иДpL(|?a؝)!(`'H? /p` ??H @>  +`܀`+-?Ha`"&3Ē`@͔! 2a` @`  2a`< 0@ 2a @`L 2a`!( ]&``:p3Ēb@z '`ܒ!@`(?H 0`@`(&`&@0 &`@Đ` !@``&a%`@ `@@`+!(`2` d(`2@@Vp!(%p-?Ġ `@J  Ē"@  @@U @)@ / 2*L ? /,,bВh!(e%h? 1#!(`I``@  ``@$ !(@ @`&`*`,@8` `!(,`H/ 2) ``"!() % #`p?%h%p&` "``!(`"߀`"pҔ؀`H```  H!(Ĕpܿ"pܺ?Đ"۶!! 6tĒ@! c!t#`H  +`T] [r?+#hܓc@?Ġ `@ 2B (`+; }``̐b8@'Ē` @\@n`'  Ēg#h0 -Đd!! tĒc@c! "tH T`  !?`"8b8@0@08#Đc6``?c(#a(`'H? #'  - a(" 3bH       $ a( +`.@;` & ` a(0,`e3 `2 `2 H( a(Ē@  MĒc@  "$a(" Ő a("  a( ̀`bp`3 0'Œ @Ԕ   a($%a(`" ِ02a( Ha(  Œ`ۙ Xp ?cHŐ` @ ?+a(`ŀ 1?; 5?#`$'` 趒?#$`"!?#@a@T ( 2*#`@Z   "  1@J  쀦 @~`" `,2? @' ( c@J @ )?㬘 @ "* P!?#- 0 " @a(5 :a(`zŐ@ @ڐ@`@ ݔ@ƒ "ִ@n , Д*  " @_a(" `֔ a( "+ #@``@@~(@ڐ2?㬢@. 7@' , !?"`#'`% ; / $'`%( ڏ  ڊ!(7!?@CӠ+a( "1u!H`r`zc@ݐ? x`*. Š@ hK  @>!(ŀ`a$!ŀ  !  0 ?ٷbt`1`#p `? a 8 $"0" `? a 8 "@a( Œ 8   t11Ł!Н8% 䀠`7l +` )! `` $+`1"l *?"@  *%tp#Œaؐ 7@$b   ? `b"#aЂ @ x" Š"# `@ x  m&Š`@ r `L `  `@ } J` @䢒 @C1tb0@o#p% k ? "`Š`#᠐@\`8!(2H1`!1Ŕ 8!@N(+%Ő  #Fa  x@ Œ"h@9<$Nz t#pŒpk 'a(` a(  4 8Ր/w * ~ !%`8Ɛ(`  } #p ?c!?) % b@9L` * @:,@`L@  @? Œ⠐@  %`P Œb@  \?Œ"@  T!Œ"@  M @2 F ?@bl ?+``` "# $`5  @m't1Ŕcp#@ ?% ?Œ!!@ 8a( %Őؕ 8  ?"В׌t?cŐcH @ F?#a(`)ŀ> 1?@ 宒$ -3ha( !5 Lx @,.`   I#XՀ l"   #Őc=ސc׳0с?cPŒc@H  ?1!(`nŐf? ` Z$`i%?@@ ( 2*) @+ Za$$$ @ ( "9  +Ų)-Œc@I#耤`'@ .@&@ @@&!(`&c@$#耤`ݐ   0&ײ#@$ ##%? (@@| @@$$  @㿈a(`<`' # $$`@  ",R $2( `"$ '' `@$ $& 7 ` 23 @`$3 `$`$ $ % ! 0L  ?ca(`?`) ' % $@6  . R $2+ `"'?   & $ % @{ `@ # ` $% $Ԕ 0  8ʔ #  㿐a(`# % $$` &  ``"$  $$֐ h#  ?bƒ`@  z?'(`2?ƀ7? `$`V7?@ 2〠 @@@ $,3ƒ`@m ?7ƒ@f 25Ɛ0<W8 ր }0,( 2$#3 ! $ &` & ; `􀤠"$ 1  2 $ $`#ה7?0`hQ3 ?ca(`'D'H'L'P+?`.? 'L $% # `$$`"@  +?`D H@ f?/(219!$?@L@ " 4 +#?a`%7 (Ḣ`U@ @: ,  *  @ `O(P@  Ζ Uܢ` p9P '!tL@H7  2z +?; `'` D H@\  ?  )"#`n%!t#at LCP@: ,  +` @ `($ Ɛ!(@՘ @  | 4 ?@h ;-@@+?`@b@ae? x[9ƒq!@0+?= 0\-?/Ʀ  M`9P '!t.L@HH7  +? ?3  )&a"#`%!t? @─/t%Ɛp?/t-Ɛp@ '  | `#9Œ!@`87( 3+a$`)Ő!ԙ`8  b#a`8+ ?cƒa@#  ?+a(`ƀ?# `6$`a(`)Ő"@OЀ  Г* @:`, L  )!1 %"t& a@ ƒ!@ X@7??\p    @K V@b!"`2})tc#p@ `?`v& g 7?p? \@$ @L- x @W,  o  o Fj o!r@>b ?cT 2 -  @ @"t #at%"t`x @,  .  . 'Ɛ4MАӪ0@"В+Œ!@  8a( 2 +Ő  ~a 8) "l$ ?cƒb @  ?a(`cƀ[?@ `2$o@@ b#%x  ` ` @ "@`$'!?x@ ` `  `)ƒ"@ A3Ɛ@ #$7?@+ҭb# !` T$`$ Tq $ T$`- j( ӓ"0'# !` T$`$ TU $ T$`ܐbXҁ%bv?cƒb@  G?a(`0ƀ(? `$(#@I%Ɛ@5 $'1 !  T & $ T $ T@4&   ,"΀cҢג#1 ?b'Lc8 @/  ƒc@@&  -?*  +a( ƀòa@@`  ,@ %?@-L/$  <@ܒa(̶ ƒcp@ 'Ɛ@x |xƒ#@ #Ɛ@c Вcƒ@ #Ɛ@c ƒc@ " @@@@@}`@#?'ƨc`@ȔcX㨔@Ð@@ &`  "  2  ?"%a( nĒc@ "  + %` Ð @~@ 2 .L HLWZx@& " @H@&@@@@@8@   @ #Ɛ@c 3ƒc@ " a(`#@a( ǐ ! @  xa( a(` ǔǐ` xLtr c@Ő " @@Ő`@ߐ@@ @א@@ @  J `?L  %?@ 7  a(`2U   $ a( +`;,@ &` a( ,?)`@? -ƒ@@  # `?ÔL "a(Ē@  Ē@ &2$`!()ǀ 0m`a(`"Hdb]a( "`;bpT`Œ` @i  !(' $$` !( "a(А Pǒ`x@T  1"wa( rLqa('Ф "E <,@@@@@a(`8 ǐ` 3Ɛ`2  $"1t ` 2 L̖   )Œ @ "  - 5 %m&@ #ǐ@` 'ƒ`@ " @@ @ @ Φ   "ǒ`@~ %ǒ@x )ǒ @r 3@ǐ   " #`Ѝ `ϊc@W #ǐ@Q` ǐ@K` " `@ @> #ǐ@8` ǒ`@2 " @T@, ͦ  @# #ǐ@a ǒa@ " @9!?#x@ @   < @ @  @ #ǐ@a ?a@ " @%?x@@   )<@ @ @@@ސ@@@֐`@@> @T @P a(`"3 ޒ- 㼈' `221%( kǢ@(pǐ@?p ~?1<  w?(`i!ǒ  Ә!h2!h(`$ %ǐpϥ1!`^ @@ / r / x . e o** * * * * * * * %(5ǐ@耢 ><  8(0!ǒ  Z!!(`)&!1ǐ!g0#caǢ@F("ǐ!(UP!(ːK!H!ǐ!HF!ǁ㼨@`!x@`@R g@%`!@!!@B` !@!@7 @J   ' + - * L` (`;`@aؘ/*@̠ 4 L` !!(`27'ǐ@_  1< ) @/!(```@ . 0ǒa@`!``Đ!0@̦@@`(@ @`(&`@0(ήɐ`"`!ǐ!HΥ`@;a(`@a ǒ@@ :   9+ǒb!,@n!ǒ" @m "/) +  '/-a@-!@E -! d@X 8!aК@ZM!  !a(@ǐ` 8 ǐ"h!, 2 @E# ǒp@+a9ǒa  %"x /@ "%1ǐ"`  MaЀSa!ǒ"$!@`?#/!$a a( ;-&`   , @ ` ` J@ ", F@ , @ `#ah@ `젒 %! $ `#@ a ! #!! q%0U!bԐ"@a ;ǐ@ X#%@ T'ǖ)ǔ#0@ 9+ǒb!,@!ǒ" @ 1) /ǒ(@| 1) !@{ M!+  B!ǐc`̙a(>ǐbH͐09baa͉!q-&̇0P@\ :- 8 0***c8u) c(?c# .?@'/-+ǒ@ S@.`Ґ JH@c$@ <@@ 6!Ѹ P N#?/-+)Ȓ@ !?@ Ѡ J`*@a$ @`@ 0!~@ƒ@o@Ȑ$؀n@j@[h@ڠ?(`9|?t'#x cl Ȧ  !@25% ;#@ N`#/`@@ې  A@ @@,@`@ǐ?@ȔbpJ#x#x#x`$'#xa Ȯ!h  1!Ȓ!0J@ -Ț @`/Ȑ  $@,  ? Q?-`   `/`3tcl &clȘp%Ȕ0  "W ??UK``1J  @ |c >c>  d #x`0?#|$cx 82l?? @ ?А  Ȧ! - &  %=MU ؀`1> Ȥa0L /Ȭ਒J0 Ȱ 2?`@@0 48 # b0! $""4# bJ`  "#"J`  bL ! %!%#x`Da'#xF  @ c#x|?'#xc >c> f` -  %@6 ""M 0;b$b! `$"b@%J@ "bK@ .y $b#Ȑb@Ŕ 8|:。!% 8`"a?????^% 8 2z??@ QC # b8 2??@ Gc  82??@3@? b8`2??@16?,? b8`"M ??(% 8 2s??@2? "8`2M??  @ 3 b8 9 ??" ` T JN%`#" `$"b@J@ "b$b-Ȓ@A# b8 |c;;{! ޘ` ? #@????@y?p????@p ??@i #@''@c?T????@T ??@M@#@'???@A ??@:Ҡ? ??#@??Ȑ@1? ????#@@#? #@????Ȑ@} #@@k@M "M"` $"b@J@ 2"b$b#ȐȒb??@|;cʂ!0bMxb@M bb $b!  $"b@J@ 2"b-$b3 7 ?? >> $$(('H't'''(L(t$(㿀   #4#"0@ .@  ,"8  " b@`&@??@&㿐a(`a` a @ `,` 2Ȑ0 ڐ"€ %(Ƞ `##Ȓb@ !?@ @ @(83  @ 2 *0ɢɞ0#a(`:Ȑ@eb >?@  @@ a(- - @X (?N@   "@(`;N@ ` @ +`< @ 2 .@  N@ `@   Y#XȐ8S0с!!(Ȣ `#x-Ȓb@ +?@ 6@ 3@!(ͳ  @@Ȓ#@   00 @ 6*@ ?Ђ`` ( *@ `2*@ J`-2 ?*@ `@ & *@  㿐@ѐ   N Ѐ`.`` (   2 N-2 ? &   ?@ d?N `-`?N  -\X  ?В ` ( * `2* N-N?* ``& *  h ?Р ` (* `"3J* ``& *  x ?Ж (,@ `"&J,@ ``& ,@ @Ð ? ?@, #aؔ@  ?2@ ` `-"* ?`-",@ ?㿐@D @6  Ђ `` ( ```N-2?@&  `@@   Ȕlc@*@ @ @.㿐'   <@  >  #!, ` 8#!b<<2` ?$+`<$b<@c b<*@3 b<*`$b<*@@' <$@ !%!<+`@X $ <* @ @<(``@|@`@x$b<Ȑ<'<㿐#Ȓc@Ȓc  , | ?, @  ,? & ,?㿐a(`[ɒ` @~ Qɒ(@x ?ɒ0@r Tɒ 8@l Vɒ@@f Cɒ`H@_ <ɒ`P@X "5ɒ X@Q ɒ``@J  ɒh@C 4ɐ@=: &0`{  v?8o@?P @ 2 ` h8X` Đ S p@  ɐ@׀ x@ ɐ@:` @  ɒ`@  ɐ@?@0`% `@ߐ " ɒ @ؐ  ɐ@Ғ82  @ː @ƒ` 1ɐ 㿐a(`;ɒ`@@  ɒH@ ɀm k?P@ ɒ X@ "ɒ`@ ɒ`h@ ɒ`p@ ɲE@?ƥ < :? x@p ɒ`@i  ɒ@b  ɀ# !? ` @T  ɒ @M ɀ  ?@B 1ɐ i㿀a(`?'B'ɒ`@@- 4ɒH@& -ɒP@ &ɒ X@ 0ɒ`@ )1ɒ h@  "3ɒ`p@ 2"7De c? \ ɒ!;M K?x@ݐ  9L? =? @ϐ  ɒ`@Ȑ  -* (?`@  ɒ @  ) ?`@  X ?ɐ(Œ@%!;!/!-!+!)!'!$\%"X%bT%P%L'bH$@@*`X#!8`?`1 9(` ɒaH@    ɒaP@  #  $bD jЖ   +/?!X@`;(. ?$@' . ` $\bD@@*` @". $bD $bDɒa`@o    ɒah@g  $  $bD qА 8  /?+!X@d`;(. ?$@' . ` %"Xɒp @ @Z@. . .  .  .  glN6ɒax@     ɒ@  #  $bD qО   (+!X@`(. ?$@' . `  k%bTɒp @~ ɒ@~   ɒᐐ@~ڔ   ɒ!@~Ҕ    ɒ᠐@~ʔ  $  $bD bВ `   **?aX@~Ȕ (.  ?$@'. `  %Pɒ!p @~g 9ɒ!@~    ɒa@~  $  $bD +Ж   +ظɒaX/?ؐ@~ (.  ?$@'. ` %Lɒap @~( ɒp @~  ɒ@~ɒa@~F   ɒȐ@~>   ɒ!А@~6    ɒؐ@~.  (!ɘ $bD Ђ ``   *К+ɐaX@~,6`= 'bH @}!@~   ɒ@}   ɒ!@}    ɒ@}  !ɘ $bD nЂ ``   *њ+є?W$@@. F$bD"@}Ɣ   ɒ@}   ɒ"@}    ɒ@}  2@ $bD Ђ ``   *Қ+Ҡ €`Y  `y `A`ay  $bDЖ  /à a+Ӡ mà i@?>>>>>>>>>>>>>>>>>>>>>>??>?>?>>>>>?>???>>>>>>>>>>?ܝ㿐!bH6!bL6@!bP63!bT61!"X7!b\7@㿈'D@}D/ / / / / gl74 ` ,8'''''''@}&@}z 쀣@q&㿈 &  @ C@`2   @ ?+`:8+ `?''耢 "8 `*; *`    J&^$#""$` `"N `"I`T`":. d ``2  ` `+`< `#T ''耢 "%`(`;``.`?C @  J$/$"# +(`/ ?+ + . & % .` * . "#. (`2. *  , . # ` `"$@&@"㿈"@@ @ & @ _'耤 $ڐ ``' '耢 "`* ?; .` Ð ?J`2&"# *``?+ `2 ```2\&&?`"V&N`` c @`2&@ &` .`&N``  '耢 #@`, ;  .`?o? l  J`"%&`":&# ` `"&##J `"%`1`"* K?I??+ ** "# ?* @ ^+ ```2+  , * "# *(`!?2* *  . * #@ @"& # $&"#+(`㿈`   € " @耢' '    耣 'ha(` '@ /  `" @ % `€ "@ @`' `'Ԓ  @`'`'̒ȁh!!(`ɀ`' 6? € `",?( ɐb "8!( @`' 'Ԓi6 ? ' '̒ȁh!!(`` `'@ &`&@.`9 ` h"P!(` `'`b @ `€ @ ?0 @@`'`'Ԓ 6&`@ '`'̒〢 J` # +`8` +` J ` +` "*@ *@ J ` " *@  J ` *@    +` 㿐N` J/`>` /` N/`>`^ >:`{`'" C`[`"   /`.` .>`+@N N`>` @`?`?+@ O`\2>`. Ѵ }`{`~``2˴ ɵ>2Ǵ ŵ>2ô  ]㿐CN`"@NN ` .8`(`8`@`N`/`  `+@N  (`8`/`8`@  N`N ``+@N`v tN` /`>` /` N/`>`^ >0/`>`^ >0`{`'>M`[`"2  /`.` .>`+@N  N`>` @`?`?+@* (ڴ }`{`~``2Դ ҵ>O`\2>`. /` | N`dr2 >2  ]㿐@y  !@x&  ! &@y(ɀ`hR ɐ" Đb@x 㿐%(`J`X!(a7`@T @!  2T @x \!@x@$$@!T @ @@ (`B4 T @ '   "@ /4 @xÒ =@x 4@x `&6 $`0 ɐbi( "`Ȓ_R`"aɐ"Va*ɐcN:Δ*ɐc8;`F(!C" 㿐a(` 2#X 20@xN$ 2   @xC$   2@x=0?㿐a(`  #p @`20`  " $ @x$   2$ ?㿈!bx   @ @w 1 2& aЀ )!(2!+2?@@ΐ!p#\!`!h!#`"l!bd& @ ڐ $@w$@c??0 %(` ?@!#?㿐%(`:c#& c$`@x ; ", *`, "@* @!+b@Ԓ &`+"(`@+ @l`%|` $t+`" . @ ?*`!Ȁ   $@&!< ^#@$@( `` ,?+`& *` ?,`aȀ  $$a?+` @ + *@5%6`@f (?ʐ(?㿐)!(`2;!bx  -ʪ "  !( `$@ ѐ  !2 aȀ $a&@*$a&$!(!&!$  #b`# H!`x㿐ʐ@v`` a(` _̐!!  $"d@v@v $"d@v1!` &"h@v@vؐ &"h@v3! &bl@v@v͐ &bl@v5!3&&`@v&`"d!`"p @v @  `(@&`@v : "1*@vƐ &`1 !&$ ?  *  @5!+ @x.`aȀ   $&a   @ 㿐+a(` %&  j!! ?ʐ ВU %&'!| @v Р  ?`$@*#@ +  !"x*`@@Ȣ  &*`" (` ,@! '0  ?` % *# +` * @a.`&.`@"$ @u$  G $ @@vH ` ߠ  #&"|` @u baР  ?`n$``  +`&@ .  )!"x-`aȀ L $$a 2}?a(`Eא%& g$@v? ; , *, &- ,`!∐@@ @*#@ +  * @ @ ݐ@$Ȁ P a("L?-`&@,. @#a>?I@$0a(".?9x!0(?a(`"$?#oaP?a( "?.'@/ .`@\@%]p ?? ?a(ʐ!P㿐& +`# +  !*b` @9ʐ@u"a bʒa  @*1@u!0@us 㿈@d!@tbʀ `b@ZH@tX U!@R"@uC'(G'쀢  : t"( ` 4+ c +)@ @3  &@t = "*(`"$ t쀢,` 2 &"(@,($ `ِb0դ&$ ߀#bʂ"|#cp?㿐@#(@tc8@ 㿐@#`ʠ@twcpʀ cx @to` 㻘-(`#@ttc (( %t(0)ʤ /!*/@B@tT(ݺ @tnʒc@tS#@tS@te'!@' 2u/`( yʒc@tm  J "   +@`K "  -@@t@t] /`&@t/( \ʒc@tL "bJ  `"   *@`K "  (+@@t /  @t @t \  @t/( O0`!@ʔ O`!@!@" `!@ (/`(' `& ސ#ʐcؒʒc@s 2J !( ʐ @t  !@ O2 @t8 @t   #( ``)˒ c!@a`7ː0 ˪0 @st)ʐ@ss#!t@s !"(@s ` @sɔ  l 0@sOc (ڲ-ː@_ ː PY<ː`hSO0`"L@sK˘x@s.@s @s` $ @s3)ː@s& !@ O2 @s@s6@sn  @s @sx   @s s c@@s#ˠ`|#p#?@s@sG  @st ;@s $   @s@  @sb 8+㿐@r  `  @@r  , @2@ +@# $@@ #`$@  @"` 㿐@ @r` 5@rȢ 6 L@`', c &@S,@rw&`L@@ @/@ @``&@r = * &`L`2 &,"&- ˂|#cp'?@rW %L`  (`= &L` @rz& @r| ,& & &㿐N`  .`8`L@`@2 @rZ @r\.?ς`8.`?0`cO>`  @rΐ,* & L")? &`$ @r,* &L2 )?Ϟ@ +@r@@rA'%0L)?Ϥ@ +@r@@r-'%0@qP J ?߀`@ɚ?J +` ߛ;`@ @?ɘ@?Б(`: 㿐N`  *N "/`>`%.  O ߀`@ɺN/`?` ߲ @ɂж.N .㿐N`  #%ː `` ` А@  `.@`N  .@` @X@qT `.@J`  0J ` (`8``+2` * `J ` 㿐@q(?? .`8`L??2L?㿐 N`? `? 2.@". @qϐ* : ` .@q.N`? `? 逦@. 4  J`  *`8`+`8`@  K` ?㿐@pѐN` 1˖` `+ ` *8`;`@ ?  @ (``;`N ` 0"    . ?   \. N ` 㿐@pˀ ax㿐  @p̐ 㿀@p '@`*`?`!@p  $ " "" `\5* `@ n`[  `^`y   `-D v@p  $ "" " * ` ۰ @6٢` ]2 ?  `* `\ɀ`!`\ŀ`[`\`]`\2*  `^`\2*  `-`\2*  `\2* * ` A@pK  M$ "" " *  * ` @p;  =$"" " @p1  3$ $ $$@p&  ($ `   @p  $"" " * @p   $"" " *  * ` {   &$ @o 㿐/H P? `L(`#p@ H B  0>=?H`9   04 H 0? `,  ֒ 0'H @t   H@n    H0H @b  H @\   ? `  H~t~|~T~~㿐 D @oL `%9?@ 4? ",  `&@`$   @?@    @ @? 㿐&a` #a1@o"  &`"  *  &@ @ @ &@   '`@oK @o  @o @o 5th@o'd`d `-&h(p @o    h6 (  +@ "'h@ow'l 'd?cd@oo`  ?d`t "#h?㿐 ? @ '2  @ S'$ "" 2! '!8   ` *` & '&   @?0$ "`@ ? "( ""? "  *  "    (@(@*  @"   (* 㿐&<& ?05 &(,  &(.( .((@B &.( 㿐 ? @s*  '& "x? !d ". '& 5"& &!$??>!H@ @ ˴" `@m@  / @ {@B*  '֖@m@   '$ "x @?0 /  2  &!`? ?p 'ؐ'ː"''''@؀ Դ  #J@ -2}J` -2y @ =J@  `*@bL @1 ?` 8f#ܓ*`  (PXPD`"Q@mL& `"J@  @( B& @. `">@  @ 6& 4. `"2@mh-&`"+@  @  #& `"!@  @  & `"@  @  & `" @  $@  & $  &  2@7ԁ㿐@. R ` G/ : .:   @.& @)$   *`  * &  &  ` @* @&    &   & `"&@&&'    `@`@ O㿈 (y @  0 ' @" &   >& ' `  B@>  *`@@ $ '@K@ '%"@G % @. # `?2""@l,@ @쀦`'*% `@ -`" 2  " @  @ ֐  '  `%㿐Jb 0 @ {*b @ !" 2!,$"ː#@lc " $"@k#( "!@l0$"!" 2  ː#8$"@kӐ#H 2$" @l] p\!'X``! ``!˒#X 5!@ ~!@ |!&!&!`"!N@ !"!N ! ! @k#` "!O X!X !'X"!&"! .!?& ` @khcp G " >˲#p  ""`(  @l7 2 & '& t#h@kZ  '?c @l% @l$ n7@!Y n i'& th @k8  X"'X`˲#pb` ,@k# @k 2 $'$t#h @k  '?c @kޘ h@kޒ  7h@kݐ?''l@kِ 2  '$th  @kPlXh @k7j  '$thbl@j۔Q @ 2J  &!8:"B  &!8?   '$"|!8@j2 @E  x   *@ +  @ *@ &!@ @#?$@ * @&!4˴" ˶" @j @j @j @j|  @jw  #\!#`#d!;h!#p#x ! ! $ #t@[! 2 ! '$"@ @! @!@!@ "&!!@!@`X !&!,&!0 /5/bX bX/2 /2  /N . @k  @qb(0&@k @j@k "@j"0 2@j "8 2 @j"@ 2˒"H @{@ x!8 @–`? !4   @8@  &!( @($ 2V @ 2Q C?K  , @# 2A !`X!@..! 27 @ "M.!`< "`!d 2``!H  㿐 M ?,!h !l@ !l!l@&!h&!<&!d   &  ?@i @i ?& @!h "@@&!h&!<@ ! @ !(@ !@ !@ !@ !@ !@ !@ !&!(&! !@i 0N! @ 㿈   2V?3"P?!h !l@!l!l@f&!h&!< X'젒 ?>!H >!P :1 G )'&!$@( " ?b>!X   !l!4 3   &!h &!d&!< ??Âc?Ē@˲ @ @ [  '& "@ _? @  '& thch@hI @” ǐ@ @y0B"`<@ ؖ @x & 4@w @  0*@  ˒b @e '@S  '& "t#h@h 0`  & thcp@h @z @?㿐!h B !d`" $!d'$ "@5 6 !< 0* @ H 2 . @'$ "@% &  H& 8!h!<J & >@ @d 46$h`  ``  2O O O  /   @dT   h 2?`` ?  `?K.  2%h 2A !   @<?  &  * *`@    耢 !"X H@co .   p@m  2& .  & & &  "  ? !@   O   @c 㿈!"\@  & 0 "\X@8"X&  & && . .  & & & & . .!. & &!&  '  @c̘     '  @c  㿐@ & 㿐   @c  @c 耢 4  2  @c  & & 㿐  @  "  & 㿈/6/N 6`/  &  /@P  2 @I㿈/2 /N 2 `/  &  //@0    @' 2   @ \"  &   㿈 !? & * * 㿐  "@ @b  2 @  & 耦$  @b  $ h".N  #5 "qN  " `? @bc,` @,N 쀢 # @'А 'Դ #5 N@`"qN  " `? @b<,` @,N 쀢 # @'Ȗ . 'c#'?@b̐ '2 c#'? @b '@b'N@ -`ܑ* @b ' @b !'`'#؉F腡 #F?@b#聠F@'.N@  ײ`. 2..ܑ* @b ' @by !'`'#؉B腡 #D?@bj@'   - 2 .` #5 N@"q`@, :  "` "` `? @a,` @,`N@ @# @'Ж . 'c '?@b# '2 c '? @b '@b'ܠN -ܑ* @b ' @a !'`' F腡  F?@a F@'`,L@ נ .  'N4 ܑ* @aѐ ' @aː !'`' B腡  D?@a@'N   *` * @Ӡ N  㿐c(& @a> & @a& 㿈  *` @a&@ !@a'쉠`& 0B  㿈 #5 N@"q`@, :  "` "` `? @`,` @,`N@ @ @ ' '@`Tcȁ" `&"J@"  @Є `(8 Є(8Ʌ8*"J@ 㿐c8& @a> &2 & 㿐 #5 N@"q`@, :  "` "` `? @`K,` @,`N@ @# @& & ` ȝ t"H""  !|#c@_ِ @D   t"H@J @`ǒ E) ##cp* ,  @`;, '-#* ,  ?@`), '-#\#`##d#h#l#p#t#x#|#?@_#㿐J  !" *@_r#` $"@ $"@_h#h @_!"b㿐 " @_ ` t#h`""#`"#\`  $@`@_ @`㿐 @_p㿐` @_c  t#h""#`"#\  $@`" @^ @_ @_n㿐@^  @_4 ` t#h`""#`"#\`  $@`" @^ @_ @_?㿐  @r@_˒ 2 t#h""Đ  $@㿐@_  ~%bȕ. "    "b "b@ "bt#h""Ā Ē $@Z㿐@_o `3tch ""@ ch@F $ ~"ȱ.  ` )"&`㿐!t$#h@_L#h3&bĀ?@  ?@ b@ $??2 h h'L'P'T'XL@^#耢  # 2##@^c#@^W, @* @@^L@؀ U @ `%`I.L@`% @A?  2 ``."``-2L@` @ @ 2`*`:  ."` -"`L@ s d`@]ΐ!@  u2 %` d ?@"! %`? %.L@  @.\؟x'P'T'Xؐ@]P\㿐c\ ~  8 ȑ* "ΐ @㽐@@^ : `"@ !@][&@@ @^a N@ /  @]E @@W R!"   @]3"@ J /"`@b@^4  N / ~. @p-`@b@^  L / ~/@X@ @\N @H0 .. /. . 㽀@] :  $ @S@ //Β`P@*"@,*  `"L /",L /2@$\$@]ǔ 2V$"@?L ~ .L? /2L"`r@J /L .L? /"@ Y@ےJ / L /"L ?:LL  ~@]{ 2<@`@ /4,$ $@]i逢 $' $L? /$?  L? . L? / ? (@L?`~2 @L? /2@// @ ,*  c`@|$㽀@e@\  L : / /,`,$O耢`~&'@\䤒 `"@@[" @"J? /"?@ :@\@@k@\@㿐@`!"㽐@j@@[ǐ!@@㽐2@@G@[㿐J@ / "@[ / 2 @@1 @,@@\,@@\ 2&  㿐t"8@[v @\ "  @[ΐ X@[ @[ @\@[] 㿐@\ : " J  J@ /" `J@  /" !@В@㿐@[ : "? J  J@ /" `J@  /?"㿐@@ J / : /*@*`㿐@ S` @ .L"  K@K@ 2KJ  K  J J "J "=  2   .  ۀ  L # @pJ? # @[*?  @@  " L   ?0 ``,`@@ `㿐`.@@@:   *`ΐ `㿐@Z     ?  8  2  2  * ` *   2  "  ## ?# $  "# "  $#$ @Z" " " " " 㿐 `  @ @8   2  2  *  ` * ͒  2 @ "  ## ?# $@  "# "  $@#$㿐   "   " & && 㿐   ?  8  2  2  * ` * o  2  "  ## ?# $  "# "  $#$ @Z 1 @  @c  c@Y .   "@J h@D@Ym@Yj!` @58!@  @Zf@@Ĕ@   @Zbh |< (  @ZY @J" H ` "HHHJ   H "H䀠 " p'H'L'P'T'XH    ? H  "  ?@P  -  @Xɒ` 2$*`` ה &    *@"  &@Y&0À   @E` "' @X = 'ΐ '@  'Ȳ`@ `'Ȳؐ @ *  tA    `Δ @ȑ*  }t#Ѐ`#!ΐؒ@ @vȑ*  i`@ @ *`` [ & ܐ @X*`?& &  @X*`Ȁ 2 ?&  &*  `@X*@ *`$ ܔ  &@X&@.؀#@W  6!.  @W!  &@W @WԐ t"H@Xa(@W͐ p'D'H'X @W@Wې!!(@)N ~@Wʒa@@_@# @Δ   @   3κ  \!@W ب    `  2N #" ;" " [  @W ] t  `  2.XX  4  Ĭ@Ww = @   `  2 2 H&   '@aؒ@ʔD@Œԑ*  !  `   2 @Ő ?   H` ? ? 2?H&$@ؒ` l'D@ԑ*  e@eaؒ@ =.H?O \2> "; ?* : `0!*` ጚ . .  .  ..... .@%  t"Ha"HΒaH@Vؖ@  xؐ?@W 㿐 #@W ( "& & & & @Vڒ1  & &  㿐  2  @ 2    @V  `&  @VӒ 㿐  2   @V P 2   & &   @V & 㿐  ?  @V& 㿐 *,  *  @WK @Vv  @VrN P 2& &   @Vc&@V\ @V&  @VS@Vi 㿐 *  @VӐ0 @V? @VT㿐 && & 㿐 @V& & " @V @Vؒ㿐   `   @V &&  @*`( ?####Ѐ` @*`( `?*# *`( ?2 @ *`( ?2 @*J ? J@J`*8  J@ @ H ?`  $ "0   -.@` ? "%/@V2 @VP/ @Uv @U. 2,@*  `H ?`  $ "0   -.@` ? "%/@U @V/ @U8 @Uk. 2,@*  `H $ "   -.@`  "(/& /@U @ @U/ @T @ @U2, 2? .@ *  `*`:`J  ?㿐@' @ @U@T ? @*㿐Jb b@T`     $th7"?J / /*@*`"!а 㿐L  /L  ΰ!@TŐ  t#h`""Đ  $0@ "!J /"@ /.@ .@*"㿐N ~ /N  /2 N"   /@T :@  㿈@@S  t ~(  ȓ*` "@ b "b  *  " @; "b#h""Ā Ē $ 㿈@K@Tݒ  t#h""Đ  $0"ȓ. @   ""⼐ "㿐@S  ~`3tch "" ch` $ ~"ȕ,  `  "`E b?"b`` r`  w` r a w*  +* *㿐@/Sl  ?  b     =  b   S @ & F` @  & & `@ & :`  @T8   € ' G` €  ' ' ` ' : @ & F` @  & & `@ & :`x ?q #@? ?#   2 @  @2 "@  T R . 3 + 6 . 4  ,   @ "B ` @  ""€ `@ ":` ;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82       b 㿈@/R  ?  b     b    U   &F`  &&`&: 8 @S?    'G`  ''`':   &F`  &&`&:  ? }#@? ?#   2 @  @ "@ @ @fZ. 0 @( 6 . 6@ @.@   "B `  ""€ `":  8  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@b@ f. 6@ @6  ?  b ?㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@Q~@Qz㿐/P。` @?㿐㿠㿠. WebX v.7.9 (c) Dimitri KRAVTCHUK (dim) 1995-2010X_PAGE==> WebX: started...Unknown http method-V-X_PAGE ==> X_values(); ==> X_action(); ==> EXIT; Content-Type: text/html X_HOME%s/x.envrTMP_DIR/tmp/WebX%s/x.config/etc/WebX/opt/WebX/apps/WebX.TMP_DIR=%sX_exit( %d );%s/X.%dX_exit: exit...X_ERRMSG: %sREQUEST_METHODERRMSG: locked= %d :: msgfmt= %s

 %s 


Usage: WebX script [-Var Value [-Var2 Value2 [..]]] ERROR: %s %5d.%06d [%6d] %s/X_DEBUG%s/X_DEBUG.%da


%s/X_TRACE%s/X_LOG%s/X_LOG3%s/X_LOG.%dw%s/X_LOG3.%d

 hp: %d  mb: %d m_used: %d =====
áéíóúýÓÁÍÉÚÝàèìòùÀÈÌÒÙäëïöüÄËÏÖÜâêîôûÂÊÎÔÛãñõÃÑÕçǺas;&questi;optioncompilehtmlsqltrapsleepusleepchdirsqlnamesquitshellsetaddincludeerrorunlinkclearcookieforkfilexfilereplacewhileifeliffunctioncallexecreturnsqlsqlexecfopenpopenfclosepclosefgetsfputsvfputsfseekshmatshmdtendcontinuebreakX_fgets:OUT fp->size= %d fp->offset= %d
X_fgets:IN fp->size= %d fp->offset= %d
X_fgets: return( %d )  buff={%s}
cut_cmd: IN= {%s}<@----@>cut_cmd: OUT= {%s}cut_cmd: No more memory...<@quit>X_quit: buff= %s; compile= %d ignore: %d 
%s 

==> MALLOC ERROR! no more memory?? ==> EXIT; 
X_clear_value: name_patt: [%s] X_put_value: name: [%s] value: [%s] fixed: %d cookie: %d  ** %s := %s 
## Fixed Value: %s  ** %s add:= %s 
X_get_value: not found {%s} 
date_YEAR: %sdate_MONTH: %s%.2sdate_DAY: %s%02xX_transvalue: [%s]\t\n\rsh:call:txt2url:url2txt:trim:lower:upper:crypt:dt2str:str2dt:### dt2str ==> %s 
Bad format for dt2str: %s 
Too long name(s) for dt2str: %s 
%ld
	==> call: CALL: [%s] ==> call: OUTPUT: [%s] 
trim_buff: IN= {%s}trim_buff: OUT= {%s}year:Bad format for str2dt: %s 
Too long name(s) for str2dt: %s 
month:day:len:cut:str:word:%dint:printf:ftell:expr:-1env:todayX_ROWSX_DTX_UDTX_DDTX_RANDOMX_SQLCODEX_VERSIONX_INSERT_IDX_NVALX_NFUN%d [%d]X_ERRMSGDIRX_transvalue: no value for: [%s]%ld.%06dEXPR error: %s 
%f<@shmdt>X_shmdt: {%s} compile: %d  ignore: %d 
%s // %s 
0<@shmat>X_shmat: {%s} compile: %d  ignore: %d 
## Reached MAX SHM list value## Cannot get SHM...## Cannot attach SHM...## Cannot assign SHM Variable...<@fseek>X_io_fseek: {%s} compile: %d  ignore: %d 
<@vfputs>X_io_vfputs: {%s} compile: %d  ignore: %d 
stdoutstderr<@fputs>X_io_fputs: {%s} compile: %d  ignore: %d 
<@fgets>X_io_fgets: {%s} compile: %d  ignore: %d 
stdin<@pclose>X_io_pclose: {%s} compile: %d  ignore: %d 
<@fclose>X_io_fclose: {%s} compile: %d  ignore: %d 
<@popen>X_io_popen: {%s} compile: %d  ignore: %d 
<@fopen>X_io_fopen: {%s} compile: %d  ignore: %d 
<@return>X_return: {%s} compile: %d ignore: %d 
X_return: {%s}<@exec>X_exec: {%s} compile: %d ignore: %d 
<@replace>X_replace: {%s} compile: %d ignore: %d 
Bad syntax in REPLACE: %s ...X_replace: NAME: [%s] NEWVAL: [%s]X_replace: NAME: [%s] VAL: [%s] replace: [%s] by: [%s]X_replace: NAME: [%s] not exist or NULL value<@fork>X_fork: {%s} compile: %d  ignore: %d 
<@cookie>X_cookie: {%s} compile: %d  ignore: %d 
%s=HTTP_COOKIE<@clear>X_clear: {%s} compile: %d  ignore: %d 
<@unlink>X_unlink: {%s} compile: %d  ignore: %d 
<@error>X_error: {%s} compile: %d  ignore: %d 
<@>=>+=X_let: {%s} compile: %d  ignore: %d 
>*=>;=>$=>/=>%=>-=>++>--X_let: ### ERROR : did not find a command!!!<@add>X_add: {%s} compile: %d  ignore: %d 
<@set>X_set: {%s} compile: %d  ignore: %d 
<@shell>%s // %s
X_shell: {%s}
Cannot run SHELL: %s 
<@sqlnames>X_sqlnames: buff= %s; compile= %d ignore: %d 
lowercaseuppercase<@chdir>X_chdir: buff= %s; compile= %d ignore: %d 
<@usleep>X_usleep: buff= %s; compile= %d ignore: %d 
<@sleep>X_sleep: buff= %s; compile= %d ignore: %d 
<@sqltrap>X_sqltrap: buff= %s; compile= %d ignore: %d 
OFF_TRANSACTIONSON_TRANSACTIONSOFFON<@html>X_html: buff= %s; compile= %d ignore: %d 
<@compile>X_compile: buff= %s; compile= %d ignore: %d 
<@option>X_option: buff= %s; compile= %d ignore: %d 
fflushoffflushsql_namessql_transactionssql_traponsignalalarmlatin_htmlignore_empty_linesoff_transactionstranslatesigtermon_transactionsdebug## Wrong or unsupported signal name: %s !!sigintsighupUnknown option: %ssigalrmsigpipesigusr1sigusr2sigchld<@include>X_include: {%s} compile: %d  ignore: %d 
rFile SIZE: %d
X_ROOT/X_printfile: %s compile: %d level: %d
X_printfile: DIR-new= %s
Cannot access file: %s 

Cannot access file: %s


X_printfile: DIR-curr= %s ./%sLAST 100 CHARS ===> %s ===> Cannot open file: %s

Cannot open file: %s


Reused, File SIZE: %d <@end><@continue>X_notfound: [continue] ==> %d <@break>X_notfound: [break] ==> Continue= %d X_notfound: compile: %d ignore: %d ## Continue: %d Break: %d <@call>X_call: {%s} compile: %d ignore: %d CALL: Unknown function name: %s ,X_call: add argument name: %s value: {%s} X_call: analyse arg_string: %sX_call: no more values...<@call> %s( %d ) ==> SIGTRAP call: CALL: [%s] <@call> %s ==> SQLTRAP call: CALL: [%s] none### SYSTEM ERROR: more than 10 DB Session in proccess!X_BASEX_USERX_PASSWD### Cannot open database: %s ERR: %d SQLERR: %sc%d### Database name was not specified...%24sdisconnectbegincommitrollback### DATABASE Query ERROR: QUERY: %s ; ### ERRMSG: %s ### DATABASE Query ERROR: QUERY: %.200s ; ### ERRMSG: %.200s <@sqlexec>X_sqlexec: {%s} compile: %d ignore: %d X_sqlexec: query: %s <@function>X_function: {%s} compile: %d ignore: %d ,)%sX_function: add argname: %s X_while_values: name: %s compile: %d X_while_words: name: %s sep: {%s} compile: %d X_while_loop: compile: %d <@while>X_while: {%s} compile: %d ignore: %d wordsvaluesUnknown option: %s in WHILE...Fetch: %d values ** SQL fetch row: %d columns Name: %s Value: %sX_found: cid: %s compile: %d X_sqlnames### DATABASE QUERY ERROR: %s ### DATABASE QUERY ERROR: %.200s <@sql>X_sql: {%s} compile: %d ignore: %d selectshowexecuteX_sql: query: %s <@xfile>X_xfile: {%s} compile: %d ignore: %d X_xfile: file name is too long: {%s} aX_xfile: Cannot open file: {%s} X_xfile: outpass MAX open for file: {%s} <@file>X_file: {%s} compile: %d ignore: %d X_file: Cannot open file: {%s} <@if><@elif>X_if: {%s} compile: %d ignore: %d cmp!cmpicmp!icmpfcmp!fcmpfmt%lfX_if: try as line command: {%s} filled!filledEOFFilled... Filled? {%s} NULLafter VAL{%s} = %s X_if: [continue] ==> %d X_if: [break] ==> Continue= %d <@else>X_if: {%s} <@else> !fmtintfloatdateUnknown option in FMT: %s !EOFexist!existisDir!isDirisFile!isFile%s/x.pageregular_file: %s ==> ? regular_file: %s ==> OK. X_PAGEdef: X_PAGE: %sX_ERRORdef: X_ERROR: %sdef: X_PAGEInvalid %s value: %s ///./...%s/%sHTTP_HOSTSERVER_NAME%s/x.configrshell:00%s%s%s%sX_ROOT ===> {%s} X_ROOTX_HOME%dX_PIDX_PROGholdX_BASE==> Server: %s Root: %s Base: %s Hold: %d ### Not found X_PAGE value...WebXX_values: entry shellSERVER_PORT00%s:%sCannot open X_HOME config file: %sNo X_ROOT configuration for SERVER: %s X_ServerCOOKIESSet-Cookie: %s=%s; path=/; expires=31-Dec-2037 23:55:00 GMT Set-Cookie: %s=%s Set-Cookie: %s=NULL; path=/; expires=Wednesday, 21-Aug-1996 01:21:36 GMT Del-Cookie: %s X_SessionCOOKIESSet-Cookie: %s=%s; path=/;                       ! &%lld%Lf%llo%llxstrcutchcharstrlenX_exec_call: name= %s args= %s EXEC: Unknown function name: %s cutstr: fname= %s args= %s cutstr: name= [%s] str= [%s] chchar: fname= %s args= %s strlen: fname= %s args= %s strlen: STRname= [%s] LENname= [%s] %d%04d-%02d-%02d### No memory...||&&X_user_cmp( %s, %s, %s )likevlike!like!vlike>=≥>=<=≤<=!===>><<=Unknown CMP operator: %s X_user_icmp( %d, %s, %d )Unknown ICMP operator: %s X_user_fcmp( %f, %s, %f )Unknown FCMP operator: %s SSss%dMImi%02dHHhhDDddJJjjMMmm%04dYYYYyyyyAAAAaaaaYYYyyyAAAaaaYYyyAAaaAVL_search key: [%s] AVL_remove key: [%s] AVL_insert key: [%s] X_heap_new: hp: %d mb: %d m_used: %d X_heap: NO MEMORY...X_heap_alloc: hp: %d size: %d X_heap_info hp: %d mb: %d m_used: %d WARNING: heap_alloc( size= %d ) rmalign ==> mb: %d m_used: %d rmalign: mb: %d m_used: %d X_heap_free: %d X_heap_reduce: %d ### No more empty cursors!!! ### Cannot connect to DB Server: X_noselect_sql: QUERY: %s_mysql_### QUERY ERROR: %s### ERROR: cannot get a new cursor _mysql_; code: %d X_finish() -- Begin### FREE CURSOR: %d X_finish() -- End-X_database: "%s"MYSQL_SOCKETmysqlNULLX_select_sql: cursor: %s cmd: %d PREPARE QUERY: %s### QUERY RESULT ERROR: %s ### No memory for VVAL: %s ### CURSOR NAME ERROR...### QUERY ERROR: %s ### CURSOR: %s is already in use...%.70s ### CURSOR Duplication.### No more cursors OR %.70s REQUEST_METHODPOSTThis script should be referenced with a METHOD of POST. CONTENT_TYPEapplication/x-www-form-urlencodedCONTENT_LENGTHfmakeword: [%s] makeword: name= [%s], val= [%s] POST: CONTENT_LENGTH= %dThis script can only be used to decode form results. CONTENT_TYPEapplication/x-www-form-urlencodedREQUEST_METHODPOSTGETTMP_DIR/tmpw+%s/post.buff.%dTAKE: %s name="filename="NAME: %s VALUE... VALUE: [%s] NULLSEP: %s SIZE: %d %s/post.inputE_POST_parser: END: %d values FILE-src: [%s] FILE: [%s] %s/%s..%d.%dwBroken Input...PATH_INFOREQUEST_METHODGETQUERY_STRINGThis script should be referenced with a METHOD GET.
WARNING: Value value size is over %d!!! [cut]...
%%%02x&;`'"|*?~<>^()[]{}$\ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqrstuvwxyz{|}~ݬrootUSERLOGNAMELOGINUNKNOWN_USER like 'return-found-rowsdebugdatabasehostinit-commandusertimeoutpipepasswordcompresssocketportoptionsclientd:t:o,/tmp/client.tracemysqltcpMYSQL_TCP_PORT/tmp/mysql.sockMYSQL_UNIX_PORTmyMYSQL_PWDlocalhostshow databasesshow tables3.23.2-alphaPacket too large (%ld) %08lx%08lxA@?@PAAA@?@PAAAAACan't set state of named pipe to host: %-.64s pipe: %-.32s (%lu)Can't open named pipe to host: %-.64s pipe: %-.32s (%lu)Can't wait for named pipe to host: %-.64s pipe: %-.32s (%lu)%s via named pipeCommands out of sync; You can't run this command nowLost connection to MySQL server during queryError in server handshake%s via TCP/IPLocalhost via UNIX socketWrong host infoMySQL client run out of memoryProtocol mismatch. Server Version = %d Client Version = %dMySQL server has gone awayUnknown MySQL Server Host '%-.64s' (%d)Can't create TCP/IP socket (%d)Can't connect to MySQL server on '%-.64s' (%d)Can't connect to local MySQL server through socket '%-.64s' (%d)Can't create UNIX socket (%d)Unknown MySQL errorHOMEUMASK User time %.2f, System time %.2f Maximum resident set size %d, Integral resident set size %d Non physical pagefaults %d, Physical pagefaults %d, Swaps %d Blocks in %d out %d, Messages in %d out %d, Signals %d Vouluntary context switches %d, Invouluntary context switches %d @Y01230120022455012623010202Can't create directory '%s' (Errcode: %d)Disk is full writing '%s'. Waiting for someone to free space...%d files and %d streams is left open Warning: '%s' had %d linksCan't change dir to '%s' (Errcode: %d)Can't get working dirctory (Errcode: %d)Can't open stream from handle (Errcode: %d)Can't change size of file (Errcode: %d)Can't get stat of '%s' (Errcode: %d)Can't read dir of '%s' (Errcode: %d)Can't unlock file (Errcode: %d)Can't lock file (Errcode: %d)Unexpected eof found when reading file '%s' (Errcode: %d)Error on rename of '%s' to '%s' (Errcode: %d)Error on delete of '%s' (Errcode: %d)Out of memory (Needed %u bytes)Error on close of '%s' (Errcode: %d)Error writing file '%s' (Errcode: %d)Error reading file '%s' (Errcode: %d)Can't create/write to file '%s' (Errcode: %d)File '%s' not found (Errcode: %d)UNKNOWNUNOPENED..: ?~//etc/--no-defaults--defaults-file=defaults.cnf--print-defaults%s would have been started with the following arguments: %s Program aborted .error: Wrong group definition in config file: %s at line %d error: Found option without preceding group in config file: %s at line: %d --/AT$TTTT9:T00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0)8K  ^^. k o@oAo4BTB | oo<hx (8@PXhp(0@HX`px (08@HPX`hpx(0@HX`px      (08@HPX`hp !"#$)%&'(((". "."0 -...........x.` .F 3H3(2222h2H2111111X1 1000@4?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~AAAA\[\CEEEEIIIIDNOOOO]UUUYYAAAA\[\CEEEEIIIIDNOOOO]UUUYY|e  ex - e|e  e` - e|e  et - eT . AB B0BTG    ; <AB`TTT$TTT !"#$&T/B`: IYH tH TH B`TTT$oI@ TTTTI U4 U8!+e84@eHEePJeLQeTXe<\e@ams}|xDTBl(|8@ix0 DDxdBipibb y@Ba D@$DL6;i`AKbdX Vit^DX`deXkilryDHDPe\id[8 (     !02  2    !h    (428=0G  L  Q["p bmE r~<<E0>\  T@XHL\PDP L J,   `'d.]D 29@pIx OlVh[epyF TX   FL  P$ T %tp 3pt B,h MfF4vF T   8    4 H \ FG  ) 60 @À J4 SH ^ gq8  ~θ 8 p Ҁ d ش T 0 h 0 T   4 L % /l 9 C OG ^ it\  T$9 TT: TIT \  TTTT @@5 &( 7AB4H KA4T \0 dk ty0T xtT @ P d  O, ` L $ , Q`<  0j, CÀ KӬ  [ [ dD  p x  (@!  cl t X J dt OT r cp ^ )F\ ;= V>+> B@ J?h RhT ^p h= qA xw  @\    @t OP l U IL  8h 1h P  tt  > I )> 0@, ;? D@ L XxT o? vOfB@D  N OH  > >| >  y 8 ? 2 J < N, %U +>X *@ 2h AD KX > X  d( m uU( {O$  P <   8 = ( < h ?` A( L fp X QT AL h  (@ R-t ?!4 (g0 4@94` IYD S [\$ c-t o$ {zh( O BhV Ҁ, ̈́p ,D ` =8d x ., 1 θ $8 6 Ax =NL Y` bZl oƜ$ zUXl =,UL$ >T ; \ < ?k R LH   $ S!O00op  3T B JTQd `@ k$ y(5$ U p 4 D?  <`OgI T   p $<,O<7d AH0 Pl, X.  _ h, |Bd<O`  k4` z\ ] 3?TZH =D FX tD t <@#\ *$ 6@H D ]nx <| hAdn@hx0$ =P a !=, h, d 9 g\ $ \4 P`  SX< ?U'N p 0 9D A0  HOd[Fd!  l  :>d  jT t  ?H  ?$ h O4 _?$ ,  i  ILD UH O( 1Y <n(X =F?lN=V l>rL y>4~XT F`L>x *?<< JOhX0 HH <h 4 AXnx ApN  @8& t,d 04 U0?OP ZD #=hjd8 vvT y, 6, >@H gl\ p  4 h @  @A@T 4\ p U,! t @d &T 4JC P( =b@hORD   OX =\?U , xl XD HT @)=D ?0> Fsx(P nL@ OL" ~@*3h 68 F WA`H8 iOe}4 <NPO(F@(  $ p( U$ i=F8 == 4T =I8d n=F| ZO8eFqtZH }, ` m %vP q >6> Gt  @P@ P8` O@\h xx HP  =@z0 T (YxD 2  CO%La Wx^H o?w>p~\X $  w` <O  j< ; SH ../bin/WebX.mySQLcrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1chp.0__JCR_LIST__WebX.cX_checkpageprinted.0lib_ACT.clib_ENV.cbuff_env.0lib_MSG.clocked.0lib_TRACE.cfp.2fp.4Init.3Init.5F.0tp.1lib_TRANS.ckey_pX_sqlFUNCSignalFUNCDO_fflushc_freeContinueBreakTRAPfuncx_OPENX_sqllineX_lenX_get_cidHTML_tablevel.6Init.4scan_treex_SHMX_sqlTRAPX_USER_newHTMLReturnX_sqlcaseIgnoreEmptyX_get_basestr.2X_sqlcodecount_treeX_linesx_CMDinit.0init.3init.7ContinueMY_fflushX_sqlTRANSHTML_char.1tp.5cut_cmdlib_VAL.cbase.1pid.2X_ROOT.0EXPR_parser.cyydefgotoyydefactvalue_floatyycheckyytableyystosyytranslateyypgotoEXPR_INITEXPR_FLOATEXPR_BUFFyyr1yyr2value_intyypactlib_EXEC.cExeclib_check.ccurr.1cache.0daylong.2FMdate.cSETdateHoursOkMinutesYearMonthSecondsDaySkiplib_AVL.cavl_searchavl_removeavl_insertlib_TOOLS.cX_heap.clibmySQL.cDBhostDBnameNEW_cursorDBportDBsocketx_CURPasswdUserlibpost.clibEpost.clibget.cutil.cdim_PATT.cdim_CMP.cASCII.1Init.2Alpha.0libmysql.cnet_field_lengthconnect2read_rowsnet_safe_readoption_typesmysql_once_initmysql_reconnectgcc2_compiled.unpack_fieldssimple_commandend_servercurrent_mysqlmysql_read_default_optionsmysql_client_initnet_field_length_llremember_connectionsend_file_to_servernet.cmy_real_readnet_write_buffpassword.cerrmsg.cmy_init.cmy_init_donemy_static.cmy_malloc.cmy_realloc.cmy_open.cmy_read.cerrors.cmy_error.cmy_div.cmf_pack.cexpand_tildemy_messnc.cmf_dirname.ctypelib.cmy_alloc.cmf_format.cmulalloc.cdefault.csearch_default_filearray.cstrmov.cstrxmov.cstrnmov.cstrmake.cstrend.cis_prefix.cint2str.cstrcend.cbchange.cbmove_upp.cctype-latin1.cmy_getwd.cmy_fopen.cmake_ftypelibgcc2.c__FRAME_BEGIN____clz_tab__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START_my_reallocgetrusageX_CMPpattX_io_fseekX_io_popencheck_scrambleendpwentX_shmatmy_openyylvalint2strrindX_rowcountX_stdoutload_defaultsmysql_data_seekalloc_dynamicsystem_filenamesf_malloc_prehuncmysql_escape_stringmysql_optionsbchangemysql_pingX_shmdtX_ERRMSGlocal_thr_alarmCheckEnctypeMethodmy_readinit_alloc_rootX_cookiememdup_rootmy_ltoamysql_connectX_exec__iobX_io_fcloseX_clear_valuetest_if_hard_pathX_search_commandmy_file_infoX_put_valuemy_time_to_wait_for_lockGET_parserX_select_sqlX_noselect_sqlnet_buffer_lengthstrchrgeteuid_Q_qtoiHTML_stringfind_typevfprintfbcmpunescape_urlset_dynamicbzeroX_while_valuesgethostbynamemy_have_got_alarmyynerrsX_BASEX_startmysql_field_tellX_xFileX_get_int_finifmakewordX_shell.divX_avlcmpX_io_pclosegetsockopt_Q_qtollstrnmovX_error_ciddelete_dynamic_elementsystemmy_disable_flush_key_blocksX_signal_my_signalssf_max_adressX_fork__flsbufshmgetmy_fdopenescape_shell_cmdpop_dynamic_Q_divX_check_datemy_stream_openedgetcwdX_envX_eofrandominsert_dynamicX_commandX_check_namedim_EXEpattX_returnerrbuffTracemy_once_root_blockget_salt_from_passwordX_exitaccessX_unlinkmysql_row_tellmysql_list_fieldsmy_fopenX_io_fputsstrcmpmy_errnostrrchrgetpwnam_etextmysql_get_client_infomy_umaskmktimesf_min_adressnet_real_writeX_usleepX_setmy_mallocmysql_fetch_lengthsstrxmovmy_multi_mallocsrandX_add_valueX_trans_printfileAVL_searchlstatmysql_get_server_infonet_write_commandto_upper_latin1X_exec_call_Q_mulstrendX_free_allfreadmysql_fetch_rowuppercaseX_sleepX_clearEXPR_parsermysql_debugGETenvsoundex_mapTMP_DIRX_arg_string_sepstrdup_rootunpack_filenameconvert_dirnamenet_endputenvX_translinemy_net_initchcharX_check_floatmy_message_no_cursesmysql_fetch_fieldX_io_fgetsmy_net_writemysql_infoX_finishX_heap_allocmy_messageX_tracestrcpyX_BASE_holdmysql_dump_debug_info.remmy_filename_GLOBAL_OFFSET_TABLE_mysql_errnolocaltimeE_POST_parserPrintTMis_prefixX_callsort_order_latin1sf_malloc_endhuncunpack_dirnameX_chdir_edatadirname_lengthmysql_killX_set_cookiesatexitmysql_errormysql_stat_Q_addmysql_shutdownmake_typeX_printvaluemysql_real_querybmove_uppmain_Q_submysql_num_rowsfatal_error_handler_hookgettimeofday__deregister_frame_infox_BUFFERSX_functionmysql_eofX_arg_stringX_while_loopdim_ORpattX_cryptmemmoveto_lower_latin1X_htmlsscanfX_PAGEX_transvaluenet_flushmysys_uses_cursesX_str2dtmysql_thread_idmake_scrambled_passwordPOST_errmsgX_printfilevsprintflMaxMemoryX_sqltrapdelete_dynamicstrcendstrcutmy_setwdmysql_affected_rows__dso_handle_PROCEDURE_LINKAGE_TABLE_X_whilemysql_list_tablesdim_LOADpattX_heap_reduceX_fgetstouppermysql_use_resultmax_allowed_packetmysql_closeX_notfoundmy_endmysql_queryX_while_wordsmysql_fetch_field_directdate_MONTH.udivinet_addrstrmovgetpidmy_strdupX_quit_environfwriteX_letfreeze_sizeX_user_icmpX_free_cidmysql_field_countmy_net_readctype_latin1X_default_namesAVL_insert_Q_lltoqX_ERRORX_actionmy_closestrmakeStrLenmy_disable_lockingcurr_diryyparsemysql_real_connectmysql_fetch_fieldsGetMethod__muldi3fgetcX_sqlinit_dynamic_arraysf_malloc_quickX_valuesmysql_drop_db_Jv_RegisterClassesX_putcharX_headerX_fpmysql_field_seekmy_getwdX_heap_newdate_YEARisdigittolower__register_frame_info.umulX_Fileatoimysql_select_dbclient_errorsatol__divdi3X_fflushgloberrsmy_memdupX_sqlexecstrlenmysql_row_seekrealpathdate_DAYmy_dont_interrupthash_passwordgetservbynamemy_fcloseinit_glob_errskey_cache_initedstrlengthintern_filenameold_randominitmysql_create_dbX_user_cmpftellmy_errorX_get_valueX_io_fopenX_addX_todaygetloginX_iffcntlfputcX_includeX_CMPexecfree_rootX_HOMEyyerrorrndgetpwuidfn_formatX_take_stringmy_file_opened_lib_versionmysql_free_result.uremmy_default_record_cache_sizeAVL_removemysql_list_dbsX_replacemy_abort_hook_Q_stoqCookieX_foundnet_clearmy_printf_errorX_date_infofloormy_itoamemcmpmysql_portpRememberRootmy_initX_check_intcleanup_dirnamemysql_num_fields_DYNAMICget_typemy_disable_async_iomysql_insert_idstrcat_my_sig_remembermy_once_extramysql_unix_portfree_defaultsmysql_get_proto_infomysql_refreshDebughome_dirdirname_partstrncpystrstrmysql_list_processesX_optionX_dt2strmysql_get_host_infolCurMemorymy_prognameX_INSERT_IDX_io_vfputs__moddi3GetDDTx2cGET_pathmemcpyvp_SYMcmpsetsockoptselectX_errorcNewCountX_heap_freegetlinehome_dir_buffget_dynamicstrncmpdim_FREEpattX_compilelowercasemy_no_flags_free_dig_vecX_databaseyycharinit_client_errs_Q_qtosmemsetmysql_initmysql_store_resultplustospacegetenvdefault_directoriesX_sqlnamesX_user_fcmpX_debug@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic 123647-02 Feb 2008as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)as: SC4.2 dev 30 Nov 1995 GCC: (GNU) egcs-2.90.29 980515 (egcs-1.0.3 release)@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.489% : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; I 4: ; I.1@ 41 .? : ; ' I@ : ; I .? : ; I .? : ; I< 41.1< .: ; ' I@ 4: ; I .? : ; I< .? : ; I< !.? : ; I< "!I/#.1$1% U& U'1( ).? : ; I *.? : ; I +4: ; I? < ,4: ; I?  % $ > $ >  I.? : ; I@ .? : ; I< 4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; I@ 4: ; I 4: ; I 1 41  U U.? : ; I<  I!I/.: ; I .? : ; ' I@ : ; I .? : ; I< .? : ; ' < I!I/ 4: ; I? < %  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > .? : ; ' I@ : ; I  4: ; I4: ; I .? : ; I<  .? : ; I< 4: ; I? < I!I/%  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > I !I/ : ;I ' II : ;  : ; .? : ; ' I : ; I4: ; I.1@ 1 41 .? : ; ' I@ : ; I 4: ; I .111   .? : ; I< !.? : ; I< ".? : ; ' I #.? : ; I< $ U%.? : ; I< &4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ;  : ; I8 ' II : ;  : ; : ;I8 .? : ; ' I : ; I4: ; I .1@ 1 41  : ; I.? : ; I< .1< .: ;' I@ !: ;I ": ;I #4: ;I $.? : ; I< %1&1'1( U).? : ;I< *!I/+.: ; ' I ,.? : ;' I -: ;I..? : ;I< /.1< 04: ;I1.: ;' I 2: ;I34: ;I4.? : ;I< 5 6417.? : ;' I@ 8.? : ;I 9.? : ;' I :.? : ;' I@ ;.? : ;I <.? : ;I@ =4: ;I >.? : ;' I< ? U@.? : ;I< A B.1C.? : ;' I D.? : ;' I E.? : ;' I< F.? : ;' I< G.? : ;I@ H.? : ;I I4: ; I? < J4: ; I K4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; ' I@ : ; I 4: ; I 4: ; I U.? : ; I< 11 U41 1 .? : ; I< !I/ .: ; ' I !: ; I"4: ; I #.? : ; I< $: ; I%.? : ; ' I@ &.? : ; ' I< ' (.? : ; I< ).? : ; ' I< *.? : ;I@ +4: ;I ,.? : ;I< -.? : ;I< .4: ; I? < % $ > $ >  : ;  : ; I: ; I: ;I.? : ; I .1@ .? : ;' I@ 4: ;I : ; .1  4: ;I 4: ;I.? : ;I< 141  UI!I/  I.: ; I 4: ; I.? : ; I< .? : ; ' I@ : ; I 4: ; I !I/!&I"4: ;I?  % $ > $ >  I : ;  : ; I8 I : ; I .? : ; ' I@ : ; I 4: ; I .? : ; I< 4: ; I.? : ; I< I!I/ 4: ; I? < % $ > $ > : ; I : ;  : ; I8  I  : ; .? : ; ' I : ; I 4: ; I .1@ 1 41 .? : ; ' I@ : ; I 4: ; I .? : ; I< 11  U1I!I/ .? : ; ' I@ .? : ; ' I< I.? : ; I< U!.? : ; I< ".? : ; I< #.? : ; ' I< $ %.? : ;' I@ &: ;I '4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.: ;' I@ : ;I 4: ;I 1 1 U41 1.: ; ' I : ; I4: ; I4: ; I.? : ; ' I< I .? : ; ' I< I!I/ &I .? : ;I@ : ;I .? : ;' I@ 4: ;I !4: ;I"4: ; I % $ > $ >   : ;  : ; I8  I: ; I ' I I .: ; ' I@ : ; I U4: ; I 11 4141 11 .: ; ' : ; I4: ; I4: ; I  U.: ; ' I .: ;' I : ;I4: ;I  !.1@ " #.? : ;' I $.? : ; I< %&.1< '.? : ;' I@ (: ;I ).? : ; ' I@ *4: ; I? < % $ > $ >  I.? : ; ' I@ : ; I 4: ; I .? : ; ' I : ; I 4: ; I  1 .: ; ' I .1@ 1 41 11  U.: ; ' I % $ > $ >  I  : ;  : ; I8 : ; I .? : ; I@ 4: ; I .? : ; ' I< I .? : ; I<  .? : ; I<  .? : ; I< .? : ; ' I@ : ; I  U.? : ; ' I< 11 U41 .: ; I : ; I4: ; I.? : ; I< 4: ; I? < % $ >  I$ >   : ;  : ; I8 : ; I  : ; '  : ; (  : ;  : ; I8 I!I/  : ; .: ; ' I@ : ; I 4: ; I .? : ; I<  .? : ; I< .? : ; ' I@ 4: ; I11 1.: ;' I : ;I .? : ; I@ !1" #.? : ; ' I< $I%.? : ; I< &.? : ;' I@ ': ;I (4: ;I )4: ;I*41 +.: ; ' I ,: ; I-4: ; I? < .4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; ' I@ : ; I 4: ; I 4: ; I.? : ; ' I< I.? : ; I<  U.? : ; ' I< &II!I/ 4: ; I? < 4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; I@ .? : ; ' I< I &I4: ; I .? : ; ' I@ : ; I 4: ; I.? : ; I< .? : ; ' I<  U11 41  UI!I/!I/ &.: ; ' I : ; I! "4: ; I? < % $ >  : ;  : ; I8  I: ; I.? : ; ' I@ : ; I 4: ; I .? : ; I<  .? : ; ' I< I&I4: ; I.? : ; ' I<    4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; ' I@ : ; I 4: ; I 4: ; I .? : ; ' I< I.? : ; ' I<  &II!I/&.? : ; ' I : ; I.1@ 1 41 .? : ; ' @ 1 11.? : ; ' I@ .? : ; I< !% $ > $ >   : ;  : ; I8  I: ; I .? : ;I : ;I .? : ;I<  .1@ 1 .1< .? : ; I@ : ; I 4: ; I 4: ; I 4: ; I U.? : ; ' I< I1.? : ;I@ : ;I : ;I  .? : ; I@ : ; I % $ > $ > .? : ; I@ : ; I 4: ; I 4: ; I I I !I/ NILGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)WebX.c/SOFT/WebX/WebX/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned charlong long intFILEJblong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _5 ino_t Jblkcnt_t blksize_t long double mode_t mJ gid_t y dev_t J nlink_t Jtimespec&tv_sec'#tv_nsec(#timestruc_t> 1 statst_dev#st_pad1#st_inoa#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksize~#Pst_blocksn#Tst_fstype#Xst_pad4!#h     'name%Y#val&Y#entry'heapblock&m_next'#m_used(#heapblock_t*_heapalloc,smallreq-_#bigreq._#X_heap0(avlleft#right#balance#key_# data _#savl_t"savl_tree%root&#cmp'+#+c__avl_tree_t)qX_varinextjq#valuekY#CX_varmC X_USER0pavlq#namerY#varsw#fixedt# cookieu#"cleanv#$hpw #(nextx#,eX_USERzX_FILEtextY#offset#size#stat1# path#next#  &X_FILE&"X_FUN(avl#nameY#file"#offset#var(# next.#$wX_FUN ,files"#functions#x_USER#freelist# vtree1#ftree1#ctree1# hp #(4X_BUFFERSA scprintedtc ,ILInU4 eX_avlcmpcII^v1_Xv2_Y X_startcbuff err X_envc  c eIIn z   fX_checkpagecIJnpageYhbuff f} 9accessc LUc JJ`!Uc w"+ maincJNnargcchargv iic]shellcd#  X_trace#c X_debug$c GetMethod&c 3X_valuesec PX_set_cookiesgc# [ $ sX_actionkc X_exitnc$ eJJ z % z & *( CheckEnctypeMethod)c GET_parser3c  +cGET_path4c& Ppage>ccbuff? f|%x iUc KL Gc'KL'L@LT( MhMt E_POST_parser+c! +c% POST_parser/c! +cY)X_startc*sc Ab +__iob 1+POST_errmsgY,TracecU(,X_INSERT_ID"t "',ent ,DebugcU$,CookiecU ,X_eofcU,X_fp U,X_BASEYU,X_BASE_holdcU,X_PAGEYU ,X_ERRORYU,X_HOMEYU,,TMP_DIRYU0 ",X_ERRMSGp,DIRYBh,x_BUFFERS T[ON,NGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ACT.c/SOFT/WebX/WebX/srcintunsigned char)long long intlong int)charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleNX_actioneNN,^X_printfileeX_PAGE}Q`N,GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ENV.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned char6long long intFILEJelong int6charshort intshort unsigned intlong long unsigned intlong unsigned intlong double !X_env'fN,Pn host( dir( name( chp( env( buff_env)!U8 buff*2h len+fc fp,Cb IN0NL ]e ]eputenv=fPPputenv=f2C }getHOMEf fname}accessfAX_exitTfPQ`ncodeSfh buffUA iVfX_traceXfX_finishifgetpidjf/unlinkkfexitfRbe__iobRTracesfX_HOMETMP_DIR; RQ`GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_MSG.c/SOFT/WebX/WebX/src__va_listieva_list5g__FILE__FILE_cnt##_ptr$#_base&#_flag'# _file(# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intunsigned char Clong long intFILEJlong int Ccharshort intshort unsigned intlong long unsigned intlong unsigned intlong double ERRMSGQ`Rn fmt7l apxlockede8 lenX_trace  X_header* X_printfile> X_exit4 RHR|X_exit4 TracesX_fpx;X_ERROR~7cX_ERRMSGRX_stdout; NdXRGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TRACE.c/SOFT/WebX/WebX/src__va_listigva_list5i__FILE__FILE_cnt##_ptr$#_base&#_flag'# _file(# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intunsigned char Xlong long intFILEJlong intoff_ttime_t@   Xcharshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _O ino_t dblkcnt_t blksize_t long double suseconds_t 9 mode_t md uid_t u gid_t y dev_t d nlink_t dJtimespec &tv_sec '#tv_nsec (#timestruc_t >timeval 1tv_sec 2#tv_usec 3#statst_dev#st_pad1#st_ino{#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atimJ#8st_mtimJ#@st_ctimJ#Hst_blksize#Pst_blocks#Tst_fstype#Xst_pad4#h      Lheapblock&m_next'L#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#RX_heap0e avlleft #right #balance #keyy# data y#avl_t"Mavl_tree%root&M#cmp'h# hyySavl_tree_t)X_varXnextY#valueZs#X_var\IX_USER0_avl`#nameas#varb#fixedc# cookied#"cleane#$hpfI#(nextgO#,X_USERiX_FILEtexts#offset#size#stat# path#next#  cX_FILEc_X_FUN(avl#names#file_#offset#vare# nextk#$X_FUN ,files_#functions #x_USER #freelist # vtreen#ftreen#ctreen# hpI#(qUX_BUFFERS~ cPfp cFtp]tv] )RSHn ;X Ee< Ne@ Xh ~X_debugTSHUXnfmtSshapUzfpV ceHInitWeLbuffX ~   c D )STD |STD X dTlT access&UUD!e/  c"P X_traceUXXnfmtsiapzfp cePIniteTbuff ~# PB @ )UV\ |a$ XVX% _access& |W(Wl!e/WW!e/&Traces&Debugt&X_fpx c&X_HOMEs&TMP_DIRs&x_BUFFERS uEXGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TRANS.c/SOFT/WebX/WebX/src__FILEuh__FILE_cnt#h#_ptr$o#_base&o#_flag'u# _file(u# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intuunsigned charlong long intFILEJglong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _: ino_t Oblkcnt_t blksize_t long double suseconds_t 9 mode_t mO gid_t y dev_t O nlink_t O'timespec&tv_sec'#tv_nsec(#timestruc_t>ntimeval1tv_sec2#tv_usec3# ~ statst_dev#st_pad1#st_inof#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim'#8st_mtim'#@st_ctim'#Hst_blksize#Pst_blockss#Tst_fstype#Xst_pad4n#h     ' "^#^#len h#X_val"iheapblock&m_next'i#m_used(#4heapblock_t*4heapalloc,smallreq-#bigreq.#oX_heap0(avlleft(#right(#balance#keyd# data d#avl_t"javl_tree%root&j#cmp'#.hddpavl_tree_t);X_varij#k^#X_varmaX_USER0pavlq.#r^#vars#fixedt# cookieu#"cleanv#$hpwa#(xg#,X_USERzX_FILEtext^###stat~# path##  {X_FILE{mX_FUN(avl.#^#filem##vars# y#$ X_FUN X_CMDavl.#code#X_CMD S,filesm#functions S#x_USER Y#freelist Y# vtree#ftree#ctree# hpa#(mX_BUFFERS 3fp0 #1 #  X_OPEN3 p $>< #shm=^#  X_SHM> vcmdt^#codeuh#cmd_tv  WQhtmlN^#textO^# HTML_codeQ - X_search_commandh^initcmd hpanh iXYxn h  Y cXYT b /lowercasehstr^ J YxYn #h nuppercasehstr^ JYZn bh X_fflushhfp  ZZHn X X_fgetsh^hfpmnhh M ZH[8n ` i j h  cut_cmdh[8an!fpmh"oi#ih[#nhY#in }$ h%  [P\& & [P\aY' [\0& (& /& 6( `% M ^^& (& /& 6( `(0) f ;h' ^_& & ^_aY' __& (& /& 6(H ` u*++cut_commenthfpm^first^last^,X_quitWh-V^-Vh-Vh$hh)|_h.K]haan1`=ZIj/U/h| }X_USER_new Yabdn!hpXah"^i"^j0nh#p^h#hpa`0u Yab$kh.K]h1count_tree%h2a$j2len$0n&hh}bdbnaiX1Oscan_tree5 Y2a4j2patt4^0curr6 Y36 Y0p6 Y4X_CMPpatt;hbcn`ih"X.]8,6X_clear_valueYh2name_pattX^0uZ Y0prevZ Y3Z Y$h5&O6[&66&b&i66"6.1vX_USER_delh-^0u Y.h1X_USER_extract Y-^0u Y0prev YocdnhQ6a/%)cdXb`&i(`a"X.]'6dhdpO`(x6['vdldp&(h67kX_put_valuehdfpn"^h"^i!fixedhj!cookiehk0nh#hpa`#u Ya$h)_h%@kee$&ee$6()Yh._h1X_USER_get Y-^0u Y7AX_add_valuehfpgln"^`"^j0nh#hpai#u YX#vsk)_h'kftf&ftf6,X_get_value^-^0u Y$h&6Aglgn\h6h/r'kgpg&gpg68gh0ihgg^]9C h2id^0i heghTn-h8`,HTML_string^2ch0inith0HTML_char0str0chp^0ih ^   CehTin_eXe\i`mhphm,}X_putchar wh2ch v&66Cik4n\\%ei0i`h(](]:uChk4mn!val^h!out^i#lenha#ih`#chb%C klD X'elm&(]lm];GetDDT 0Init 0tp :0tv :0D umn(nibidh69?!h2date ^0i"h0n"h3#?h O n(nn`66#P/9/h2date.^0i0h0n0h31?h nnn`66P9YB>h2date=^0i?h0n?h3@?h nopn`6)63=PI<X_get_base^opo|^,X_crypt;h2in:o2out:o0key< 0n=h0len=h&'&2&>1Kcrypt_char1u2ch0u2key0^2len0ho|pnhiP`a'pp'a&2&>:& hpTn" ^h!out ^i0i h#n h}= &0env ^0val ^$/h>MCh^^?#format Z&~#val Z&~0chp Z^#dt [}) ;h@X_dt2str oh.C hAss.C hAss4.C hA/s4s<.C h?0= K'}0pos L#i Mhb)uC h(P.C h?p)Ph.C h?0#fmt $'}0val $^#chp $^Y#f %'/})C h'Ass&(6hANst.C hAtt4@|escape_shell_cmd h.C hAt4th#url &~@escape_url h.C h? )C h' tt BaA(tt.C h?m)EC h''8uu&'P('\`'faAuvP)C h' JvvD a?,(#format x&~#val x&~0chp x^#dt y}) ;h@X_str2dt h.C hAwx0crypted L^B]'oo)qC h'wx&^&ewx~a`'x@x'a2c&>? '@B'^)C h'zz&b(X66#~? pB ?'^) SC h'z{0&(66~? B '^) C h' {`{&l(6)63=~?!9#string &Ȼ~#s1 hc#s2 hd#m ha||.C hA!h|} #len '~.C h?!= '}.C h?"B#string &}0no h#m h\#n hX)!C h''~~&'&''d(0( [(\''8~~&'P(P'\`'fa?"|p#fmt '}#L }.C h%"k&6A"$.C hA##0#init il= '})#C h4getpid hA#= '}0u Y0n h#len h})#zC h%#}a&(X?##tv :}= '}.C hA$fD= '}0fun S0n h#len h})$:C h%$X}HLa&(XA$ .C hA$ 0= '}.C hA$0P= '}.C h%%&APl&(6h'kP\&P\6A%U= '}.C h%%uP}6(}6A%#T }= '}.C hA%@= }'}.C hA&.@d)&C h4X_today vhA&Ld.C h?&#i ^h}#sst ^h`#f _'/}= `'}@&EXPR_parser bh)& ;h.C h(.C h &* ' c ' ; '/ Ofloat1'trim_buffh-^0ih0nhhCX_crypt;hD!hD/hDB>h ' '1(getwordh-^2noh2word^0ih0nh7(mX_printvalue hTd^" ^XE h^^:) hd,n" ^X!out ^i" hj#chp ^h= )_#fullname )#i h\#n h[?). hA)7.C h%)Ch&'e$&(H]8]' x X )*7+X_shmdt h,n" ^h" hi" hj#io &0i h0n h0key h3 h3 h0len h#chp ^`= +=W ^h$*h)*_h)*Ph%*+-D&+C(`+O`'6&O6['v&`6 +-*1+ZSHM_del 8h- 7^0i 9h7-X_shmat qhn" p^h" phi" phj#io r&0i sh0n sh#key shd= shc= she#len shf#chp t^`= t+=W t^i$,@h),T_h),hPh%,+-`&+C(x+O`%,--j&-&-&-&-(. X.]6.%,k&6%-G6(&O(6['v&`6%-k+-h&+C(+O`'6&O6['v&`61.)SHM_att Ih- H^2key Hh- Hh- Hh2len Hh0u J Y0i Kh0id Kh:/9} h,n" ^h" hi" hj#io &#i h`0n h0sz h3 h#chp ^`= +#mode ^c= ^d=W ^b0fp  $/h)/(_h.Ph:0r h,(n" ^h" hi" hj#i hi0n h0sz h#io &#chp ^a= &~= ^`=W ^c0fp $0 h)0_h)01Ph'A<&(6h'k,&,6:1g h(n" ^h" hi" hj#io &#i hi0n h0sz h#chp ^`= &~= ^d=W ^c0fp $1Bh)1V_h.Ph:2x ^hn" ]^h" ]hi" ]hj#io _&#i `hi0n `h#sz `he3 `h#chp a^a= a+= a^d= a^j=W a^c0fp b $2Sh)2g_h.Ph:3I :hn" 9^h" 9hi" 9hj#io ;&#i <hi0n <h#chp =^`= =+=W =^c$3$h)38_h.Ph:4 h\n" ^h" hi" hj#io &#i hi0n h#chp ^`= +=W ^c$3h)4 _h.Ph:5w h\pn" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$4h)5_h.Ph:68 hpn" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$5h)6_h.Ph96Nnh-m^-mh-mh0ioh0noh0retp&$6|h)6Nh._h66n6%`61i6=j66I66S6]/66i/66|6,7X_exec[h-Z^-Zh-Zh0i\h0n\h3]'0args]&$7xh)7Nh)7_h)7Ph4X_exec_callgh8J6n7a7 i7,j67867B7LH7Xȿ/87e/8)7x/857/8A77:9hn"^`"hi"hj0nh#ihj0oldlenh0newlenh#out&#chp^a#cmd9ؿ=&#old&#new&$9:h)9NNh)9b_h)9vPh)9 ;h'Al`(6h'kx&x6 9 7:X_fork hn" ^`" hi" hj#pid :~#nm :|0sst$:dh):xNh):_h):Ph4forkh : :;h\n"^h"hi"hj=:~#nm:|#v&3^#ih[0nh$;kh);Nh);_h.Ph7<X_clearh\n"^`"hi"hj=&$<h)<&Nh)<:_h) <`n= a=i=$j=0/==</==O/==c/>=w=,>X_errorh-^-h-h0msg&$>dh)>xNh)>_h. ;h>> `,n>!a>-i>9j>E/>>Q/>>d/>>x>7CdX_leth,n"^h"hi"hj#let&0ih#nhi#chp^X3^=&~$?h)?Nh)?_hA?.Ph?@X#val^Y.Ph?@qx)@4Ph'A\`&(6h'k\`&(6?@.Ph?@)@Ph'A0&(6h'k & 6?A(.Ph%AGA&(H6h'k&6?A`)AdPh'A|&(x6h'k|&|6%AAX\&(6h'kX\&(6?B0valx^#name2x^i)BPh%B^A&(6h'k&(6'A$@&(6h'k$0&$06%BA&(06h'k&(P6%C#APl&(h6h'kP\&P\6'A,L&(6h'k,<&,<67DJX_addhn"^`"hi"hj#add&#iha#nhb0chp^3^=&~$Dh)D%Nh)D9_h.Ph7E0X_sethn"^`"hi"hj#set&#iha#nhb0chp^3^=+$Dh)E Nh)E_h.Ph,EX_shellch-b^-bh-bh0outd&)ENh)E_h$Eh. ;hF"E0nEG`ESZE_jEk/FEw/F E/FEE,FX_sqlnamesFh-E^-Eh-Eh0outG&$Fh)FNh._hFF"nF<`FHiFTjF`/FFl/FFF,GX_chdir4h-3^-3h-3h0n5h0out6&$G[h)GoNh)G_h)GPh4chdir?hHFnGaGiG&j6G2G</GGH/GG[/HGo/HGG,HX_usleep"h-!^-!h-!h0n#h0out$&$Hh)HNh)H_h4usleep-hI$HnH2`H>iHJjHVH`/IHl/IH/IHH,IX_sleeph-^-h-h0nh0out&$Ih)INh)I_h4sleephJ,I$nI;`IGiISjI_Ii/J Iu/JI/J#II7JX_sqltraphLn"^`"hi"hj#cmd&0val^$Jh)JNh._h,KKX_htmlh-^-h-h0cmd&$K&h)K:Nh._hKJLTnJ`JiJjK/KK/KK&K:,LX_compileh-^--h0cmd&$Kh)LNh._hLrKTTnK`KiKjK/L]K/LiKL7MX_optionVhTn"U^`"Ui"Uhj0nWh#sigWh`#cmdX&0chpX^=X^h#valX^b$M!h)M5Nh)MI_h)M]Ph)Mq ;h%M  Bj%M LƄ B`?M. ;hʜʰ4alarmh,NpX_trans_printfileKh-J^-Jh3L&0fnameL^)NANh)NUPhEa h^hNMTnMhNiNN`/NN-/NNANU^h:Om hTDn"^a"hi"hj$O%h)O9_h'M&N&NNNa7VX_commanduhDn!fptmh"t^i"tj"thk=v P#nwh\FPX_leth^hh?T.FP4X_seth^hhFPYX_addh^hhFPX_ifhm^hh>P'h^hhFPX_sqlhm^hh)P1hBPV^hhFQ'X_Filehm^hhFQSX_xFile=hm^hh>Qv ^h^hh>Q h^hh>Q h^hh>Q} h^hh>R8 h^hh>R%w h^hh>RH h^hh>Rk :h^hh>Rrhm^hhFRX_whilehm^hh>R h^hhBRV^hh>Sh^hhBS7V^hh>SZh^hhBSsV^hhFSX_clearh^hhFSX_fork h^hhFSX_shmat qh^hhFTX_shmdt h^hh'π&Z&%Tk6Ѹ&66a&6(66I66S6]п%T6Ұ&77`&7(67867B7L{7Xz%T<X&==a&=( =0}%U> Ո&>>a&>( (>Eп~%UOE0֬&EEZ&E֬Ek~%UF"֬|&FFa&F( @F`п}%UF|&GGa&G( X6G2G<{%UJ@&K^Kea&Kl( pKп{%V*H&HH`&H( HVzH`|%VgI$ڈ&II`&I( I_zIiп|'KڈP&L2&L9&L@( KzDNnhCX_errorhD^hCX_exec[h:Ya hn!fname ^c" h#level hip#file mi#fp  b= &= &#oldpath ^c#newpath :0t h0n h#sst ~= m$Wh%X:Y&Y4YBb( 6YR'A$`( 6h'k $&( 06%Xj t (`& /& 6( X a?X pE h^^h?X )X ;h)XK]h'  X( )X ;h)YK]h' 8 X1Y`new_dir h2fname ^2newpath ^0root ^:ZYl{h n!fpzmh"zh"zhj0i|h0j|h0n|h0sst|h3}=~&=~&$Zh%ZB l (`& /& 6(  i( .Nh:\1h n"^`"hi"hj!ret^k=l0ih#nhX#argsh~#out&='#val&~#chp^X#sym^X#oldReturn^~#fun Sb#vsj#u YY#x_USER Yc#hpag$[h)[Nh)[_h)[Ph)[ ;h%\v$X`(Xk6( )\8h'6DO`H6['vHp&Hpk67\X_signalhn!sighh= \}( $\h._h ]*+;]MX_error_cid^0cmd]M)]; ;hh ]^*]]hn]|/]]'( ]<G_LX_get_cid^hn#iha#user^`#passwd^Z%^ ]<]|( X]|( @^,X_databaseh%^nAT``( 6h'k\`&( 6%^A`( 6h'k&6%^Ah( 6h'k&6( #msg:{)_#h']H]|( 8]| `jX_sqllinehHn!query^c#cmd&@_X_noselect_sqlh%_ LP BaA`8t@_X_finishhB_`j'Ht]Ht]t@)`;h)`O ;h(hHgh:aJ'hHn"^`"hi"hj#query&#cid^h$`h)aNh)a_hBa)aJ^'(&V( X8jD h:brh n!fpmg"^i"hj"hk0ih#nha0argsh#out&='#chp^X0sym^#fun Sc#hpab#vsk$bEh)bYNh)bm_h)bPh( p.>h:cRRh @n!fpQmh"Q^i"Qhj#uS YX0nTh3Th=Ub#srcVh#varVs`#vVsi$cIh)c]l'h%ck8@&( 6Ac.l'h .l'h:e 4'h@n!fp&mh"&^i!sep&^j"&hk#u( YX#n)hQ=)hf=*a0src+^#val+e b#chp+^i=+&$dh)d>h)dl'h%dk`h&( 6?d .l'h@T.l'h^9el'h2fpm-h3$eYh.l'heene#he.ie:`/eeFeZ7gX_whileh,n!fpmh"^i"hj"hk0ih0jh#nhX0ssth0linesh3#out&#chp^i#cmd9ؿ=&#sep&$fh)fNh)f_h)fPhBggmh>g-4'hm^^h>gPRRhm^h)gd ;hAg8L.l'h'ex&e&e( e:kD'h7iX_founduh,$n!cidt^!hpta!fptm"th#valviQ#iwhc0jwh#nwh#sstwhm#lineswhd=x=y&=y&$hh)hh)hl'h?i1 )h_h)il'h)ih' Jl `%iJ  B`4)igh)i{ ;h)i_hE1h^hh^ i'*7kX_sqlh$8n!fpmg"^i"hj"hk0noh0ih#nhܐ0showh0ssth#cmd?P#query&п#vali#cid^b#hpac$jh)jNh)j_h)jh%k  B`?k ()k5h)kIh( H)kbh)kv ;h)kh)kh'D|&VD|8`'H&V( `8`7mX_xFile=h8n!fp<mf"<^i"<hj"<hk#fp_OLD> c#fp_NEW> d=?&#i@hb#FF@hb$lh)lNh)l_h)lPh)l ;h)ll'h.l'h7nBX_Filehn!fpmd"^i"hj"hk#fp_OLD c#fp_NEW k= &#FF!hb$mh)mNh)m_h)mPh)n ;h)n'l'h.l'h7r]X_ifhn!fpmj"^d"h"hk0u Y0ih0jh#nhi0ssth#Nothk#i1ha#i2hZ#linecmdhh#f1r]#f2r]ؾ#out&#chpcmd^f#chp^a0name1^#name2^`#op^a#v1^`0v2^#f_sst~$oh)oNh)o_h)oPh)p ;h>p4l{hmhhApZ  <4X_user_fcmph?pt x.hAp  .l'hAp  x.h%pA  <&( 6h'k  ,&  ,6Aq 4X_user_icmph%qJ d (`& /& 6(  aAqh.l'h%qA|&( 6h'k|&|6Aq4X_check_datehAq4H. ;hAr 4accesshAr:4X_check_floath4X_check_inthdouble rwg I__iobrgITracehIX_INSERT_ID8IDebug*hIX_eofhIX_fp IX_ERRMSG&IDIR^Ix_BUFFERS _JHTMLhD@JX_lineshitJX_lenhDDJContinueBreakhJContinuehJBreakhKX_stdout JReturn^JX_sqlcase hJX_sqlTRAP!hBJX_sqlFUNC"hJX_sqlTRANS#hDPJX_sqlcode$hJIgnoreEmpty%hDLIX_rowcount)h tb Jx_OPEN5tRix t Jx_SHM@tvy t ?JTRAPfuncCt|8JDO_fflushDhDTJMY_fflushEhDH t +Jx_CMDytDX u&  JSignalFUNCu|x uN W 4#HTML_tabUu>B u{   #ciduex uh  #c_freeuBl#base^#key_p.h !GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_VAL.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned charlong long intFILEJelong intoff_ttime_t@  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _+ ino_t @blkcnt_t blksize_t long double mode_t m@ uid_t u gid_t y dev_t @ nlink_t @timespec &tv_sec '#tv_nsec (#timestruc_t >{statst_dev#st_pad1{#st_inoW#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksizet#Pst_blocksd#Tst_fstype#Xst_pad4#h       'name%O#val&O#entry'heapblock&m_next'#m_used(#heapblock_t*cheapalloc,smallreq-c#bigreq.c#X_heap0,avlleft#right#balance#keyU# data U#wavl_t"wavl_tree%root&#cmp'/#/fUUavl_tree_t)uX_varXnextYu#valueZO#GX_var\GX_USER0_avl`#nameaO#varb{#fixedc# cookied#"cleane#$hpf#(nextg#,iX_USERiX_FILEtextO#offset#size#stat%# path#next#  *X_FILE*&X_FUN(avl#nameO#file&#offset#var,# next2#${X_FUN ,files&#functions#x_USER#freelist# vtree5#ftree5#ctree5# hp#(8X_BUFFERSE fXnrootOhu {chpO  Omf bof 8   z 4 @ y ofmf  )regular_filef!uOsst%mf fXnrootOhuiu {"chpOQ Yf# X_heap_reducef  $ 0` ;` F{ Rc _h  x z iroot_levelf$rootO!uOchpOname ilevelfif y c% X_values>fnprog=Oh"n?f`No?fMax?fv@,"ServerA i"ConfigA i~"httpA i}"holdA }"chpAOY"S_NAMEAOX"S_PORTAOX"fpB `"X_ROOTC "baseC "pidC hpD"uE` mf Yf# chdirmf of# getpidqf& fO' :4`(X_add_valuef' Wf' ~)fO Yf(getcwdZf      '*'X_set_cookiesf!n+buff'+namelistOX+chpOa+nameO`+valOQ+cookieOh+nfb,{f-f,{f-f' !`!,f-f!!-f 8.Tracesf X'.entoG.Debugtf.X_BASE{O.X_BASE_hold|f.X_PAGE}O.X_ERROR~O.X_HOMEO.x_BUFFERS-t!GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)EXPR_parser.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intYYSTYPEt_intt_floatlong doubleYYSTYPEyyalloc yyss yyvs short intyysigned_char  <signed chari K!!^ Fyyparse li!-n yystate nic yyn oib yyresult pih yyerrstatus rii yytoken ti[ yyssa F| yyss ]e yyssp ]d yyvsa cc yyvs sj yyvsp sh yystacksize m yyval c yylen ig yysetstate " yynewstate =$ yyexhaustedlab +x yyabortlab %h yybackup " yydefault C#\ yyerrlab # yyreduce M#t yyacceptlab , yyerrlab1 u# yyerrorlab j# yyreturn %l fy"," yysize b"\" yyss1 ]h yyptr `"|" `"" #$  Ei%&ccfccfVVsViyylexdiieffvalgchphisdigitpicharEEXPR_parseri--tnexprXv_intEiv_floatKjiihiQfloatvalue_intvalue_float EXPR_BUFF0EXPR_INITi4EXPR_FLOATi8 V!p yytranslate (!h!V yyr1 x( !=V yyr2 P !-eV yydefact | !UV!& yydefgoto  !V yypact "p!V yypgoto  !V1 yytable . !CV1 yycheck Y!0!3nV yystos  !^"yychar Mix"yylval P"yynerrs Sil1-tGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_EXEC.c/SOFT/WebX/WebX/srcintunsigned char long long intlong int charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleC name#functionN#NfC X_EXEC  X_exec_call0f-t. n name/h args/i n1fa 3f MstrcutKf. .n fnameJh argsJi nameLM strLM~valLnMf=3f Sf]c chcharjf.0 n fnameih argsii namekM strkM~valk ch1kQ ch2kZnlf3f Sf StrLenf0 1n fnameh argsi nameM lenM~valch1ch2nf3f SfTracesfT Exec'E 9>\1GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_check.c/SOFT/WebX/WebX/srcintunsigned char<long long intlong inttime_t@]tm$Etm_secFg#tm_minGg#tm_hourHg#tm_mdayIg# tm_monJg#tm_yearKg#tm_wdayLg#tm_ydayMg#tm_isdstNg# <charshort intshort unsigned intlong long unsigned intlong unsigned intdlong double heapblock&m_next' #m_used(l#heapblock_t*Zheapalloc,smallreq-Z#bigreq.Z#X_heap0#` patt#dimPATT#pattCACHEt X_get_intg buff val leng ig #11^XYZ]zX_check_float*g12nbuff)hi+g\ len+gdot+g[X_check_date?g23nval>hdaylong@EbuffAdayBgXmonthBg` yearBgc_dayC~c_monthC~c_yearC~ spaceDg iEg nEgaatoiNg2H2 [2H2]22[ 0]23(X H]g] d]c"d] jX_check_intYg34 nbuffXhiZg] lenZgX_todayi4 4nhphnhtmjXTkDbufflHchplhd]'&g45npatthvalicache<currg<ig`amalloctIgdim_LOADpattg0g `!0g45(dim_FREEpattg"freeg]X_CMPpattg56npatthvaliop` sstg#s&g$668!&g!&gEX_user_cmpg69nv1hopiv2jPgIg$/77!g!g%X_user_icmpg9;n&v1 gh&op i&v2 gjPg!Ig% #X_user_fcmp8g;>\n&v17 #h&op7j&v27 #` Pg!Igdouble'Tracesg J,>\GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)FMdate.c/SOFT/WebX/WebX/srclong inttime_t@k1tm$Etm_secF1#tm_minG1#tm_hourH1#tm_mdayI1# tm_monJ1#tm_yearK1#tm_wdayL1#tm_ydayM1#tm_isdstN1# intunsigned charcharshort intlong long intshort unsigned intlong long unsigned intlong unsigned intPlong doubleub1 ?ub2 vTdatime year #month #day #hour #minute !#second "#datetime_t $}SETdate -1>\Hn v ,}h  ,i  ,j  ,1k count .1] T /w tm 0X ,>?     `h pb@@ x    ``  A<B 4 ? J U `i`rX B4C<     $`-P <CpD8     `HTDE h s ~  (`@TGTOsecond /1v .} . . .1i 01n 01{ 1G n 1WWd)X 1W` 1WWWP8]P TOminute N1v M} M M M1i O1n O1{ PGn 1WWdX 1W` 1WWTOhour m1v l} l l l1i n1n n1{ oGn 1WWdX 1W` 1WWTOday 1v }   1i 1n 1{ GZn 1WWdyX 1W` 1WWTTOmonth 1v }   1i 1n 1{ Gn 1WWd6X 1W` 1WW TOyear 1v }   1i 1n 1{ GX 1Wn 1WWd 0 g W` 1WW o Rg W` 1WW  g W` 1WW g W` 1WW oX_date_info m1HI8nyear l ohmonth l oiday l ojhours l okminutes l olseconds l omX X_dt2str x1I8Indt wk  wY  wZ v yTh tm zX RX_str2dt 1IJ,n  h  idt  Rj v Th tm @!tmp k"Ok *1@"Skip *1D"Year *1H"Month *1L"Day *1P"Hours *1T"Minutes *1X"Seconds *1\ TJ,GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_AVL.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublenavlleftn#rightn#balance#key# data #avl_t"avl_tree%root&#cmp'#t e  avl_tree_t) favl_insert@eJ,Ln t?f` a?i HGh^lKK}KKQKK4KK4]Q hihK4KhhlLL }LL  LxLLxL:LLLLQlLL}LL]Qavl_swlrootabavl_swr'root&a(b)avl_nasty1root0 avl_removeeLPn tfh aive` Wssteh sstehMMMMNN7@XKiO(O<O(O<Q(lO<OT}O<OT]QAOTOXllOO}OOlPP}PPlPXPh}PXPhQPhPPhP]QPPPPUavl_removerootetfssteaavl_search"t!fa!x#etree3 tree)!UPQTnn`xiX"PQhh#oAVL_search@t?fkey?aAt$Ie%  e !QTRDni Y,X&6%UQtQ`X"QQP0H'AVL_removeeRDSXn(tfh(keyia$Ne%R\RH,XURhR`hX"RSPH) AVL_inserteSXTn tfa ai$ e% bSpSY,XUSS`X" xT$TDPH*TraceseoՄYTGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TOOLS.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublepX_take_stringgTUH^buffXvalYig\ng[X_arg_string=g buff< val< i>g n>g ch?  stop_char* ch)2pUHVnh]lkkUU AX_arg_string_sepegVYnbuffdhvald]sepdjifg_nfgi chgAWWT S ]WWThmAWpWSQ ]hlpWYh  lkkX0X stop_sepYg chX sepX iZg]YGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)X_heap.c/SOFT/WebX/SQLintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleHheapblock&m_next'H#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#NX_heap0a UX_heap_new#YZln hp$h  w  5_'Z8ZL(_ZLZd C(_free0_IX_heap_alloc>Zl\hncurrheap<asize=_i mb?` cp@h 5_  w I[[ ]@gQt]/[t[ w\P\`(_rmalign_mbbegin_end_5_ )X_heap_free_\h]nhp` mbX 5_free0_\\free0_\\free0_ X_heap_reduce_]]nhp` mbQ x5_]l]xfree0_Traces_y|h]GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libmySQL.c/SOFT/WebX/SQLintnunsigned charDlong long intlong intDcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleQ "name#value#len a#X_val" heapblock&m_next'#m_used(#^heapblock_t*^ heapalloc,smallreq-#bigreq.#X_heap0my_bool Nst_used_mem nextN#left#size# USED_MEM st_mem_rootfree#used#min_malloc #block_size!# error_handler"#T MEM_ROOT#dmy_socket*a Wenum_net_typeN NET_TYPE_TCPIP NET_TYPE_SOCKET NET_TYPE_NAMEDPIPE st_net PnettypeQ#fdU#fcntlVa#buffWh# buff_endWh#write_posWh#read_posWh#last_errorX#last_errnoY#max_packetY#timeoutY#pkt_nrY#errorZ#return_errnoZ##Z#remain_in_buf\#length\#buf_length\#where_b\#more]#save_char^#NET_W enum_field_typesc FIELD_TYPE_DECIMAL FIELD_TYPE_TINY FIELD_TYPE_SHORT FIELD_TYPE_LONG FIELD_TYPE_FLOAT FIELD_TYPE_DOUBLE FIELD_TYPE_NULL FIELD_TYPE_TIMESTAMP FIELD_TYPE_LONGLONG FIELD_TYPE_INT24 FIELD_TYPE_DATE FIELD_TYPE_TIME FIELD_TYPE_DATETIME FIELD_TYPE_YEAR FIELD_TYPE_NEWDATE FIELD_TYPE_ENUM FIELD_TYPE_SET FIELD_TYPE_TINY_BLOB FIELD_TYPE_MEDIUM_BLOB FIELD_TYPE_LONG_BLOB FIELD_TYPE_BLOB FIELD_TYPE_VAR_STRING FIELD_TYPE_STRINGdouble st_mysql_field 9name:#table;#def<#type=# length>#max_length?#flags@#decimalsA#MYSQL_FIELDBMYSQL_ROWD my_ulonglongL "st_mysql_rowsQnextR"#dataS#MYSQL_ROWST( st_mysql_data(XrowsY#Z#data[:# alloc\#MYSQL_DATA]@ st_mysql_options0_connect_timeout`#8`##a#named_pipea# portb# hostc#init_commandc#userc#passwordc#,c# dbc#$my_cnf_filed#(my_cnf_groupd#, mysql_statusk MYSQL_STATUS_READY MYSQL_STATUS_GET_RESULT MYSQL_STATUS_USE_RESULT st_mysqlnneto#hostp#userp#passwdp#,p#server_versionp#host_infop#infoq#dbq#portr#8r#server_capabilitiesr#protocol_versions#Qt#thread_idu#affected_rowsv#insert_idw#extra_infox#packet_lengthy#statusz #{ #|#free_me}#reconnect~#options#MYSQL  st_mysql_resHrow_count#Q#current_field#  #data #data_cursor:##row#0current_row#4lengths#8handle #<eof#@ MYSQL_RES  Z-state(a#cid) Z#mysql* #res+ j# j  X_CURSOR-  NEW_cursora]^ncidhiad Ra^^RaX_noselect_sqla^`nqueryhnumbaivaljchpTRam__]``\]QFREE_cursoraia X_finisha`ania`RaaXa! X_databaseNaacndbnameMhuserMipasswdMjchpOlRa"b@b\#  $"blb#  $"bb#  $"cc(%atoinacHc!&*X_select_sqlach,n'cmdah'cidi'queryj'hpk'numb*l'valm(rowa(iai)lena)chpRa0d$dT!Id$dT*T`0ee!Iee*T`ef(]a+^FIND_cursora,cidia&sql_errorlah,hn'buffkh-Tracesa-X_INSERT_ID8.X_rowcountat p x_CUR0xDBhost@`DBname@dUser@hPasswd@lDBsocket@pDBportAacursorBaEjhGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libpost.c/SOFT/WebX/POST/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned char]long long intlong int 'name%#val&#charentry' POST_parserfhjn enth xfb mf clfl nof chpZqstrcmp fatoi+fX_trace,f`strchr fe]__iobPOST_errmsgpTracefHqjGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libEpost.c/SOFT/WebX/POST/src__FILEtg__FILE_cnt#g#_ptr$n#_base&n#_flag't# _file(t# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # inttunsigned charjlong long intFILEJflong int 'name%#val&#charentry' <CheckEnctypeMethod%gjjn strcmp g < <B  GetMethod.gjknmethod/` strcmp g < <E_POST_parser8gkqnent7hbuff9{fname9zname9XSEP9`sep9.xfp:?`fp_buff:?jfp_input:?ai;g]n;gmsize;gQSEP_SIZE;gTMPDIR<iX_trace>ggetenv?ggetlinePgstrlen  <getpidUgunlinkWg8strcpy   <]memcmp g E E Llm(dlm(pXmemcmp g E E  memcpy   E  memcpy   E j.?+Kstrip_nameg namechpstrrchr  < g strcpy   <!f"__iob"POST_errmsg"Tracegt,qGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libget.c/SOFT/WebX/POST/srcintunsigned charunsigned intlong long intlong int'name%#val&#charentry'qGET_pathdqrnentqanamei id` pathb Tgetenvd strcmp d w w}GET_parser2drt,nent1qhname1i i3db x3dccl4dno4d query5a path5` chp5X3strcmp d w w Igetenvd rsPqstrlen | w strchr  w dst$malloc  | strncpy  w |POST_errmsg^ zt,GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)util.c/SOFT/WebX/POST/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned charwlong long intFILEJblong int BmakewordBt,tn lineBa stopHi xc` wordB mallocPstrncpyBBRHcharXH fmakeword)Btvn fp(h stop(Hi cl(j ll*cb out*cc word+Bh buff+%| mallocPmemcpyPP=c6H6SwCpx2cHHwhatGB digitIHDvvT^VXb]unescape_urlTvTwn urlSBh xUc_ yUckDvvjvvbmQescape_urlewwn urldBh valuedBi xfc` yfcaplustospace{wx(^ strzBX x|c] rindcx(xxn sB` cHi xchstrlenR +getlinecxxy0n sBh nci fpj ic`YindcsBcH xc+y0y^=\FYOXescape_shell_cmdyzhn cmdBh xcZ yc\ lcX strlenR+yylYsyyO\GETenvBzhzn nameBh vBX getenvc!!czGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)dim_PATT.c/SOFT/WebX/PATTlong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubleq )PATT_NEXT *q#PATT_OR +q#ch0 ,u#ch1 -u# PATT_OP .#  0 dim_FREEpatt    free w zznh dim_LOADpattz~nbufhw`bOR_patt`ialenStopdop_TESTeop_SIDEfmalloc}~`u#dim_ORpatt~nhchu~Th vp_SYMcmp2 dim_EXEpattnXbufii`lenStoph#cTGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)dim_CMP.c/SOFT/WebX/PATTlong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doublevp_SYMcmpTns1`s2injAlpha#FASCII*Init+i0\j0m0Xt t a ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hWebX.cdata.hILIPITI\I`IdIhIhIpItI|IIIIIII IIIIIIIIIIJ#JqJ#J qJJJ J J(J0JHJTJ` J`JlmJt!J|JJJJJJJ~JJ}JJ}JJ}JJJJKKKK KKKKK K$K,K4K4KH%KHoKP%K\K`KdKhK|-KgKK+KiKKEKOKEKKKIKKKLGL7L$L,L4L8L8L@"LLLLLTtL`LhLmLgL7LLLaLLLLbMM)MM M !M(3M0M4M@MLpMTM`M`MhMtMDMMMOMM?MPMDMPMMNNN ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_ACT.cN+NN, ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_ENV.cN,:N0tNL(NdNxNxN N NN NN NNNNNNNNNNOOOOO< O@OHOPOhOpOxO|OOmOeO&OnOP%PoPPH$PHpPPP|#P|qPP=PPPP%PQQQ,Q8Q@iQP)QXQ` ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_MSG.cQ`.QdQlQQQQQQQQQQQQQQQQRRRaR0R8/R8R@RHtRTRTR\RlRtR|rRR ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRACE.cRRRRRRRS0SHESLSTShStS|S|SSSS7SST4TDbTTTliTTTTTTTTTUU(UDUXU\UdU|UU0UU_UUUUUVVLV\VlVtVVVVVVVVVVVVVVWW W W(W(WLW`WdWhWlWWW WWWWWWXX(_X0XPXpXXt ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRANS.cXXXXXXXXXY YY$Y,Y0Y4Y<YLYLYTY`YlYxYYYZZZ ZZZHZLZXZXZ`Z|Z|ZZZZZZZ Z[[[8K[<[PO[d"[dr[lH[tZ[ [[ [[ [j[[[[\\ \0 \45\4_\<5\H\H\Pb\X\X\t\|\\u\\u\]\\\\\]]] ] ]8]D]D]`]l]l]t]]]]],]Y]O]V]^^^^4^`^`^h^^^^ ^)^k^)^"^r^]^E^ ^^ ^^ _j__@_@_H_p_t_ _5___5_b_2_b______u__u_r``,`,`8`@`@`H`T`l``````z````u``u`y`aaaaa0a4a8a<aDadapaaaaa~a aa aaabbbbbb(b,bDbLbPbTbXbdVbhbtb|bbbbbbbbbbbb bccc c,c8c\c`chkctctc|cc/ccYcccccccc cdd ddd d d(dLdPdTdXdd\=d\Wdh^dl dpmdtdddddd$ddVddadd dYdddddd]ee~e$e(e(~e0e8e8e@ eLeXe\ede|eeee$ee_eee e~ee fffff(f0f8fD fLmfdfp5ft~ff~ff~fffffffffgg g g(pg4#gDgL gXg\gl!gp~ggg~gggggggggohhh h h(h,h,h8hHhThXhdhhhphhhhhhhhhhhiii iuii(i(i0 iDiXiXi`piujH jdjjjjjjjjjjjpj$jjjmjuk4 k8kDkPkPklkpkpkxkkqkkkkkkkelllell,l,el<lD lllulllllllllmmmmpm<~m<mD~mTem\mh~mpemxmxmmmmmmmmnnnn(n,n<n@nLn`ndnlnnnnnnnnnnnnnnnnnoo ooo o(o,o0o<oDoDoLo\opo|oooooooomo'pnpp ppp$p(p,p0p4p8p<p@pHpHp\ptpp'ppypppppppqqqqq0q0 q8qL$qLpqT$qhqhqp qq qqq qqq qq#qqq#q.qfr.r2rbrr,rHrLrlrl rtrxr|rrrrrrrrrrrrrrrss~ss4{s<sDsX}sdsl2stsssssssoss}ttttt$t,t4|t8t<t@tLt`th}tptttxtittttttt}tttuiuu$u@uHuXududulu|uuuuiuu\uuAuuvvvivDvPivXv`v|vv1vcvvvvv vvvvwwww w0w8w@wLwTw\w`whw|wAwwwwwwzwwwwwwwx mx0'x@nxDxHxLxPx`xdxhxlxpxtxxx|xxxxxzxixxxx xyy yy,y, y4yH yHtyP yd ydtylyzzz z(z<zHzPz\zhzpKz|zzzz|zzzzzzzz~{{{(~{0}{<{D^{L{P{T{`{p{|{|{|{{{|{1{;{Y{{{||||| |$ |0|L$|`|`|l|l|t|x||||||||||||}|||||L||||} ~}}}$~}0}8}H"}X}}l5}l_}t}}}}}}}}}}}}}}}~~~g~$~$d~<~P~l~t~~~~~~~}~~~~~K~%~o~];Y ddk~ m$&,j4~DPK`hglld|| |(gDLTdx'xm $p$00 8HH Pdd l t  t  !s0DD L`` h|| 'mjjjj (a<'<mDHjLPjTXj\`jhp|~̹i S0 Pj\``~h lppkx||kk@|$$P `|s| @ T\]d.ppxsF(<DD\,b)mm4<T{d{p||g13a $$,LTT\\dl !d0me j$ 00u8Ttpu uhhNpnpxn,h, un,8Xlx 0o08D`ot|! n$E4HTp 0<H`dhlo"2E \ (1TfdlS ooHn$ (08&LTXhblpto:o$N0DPl$048\hb(o)  ,8Xlx o,00~8 <@@qH`` hS$ s08(LLTd$ps!sq(4Tht,, 4T`dhV$s$)k$8%DTrhhp8LhtxDp|&J  .0<"<rDd|\* <Plx|g(0 \ lt"|@0<@P\xg  08"@DH\h $4@DT`| ^ (@oPX1p|(48HTXht  ^ ((Todl1}(DLu`hx` ,,4P\hp xz0@Pl|x~~ |!s!s $,008@DHPT T\\dll t%|T|X DLt2|{  @Lh V  0<@HLPTXXd!dslxxu j4<L\fhxx|Y (,, 4X\`lppxd^ m$Va  (|88@DL2XY`pg(08 @HP`il||,~8Xt p,$#88@DHT\}`d}ptt~| {DPDJ~ t t t$ $t@ @t\ \tx xt t $)} $$~, 0H\ hbpx}~ 8LLTX\h|}~ t 44<@DPX|\`|lpp~x |%o||~ ~$|044~< @DD~LXh~||~ ~  (,0nD|DLP|\``~h l~~~~~   (,|<@@~H Ld~~4   ,0H\hpqY 0<@Xlxq |(<@DHPdpxY$$8LXt e,,@d| d   D\hhpd@Xddlb,8Thˆ ¤¬¼,,LbXhh|ÐÜø ,4DTf`ppĄĘĤ ,4DT~`ppńŘŤ~~ƄƘƘƴƴƼ $$ ,@,@hH\\lftLjǐ$ǠǠǰyǸw(r 00DqLDd4xx ȀȐȐȘȬȬȼ'dec q$88H!PFX``h||Ɉ ɔɘɜɤ7$8%8o@HXX`tʄʈʌʐʔXʜfʤ.ʤfʰ%U +$$8&@PPXhht|Lːːˠ<˰˰  ,4MDDTddt̴̤̤̄̄̔$4@T`pp̈́ͨʹy$,4yDP\ltt|RΌGΐΘΘΠδθQθC||  88@LPP|\j``{πϘϘϠϴ|Y ;( DL hpZЌ:ДXа<иW=^6]7$\@8H[d9lPшDѐQѰCѸ t  4@\hh҄ҜҨtҰ`B`4O E(NHFPap3xjӔ*ӜVӼ>U?uf,.4tP XppxԌԘԴ{,8TxՀ{Ո`դ0լMGLH   8DD`ր֤X֬0Ptu|ההלװ׼  8+@~XX`t؀؜بب~((0DPlxxٰٔg (44PlڈBڠڠ~ڨڼ (HPl!t ۈېkۤ۬xqz\608 P\\x܀܀ܘܤܤܴt]08[L  $(0@\\ dބ&ބnތޠޠި޴޴޼  3a,, 4@LP`dhltx߀ߐߘߜ߰߼u ~$ (s488~@ D XXccn44<dllt xxnnnuu 08DnLdlUCoEu$~( ,s8< <tD` ltP|eu io  8@HoPXopx|r,,4\ddl p prx r r r$<@u@\u` `rl r r r  ( (<P\dltx| $u(#8@DDLXo\ \ud hltut |:Z' ,e434a<L\\dte/e3(,",r4DuH X\``hp$x u $,:8@^T\Vdl_x-xg-N (D\dt 0DLT\hl(J$((0<7HLTi\~`dhptt~| ~~ i~~ i(H^\dlppx= (N08(Tijjs$048<LpPTp` (%(o08rH dlrt   (u8HiTddx    s( <D Ts\lt} 0HX\`ddl#tx|.f  0n4%4DnX`ddl*xxDU# }$8y@DHLPyTTy\``pp   "j 0y@L`yhlptxy||y  ,,@mT hypxGsZ$DX\\d8qD*Lg`h'x_,~8DPXhlt|4` Tdv  # (f,/0e4/8e`4dhlptx||$v   $$DXt`lt Hcf.  $(,,4HTTl$0D HThlltp $TT\lp)k4D H``hllts|M#5_5  (H Lddlpps$ 8lDX\h|$((@\ddlX($"(,048<LPXbl|%@  ,HLPTX`dhpt|o        $ < < T h l l t                (" T T \$ $ p       $ < @  D L P P l t     G ~  ~  * $ D d p x  @ % o       w , 0 0~ 8  < D D l pQ pC Q C M ~      $0dst  s   (DrD Lddlruu 0088PXrX lr r  ,4@HFX\\b0d1co050_8Pp|xx hy4@dHFpp x t ; d@ @tH`l 'i#q$$@Dd y  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_VAL.c $8~H`|4~HXX`ppxn~  (4<~HX7\hhp^ 4@PX\`dlltxx-gu~~ ( H\qp3x~~~ 0L`` $<Xp4@@PPX`t/QO  (D\x%$%<D<PM\X!     $ 0 0  H P hq   (         !!!,r!D!D!Pj!P#!Xq!`!h!x! !! !*!"!r!!! ! U /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeEXPR_parser.csys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hEXPR.yEXPR.tab.c!! !(!!+!!!"q"!"" ""$"$"$","01"4c"81"@c"@1"H"P"P"X"\"p"t"t"|"""""""" """""'"""##### #8#<#T#T#\9#h#l#l~#t#####G####ԃ##$$ %$$ $$m$($,$,$4$8$8 $H$H $P$T$X$X$`$$d$d$l$$|$$$$ $$u$$$ $$$t$$#%q%#%r% %% %$%( %(%@%@%H%X}%`%l%x%%u% %x%%& &  && &&("&0&4&4 &<#&< &D&H&H&P&X&l&p&t&x&u&&B&R&&&*&j&*&''''0'<'@I'HN'd'''''''(( (_(C(((((Lq(`(t((S((((  (}(y(F(F) )),)T)\@)h\)-)*b*$(*p*q*#*l+((+4g+l-+x  +u+d++u++++7, d,$,$u,4,4u,H,Hu,P,,,,,,,  ,u--- ----0-<-@-H-L-T-X-t ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_EXEC.c-tC-x---------u-... %.$.0.4.8.L.`.h.p.x......u...'./ /(/8/H/X/l////////o/00 )0$0004080L0`0h0p0x0000000r111  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_check.c1-11$1$ 1,1<1<1D1H1H1`1d1l1l1t11111 11 11 111 11 111!1 11222(2@R2@B2HU2L2\2\2d2h2h222222 22222222222 2222333333$3(>3034383D3L3N33333M333333344 4 4 !4$4,444\4t4O4444444 444444 44555 55(5T5t55p5$555555O556 666666 6$6(6(686D6H6L6L6T6T6\6`6d6h6l6t6|656666666 666677 7 7778787T7T7\7p7p777777!7X7728[8 8 8(180,8<Z8D8P78\\8p8x$88888888"8u889999(98989T9T9\9x999999999: :-: d:0:0:8:L:L:h:h:::::::q:::':t:#:q:;;;,;,;4;H;T;d;d;;;;;;;;;;;;<<<<<8<8<@>> > >(>D>\  /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysiso/time_iso.hmachtypes.hint_types.htypes.htime_impl.htime.hselect.htime.hFMdate.c>\ >`>l!>7>a>}>>}>>?&?n?$?,?0?4?<?T?\?\?d?h?l?p??????m??}??#????h?"@}@@@8'@8m@@@H@L@P@X@h@h@t@|@|@@@@@@@@@@l@@}@@}@@AA AAAA A,A<~ATATAt'AtmA|AAAAAAAAAAAAAAAABlBB~B B~B, B4BBLBLBlBlBBB(BlBBBBBBBBBBBCCCCC4C8C<kC@C@~CHCP~Ch CpCCCC'CmCCCCCCCCCCCDD DDD0D4D8lD<D<~DDDL~Dd Dl'D D#DDDDDDDE)EkE$E,E0E4E<ETE\E\EdElVEEEEE~EE~ETEEEEEEEFFF0*F0jF8F@FDFHFPFhFpFpFxF|FFFFFFFFFFFG)GkG$G,G0G4G<GTG\G\GdGp G$GGGGGGG'GmGGGGGGGGGG HUHHHHII II$I8I@IHIPIXI`IhItI|uIIIIIIIIIIIIIIIIIIIIIJJJ,  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_AVL.cJ,SJ0J8J8J@JLJ\9J\[JdJlJlJt0JxJ6JEJJJ$JpJJJJJJKYK;KNK KKKKK K$K(K,K0K4K8K@K@KTKTK\K`ZKhiKpKpKx/K|KWK8KlKKK$KpKKKKKKLL^LLLLL hL(L4L<LLLTXL\LdLpLxrL|LL<LL6LLL LLLqLLLLsLLLLLLLM`M4M MM>MVM$M86M<M<MD8ML`M\MdMpMxM|M|MMMMMMM~MM~MMMMMNNNNNNN${N,N8N@N@NHNPN`NlNxNNNN&NNNNNNNNNNOO~OO ~O O(~O,O0O4O8O<sO@ODOHOLOPOT$OXO`O`OtOtO|OO~OOhOOOOO:OOOPPhP PPPP$9P(P0~P4P4 P<PPPXgP\P`PdPhPlPpPtPxP|PPPPPPP4PPPPPPPPPQQQQQ(Q( Q0Q8Q@QT QXQ\Q`QhQlQlQtaQ|QQQ2QaQQQQQQQQQR R RR(RD_RHR\AR`R`RhaRpRpRxtR!R.RZRR<RaRrR/R RSSS S(S<SX~S\ShShSpStSxSxSaSSS~SSSS SSSSSaSSST .T~TTrT T$T8TDTLTT~TTT\TpTT{ ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TOOLS.cT,TTTTTTTTTTTTUUU$U0 UH4ULUTUXUhUtjUt*UjUUUUUUUU,UVVV VVV0!V@VTVXV`Vh VpVp VjV VVVVVVDVVVVVXV<VWqW0W<W<WDWT'WdWd WlWpkWxW|WWWWW'WWWWWJXjX*X0jX XtXX,XXXXXXX!XY YY aY Y8 Y8tYH3YPYP Yh9Y|YYHYtY YtYY ../WebX/include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hX_heap.cY6YYY YYYY YZZZ$Z8sZDZLZXZ`Zl!ZpZ|ZZZZBZRZZZ)ZkZZ ZZZZZZZZZZ [k[[[g[ [$h[([(g[0[8[<[@[D[H[P[T[T[\[l[t5[[[[[[[[D[[[[[[\\t\(\0d\PA\\\h6\l\x\x\\\\\\\\\\\\\\\\\q]7] ]]] ]8]D]\]l]p]x]]]] ]  ../WebX/include/apps/mysql-3.23/include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hmysql.hmysql_com.hlibmySQL.c]]]]]]]]]] ]<]_]u^E^^o^,^p^p ^x^|^^^^^T^5^^^^__,_,_<_h_h _p_b__c__c_______k__u_``i``H`P`T`\`h`````V``aaaaa,a0a8 aHaPaPaXa\a\adataxaaaaaaaaaaaaapa$aabbbbbbb0b\bbbbbbbbb!bsb!bsb!bbbccc-cgccc(*cHcTccc~cKccc"cccc3cccYcd d1dcd 1d$@d(d@dHdHdPdTd`]ddddde,e@eLedepte.e eeeeeeee eefffff kf(f,Yf,f4fDf`fpfpffffffffDfPg g(Jg0g@gHgP,g`@gh*ghjgx`gJg gg ggJgJgJgJgBgRgBhh,Ph0h`h|hhhhh^ ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibpost.ch-hhhhhhiii i(i(i0i8i8i@iiiiiiiiiiiuiiui#iqijjjj0 j4j8j<jD jLjTsjlj|jC ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibEpost.cj8jjjjjjjjjjjjkk kkk k4kq,qrrrrr,r,r4r@r@rHrLrPrXr\rdrt r$rrrrr*rjr,rrrsss s sss$s0s0s@sDsH sHsPusXsXsd#slspsxSssss sssssssssssstt ttqtt,@ /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hutil.ct,.t0t4t8tDtltxtttttttttttttttuu uu(su0u4u8u<u@uDuHuHuPu`ulup utuuuuuuuuu uuuvvvv vHvTvXvxvvov%vov%vrvv#vlv#www w@wtwxw"wtww www w"wwwwwwx x(x,x4x8xLx\xdxdxlxxxxxxxxxxxxxxyyy$y0y4yPydyxyyyyryyyyyyy"z oz)z@zHzL zh#zlzzu- /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_PATT.czzzzzz~zzzzzzzz{{{ {({,{0{4{4{@~{P{X~{`F{`N{h>{x{x { {{:{Z{:{%{{{{{{{{{F{N{{{{||n|||| | |(|0|0|8|@|@|H|X|X|`|p|p|x||'||||||||||}}}}%}$}(}0}4}<k}P}T}\)}d}h}pN}}}}}}}Q}}}}}}}}}6}}}}j}~~~~y~$~0~T~h~h+~t~|]~~0~m~~~~~%~u~~DDLTT\)k)c*j ,,488@HH`htt|u /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_CMP.c2'm',,488@@HT | ILD -  IIL - I - JH -  |  N | N, - P -  | Q`< -  | $R - $SH - $UXl -  | X - YxD - YD - ZH - ZH - [8 - a - a - bdX - b - cl - dt - fp - gl\ -  g0g\ - hT - i - k4` - m - n(X - nx - nx -  op o|4 - p -  Td - , -  - ( - , - ( -  -  -  - \ - p - ( -  -  -  -  - \$ -  - ` - , -  -  -  -  -  -  -  - d - L - T - T - X - T - D -  - t -   -  -  - h - 0 - HH -  -    - @H -  -  - , - $ - 8h - L -   -  |  ` -  X -   -  $ -  |  ! !  -  -t -  |  -t -  .  -  ., -  0  -  |  p1h p1 -  p2 -  p3h -  p4 h -  p4\ -  p5 -  p6, -  p9 -  p; -  |  >\  -  HT -  I8d -  I -  |  J, -  L -  P -  QT -  RD -  SX< -  |  T UH -  V -  | Y - Zl - \h - ] -  | ]D - ^ - ` - a - cp - h, -  | Th -  | j, - jT - k -  | q - r -  | ,t,d - ,tt -  ,vP,vT - ,w -  ,w`,x(P - ,xx -  ,y0T,y - ,zh( -  | Lz0 - Lz\ - L~l - L  -  |  -  X_header ,X_avlcmp X_start wmain eTrace yX_INSERT_ID ent Debug Cookie X_eof X_fpX_BASEX_BASE_hold5X_PAGEJX_ERROR`X_HOMEuTMP_DIRX_ERRMSGDIRx_BUFFERS_X_action#=*X_envX_exitLERRMSG2g iPrintTM X_debug X_trace#$_u X_search_command /lowercase nuppercase X_fflush X_fgetsX_quitX_clear_valueoX_put_valueX_add_valueX_get_valueX_free_allCX_free_cidHTML_string}X_putchartransvalueGetDDTOdate_YEARdate_MONTHYdate_DAYX_get_baseKX_cryptX_transvalue(X_printvalue(mX_transline)X_shmdt+ZX_shmat.)X_io_fseek/9X_io_vfputs0rX_io_fputs1gX_io_fgets2xX_io_pclose3IX_io_fclose4X_io_popen5X_io_fopen6X_return7X_exec8JX_replace9X_fork:X_cookie;X_clear=X_unlink>X_error>X_letCdX_addDJX_setEX_shellFX_sqlnamesGX_chdirHX_usleepIX_sleepJ,X_sqltrapKKX_htmlLX_compileLrX_optionNpX_trans_printfileNX_includeOmX_commandVX_printfileY`X_notfoundZYX_call\X_signal]^X_error_cid]X_get_cid`xX_sqlexecaYX_functionbX_while_valuescX_while_wordselX_while_loopeX_whilegX_foundiX_sqlkX_xFilemX_FilenBX_ifsX_stdoutR9X_default_names )X_check_name yX_values X_set_cookiesXXyyerrorgyyparseEXPR_parseryycharyylvalyynerrs?bX_exec_callstrcut]chcharStrLen =X_get_int#X_check_floatzX_check_date"X_check_intjX_todayX_CMPexecX_CMPpattX_user_cmpEX_user_icmpX_user_fcmp8 X_date_info uX_dt2str X_str2dt; oAVL_searchAVL_removeAVL_insertFԆsX_take_stringX_arg_string2X_arg_string_sepPX_heap_newUX_heap_allocX_heap_free)X_heap_reducekܜ} X_noselect_sqlX_finishX_databaseX_select_sql^sql_errorX_rowcount. POST_parserPOST_errmsgE9CheckEnctypeMethodGGetMethodE_POST_parser*8GET_pathGET_parser&bmakeword]fmakewordpx2cunescape_urlescape_urlQplustospacerindgetlineYindescape_shell_cmdGETenvOdim_FREEpattdim_LOADpattdim_ORpatt#dim_EXEpatt vp_SYMcmpILN=N,4Q`<gR($_X49 ! -t1 @>\ J, hԆT,Yܜ] 0h9j`8qD&t,dzT4x4Plx(4 h $@(<lP00L<8 0 l l4TXL"l"!!x)*<$P$`x**<$P$`($(8081P'H(p(8181P( (,$0   <  $`$t!!$t$!!$t$!"l$$""l$$""%%""%%#$(p('',%&$H$P//X.8.$%()%X%)X)()T%X%)d)((&8'((+++,4,T,d..,,,,---..8.//X/081P1x2 2055`3P4303@2H33`3505D6D667<88:4:t89,:t;89:$:::;8>X>x?@$PPRRV$WHWdWV<VWdWVVWW4VVWW$Z$Z,bb$` `lZ|Z]L]tZZZZ]L]tZZZZZZZZ__^x^ZZ\,\^ ^4\L\l^ ^4\\^4^\\]L\]^4^\]^ __]]__^^__^^^^^^__`a$_(_,aa$_0_L_(_,_0_<_`_|`a``bb$``4````$``a$aHahaaapq,spt0rrr,rPvw$w@xy<ty<y{|4|4| }~Xt~XXt|L<XL<Xt <T`hXdd\`h`dd\`ht`ddp0tt@``p(@,4H0< $<xdt<Lt (<X<L<L,dt|$8D L`dX\HLDpthlX0XXlx|HT<LT`XxLp T,0D@0D<DX0dx X P p X h X  4 0 pp (,8`(4@\Ll000L D(tLpl|<p|L |( (| HP|pxTd0p $<p $ $ H d ` T d `  ( 0 ` \$ @\`Pdt$`hdXT|dX 8pxX_add_valueERRMSGX_headerunsigned intunsigned intunsigned intunsigned intPrintTMunsigned intgetpidX_notfoundX_io_popenX_heap_reducenextX_cookieX_debugX_io_fgetsX_io_pcloseX_io_fputsfoundX_io_vfputsignoreX_select_sqlX_transvaluevaluebuffoffsetERRMSGdate_MONTHcompileX_sqlexecX_callX_io_fopentransvalueX_returnstatusX_unlinkX_free_allX_functionX_io_fseeksizeX_arg_string_sepX_arg_stringX_free_cidsql_errorX_heap_freeX_io_fcloseX_translinedate_YEARnameunsigned intX_user_cmpX_includeX_replaceX_traceX_while_loopX_while_wordsdate_DAYX_exitX_while_valuesX_printfileX_tracefnameX_arg_stringX_check_nameescape_urlunsigned intX_default_namesERRMSGX_debugX_put_valueyynewbytesunsigned intyyerrorX_traceX_arg_stringunsigned intX_get_valueX_CMPexecdim_EXEpattunsigned intERRMSGX_tracesprintfsscanfstrcpystrncmpdatebuffformatdatestrmodeunsigned intright_subtreeX_traceleft_subtreeunsigned intunsigned intX_traceunsigned intERRMSGmallocX_tracemallocfield_allocfieldscompressunix_socketclient_flagunsigned intfield_countunsigned intunsigned intunsigned intPATT_LISTunsigned intpatterncurr_pattunsigned intP dx+dxK<Z̀`Ҁ"Ga|րG[ełEDe 3 ł v  $ : OB fC {D E F H ҀI O R  Mu &9 $}x @| @| $ d`P d`+d`K<Z̀`Ҁ"Ga|րG[ełEDe 3 ł v  $ : OB fC {D E F H ҀI O R  Mu &: $` @ @ $ dtO dt+dtK<Z̀`Ҁ"Ga|րG[ełEDe 3 ł v  $ : OB fC {D E F H ҀI O R  Mu $t @ @ $ dT.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.stab.shstrtab.stabstrlibgcc2.c/dr1/my/gnu/src/egcs-build/gcc/../../egcs-1.0.3a/gcc/libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.h../../egcs-1.0.3a/gcc/config/sparc/xm-sol2.h../../egcs-1.0.3a/gcc/config/sparc/xm-sysv4.htm.h../../egcs-1.0.3a/gcc/config/sparc/sol2.h../../egcs-1.0.3a/gcc/config/sparc/sysv4.h../../egcs-1.0.3a/gcc/config/sparc/sparc.hcmodel:T(7,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(7,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(7,3)=s16string:(7,4)=*(0,2),0,32;name:(7,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(7,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(7,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;../../egcs-1.0.3a/gcc/config/svr4.h../../egcs-1.0.3a/gcc/config/xm-svr4.h../../egcs-1.0.3a/gcc/machmode.h../../egcs-1.0.3a/gcc/gansidecl.h../../egcs-1.0.3a/gcc/machmode.defmachine_mode:T(10,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T(10,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;../../egcs-1.0.3a/gcc/defaults.hinclude/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;../../egcs-1.0.3a/gcc/longlong.h__clz_tab:S(0,32)=ar(0,1);0;-1;(0,20)__divdi3:F(0,23)u:P(0,23)v:P(0,23)libgcc2.c/dr1/my/gnu/src/egcs-build/gcc/../../egcs-1.0.3a/gcc/libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.h../../egcs-1.0.3a/gcc/config/sparc/xm-sol2.h../../egcs-1.0.3a/gcc/config/sparc/xm-sysv4.htm.h../../egcs-1.0.3a/gcc/config/sparc/sol2.h../../egcs-1.0.3a/gcc/config/sparc/sysv4.h../../egcs-1.0.3a/gcc/config/sparc/sparc.hcmodel:T(7,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(7,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(7,3)=s16string:(7,4)=*(0,2),0,32;name:(7,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(7,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(7,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;../../egcs-1.0.3a/gcc/config/svr4.h../../egcs-1.0.3a/gcc/config/xm-svr4.h../../egcs-1.0.3a/gcc/machmode.h../../egcs-1.0.3a/gcc/gansidecl.h../../egcs-1.0.3a/gcc/machmode.defmachine_mode:T(10,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T(10,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;../../egcs-1.0.3a/gcc/defaults.hinclude/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;../../egcs-1.0.3a/gcc/longlong.h__clz_tab:S(0,32)=ar(0,1);0;-1;(0,20)__moddi3:F(0,23)u:P(0,23)v:P(0,23)libgcc2.c/dr1/my/gnu/src/egcs-build/gcc/../../egcs-1.0.3a/gcc/libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.h../../egcs-1.0.3a/gcc/config/sparc/xm-sol2.h../../egcs-1.0.3a/gcc/config/sparc/xm-sysv4.htm.h../../egcs-1.0.3a/gcc/config/sparc/sol2.h../../egcs-1.0.3a/gcc/config/sparc/sysv4.h../../egcs-1.0.3a/gcc/config/sparc/sparc.hcmodel:T(7,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(7,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(7,3)=s16string:(7,4)=*(0,2),0,32;name:(7,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(7,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(7,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;../../egcs-1.0.3a/gcc/config/svr4.h../../egcs-1.0.3a/gcc/config/xm-svr4.h../../egcs-1.0.3a/gcc/machmode.h../../egcs-1.0.3a/gcc/gansidecl.h../../egcs-1.0.3a/gcc/machmode.defmachine_mode:T(10,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T(10,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;../../egcs-1.0.3a/gcc/defaults.hinclude/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;../../egcs-1.0.3a/gcc/longlong.h__muldi3:F(0,23)u:P(0,23)v:P(0,23) ( ". . koAA-BB B $  7BB0B0$ ABBTBT4 KGG,QW]C2;;0F<<h eAAnB`B`tTT{TTT$T$TTTT<TTT/ pRh#P P % X$ + &>5'Z#07070100007765000081ed0000000000000000000000014b9fcb3b000b0e84000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/WebX.mySQL5ELF4 4 (#"440000p/usr/lib/ld.so.1  !"$&()*,-0135689:<?@ABEGHIJKMNPQRSVWYZ[]^`bdeghikmnoqrstvwy{~     &)*+,012456789:;<=?BFGHILMNQRUXYZ[\^_cefhjklmnpuwxyz|}~    "#$%&()+,-/35789:;<=@ABEHJKOQRSTUWXY[\]_`acdefikloprtuvwxyz{~    !"$%&'),-/03467;<>?@ADFGIJKLMNORSTVWYZ\]^_`abcdfgjlmqrstvxz|~ #%'+./247;=>CDFLOTUX\_acfjlpuxz|} !"#$%'(-./3>@ACDEJKOPSTVW]`abdgioqrstv{  !'*.01246>?CDFGILMNPVZ^bghjmnqs|}  #(*+.12589:=BCEHPQUX[ehiknopuwy{}D h {t +2>G<H Lp at x4}Z $ T xD B  V- P H 4p @X Q d    H  @ )hPp 4  M ^( hbp wTl L P L $    d T P $ 8   20 H eT4h m F  d| H   ~ 1  ,\ @8 /H JO S `Pd8 qP0 R< VL L $X   ɴӄ Äl fp # * -B R _ k|x v0P D  oP $ Ɉ U$ ; X  ( '-|0 : R | ^p pp |(  p  ʠ` l BD  2 }  * 3 <2Ua(y /~t$  o *D 18 p (}  4:GTh \0ln {`  h :`L  ph    4d  +~ 7( @\< G RBDH \$ltd Ɉ F  K$P   D \,Tt - 8߈D Pe al{x( H   l g  oX  ̴l || Pl@N /!Vz X e X,X i  ( j`8 p <  DͼD -| l X ` l@<( M(\Ux td Ո0 /TL p  3H     t,  H  "ZX -T > M@V, 8a nW< |(D  W \ 0 D =   ; h  < -Ԍ 6p IP ]b=, tlx d ʔT 8P   @&L 0p A\ Rd gmw0l{( (  o,T(x  x  .I 6?LD ]; v: G  tlK `% F0 l ' 43t ? G},< S i opwH,   \P [ i <4< s}hx  ~@4 ψ(: K0 MtVmd c( ul, | }` lŐl   @ oH  x4  2<HD Wl ^(wH ,   ~D Jp % < rL   \   )}, @ "ZD 4lT<` b  o_@h ŀlXl X` ƄdL T X T .P 7<( FPYg sx  P kP: p 0  ) P Ct   - >Dl P@ arXl k[8 \ XL  -   ( T   ! (t !l  !| !1 <!;8 !Tgh !h8!r8 !H!! !!fp !Ĉ![@ !h !_| "  "G( "/"6$ "?h "KD "U"a` "z H" "\ "|8 "l"P "4p "֔   #> #d #( #7h H 8#D[0 #R #bHl #ph # V#X #\  8#h8 # #\\ #d #p  #LT $  $x $+< $<ɤx $Q$] $i$ $p¬l$ $ $8$$S $x$ $x< $d` % ĜP %  %8d %# o%(0%4%=8 %T@%n8 %x 0%`X % %֬( %` %t %% 4 T %%% /&l&p &/ 9 $ &; &R L&g&s@ &x4 %d & 1,L` 1<\8 1K;L 1\1h1p A1|e| 1Kt 11È10\ 114< 1d1h 1p12@2 \2*H2GP 1w` 2Y6 TŴ 2`{xL 2o` 2| 2bP  2H 2  2x 1 2HD 2 2T( 2=H 3`3 ,~3 3+߸ 3; o3Gl 3Sv 3f 3o3v set_dynamicmy_system_gmt_secEXPR_parserstrcmppage023dataX_while_wordsmysql_stmt_insert_idmysql_sha1_resultlist_freemy_messagemy_numchars_mbmy_caseup_str_8bitto_uni_latin1_german1_cimy_errnounknown_sqlstateX_printfilemysql_sha1_inputdirectory_file_namemy_strtoll10.umul__clz_tabvp_SYMcmpmy_is_symlinkmysql_get_character_set_infoX_sleepX_free_allget_charset_namemysql_field_tellmy_multi_mallocmy_strnxfrmlen_simpleTIME_to_ulonglong_timemysql_stmt_num_rowsdefault_client_charset_infosf_malloc_quickmysql_stmt_bind_paraminit_compiled_charsetsmy_fclosenot_error_sqlstatemy_collation_8bit_simple_ci_handler_Q_qtoifreeze_sizepage014datapage00Ddatactype_latin1_general_csmy_time_to_strdim_EXEpattmysql_disable_rpl_parsemy_uncompressload_defaultsgetrusagemy_charset_binX_error_cidX_io_fseekmy_charset_utf8_turkish_uca_cimktimepage030data__muldi3X_envX_eofX_startmy_endstrcpymysql_set_master_Q_mulX_rowcountisnanmysql_disable_reads_from_masterX_foundmy_charset_utf8_handlermysql_refreshmy_compress_allocmy_defaults_extra_filestrcendmy_have_got_alarmmemcmpX_replacemy_file_openedyynerrsmysql_shutdownX_io_fgetsmysql_stmt_execute.uremmy_casedn_8bitdim_FREEpattmy_strtodmy_closefree_rootmy_xml_parsepage009datastrncpyX_exec_callmysql_add_slavecli_advanced_commandmysql_stmt_param_metadatamysql_rpl_query_typeX_finishmysql_infomy_snprintfpage02EdataE_POST_parserX_signalmy_charset_utf8_lithuanian_uca_cimy_file_infointern_filenamectype_latin1_general_cimy_well_formed_len_8bitmy_sync_dirX_includemysql_free_resultstrxmovmysql_set_local_infile_defaultfind_typemy_snprintf_8bit__flsbufnet_field_length_llmysql_get_server_versionX_databasegetenvfreadmy_printf_errormy_numchars_8bitmy_initpage0A3dataX_io_popencs_to_unimy_strndupX_heap_newX_functionmysql_queryvio_endescape_shell_cmdvio_descriptionmy_atofstrncmpget_charset_by_csnamehas_path__iobmemcpyX_set_cookiespage000datamysql_read_query_resultGetDDTstrcutmy_connectmysql_stmt_attr_getmy_mb_wc_8bitmysql_portpage01Fdatapage026datacombo1mapmysql_autocommitsort_order_latin1_spanish_cimysql_stmt_row_tellescape_string_for_mysqlvio_writemy_error_unregister_allmy_mallocmy_fopenX_search_commandmy_net_set_read_timeoutmysql_stmt_field_countX_fgetsmysql_get_client_infomy_load_pathset_prealloc_rootsf_malloc_endhuncsql_protocol_names_libcli_read_binary_rows_finiescape_quotes_for_mysqlmy_like_range_simplemy_numcells_mbvio_peer_addrresolve_collationsscanffstat64globerrsmysql_stmt_fetchget_collation_numberpage0FEdatamysql_more_resultsint2strpage005data.divX_io_fclosemysql_read_default_optionsto_upper_latin1_german1_cimysql_stmt_resetmysql_closeget_defaults_optionsmemsetmy_net_readTMP_DIRX_arg_string_sepX_compilepage021dataTraceX_free_cidtouppermax_allowed_packetinsert_dynamicmy_charset_latin1_binmy_wildcmp_mbX_transvaluemy_symlinkfputcCookienet_buffer_lengthmy_rndmysql_data_seekmy_strdupmysql_get_parametersmy_casedn_str_mbX_htmlmysql_sqlstatemy_reallocsf_malloc_rootmy_defaults_group_suffixmysql_field_seekcombo2mapunpack_dirnameX_tracemysql_stmt_preparemy_fstatX_io_fputsmysql_master_query__ftoullmysql_server_initmysql_row_seekmy_strntol_8bitX_date_infomy_no_flags_free__cmpdi2mysql_character_set_name_GLOBAL_OFFSET_TABLE_my_default_record_cache_sizeX_xFilecli_read_change_user_resultnet_clear_errorvio_blockingmainpage022datamysql_thread_idmysql_set_character_setmy_disable_symlinksbcmpmy_collation_8bit_bin_handlerX_errormy_lengthsp_8bitmysql_stmt_result_metadatagetpwuid_my_sig_remembermy_scan_8bitfree_defaultsunpack_fieldsX_Filebchangedate_YEARstrlenmy_abort_hookmy_dont_interruptmysql_slave_querymy_charset_utf8_icelandic_uca_cimy_charpos_8bitmysql_real_connectStrLenmysql_server_last_errormysql_reconnectunescape_urlmysql_debugdate_MONTHget_dynamicmysql_fetch_fieldX_BASEHTML_stringX_unlinkvfprintf_lib_versionpage017dataX_shmatmy_openmy_xml_parser_freeinit_glob_errsmysys_usage_idmy_strnncoll_simplefcntlmy_once_free__deregister_frame_infomy_instr_mbTIME_to_ulonglongmemdup_rootX_shmdtX_HOMEmy_charset_is_ascii_basedmy_charset_utf8_roman_uca_ciX_stdoutnet_field_lengthmy_disable_flush_key_blocksmysql_unix_portmysql_num_rowsmy_unicase_defaultcurr_dirvio_typeto_uni_latin1_general_cipage0A1datactype_latin1_spanish_cimysql_server_last_errnolist_lengthcheck_time_rangestrdup_rootto_uni_latin1_general_csrandommy_charset_is_8bit_pure_asciimysql_stmt_fetch_columnmysql_rpl_parse_enabledmysql_errnosrandgettimeofdaymy_uni_ctypeX_todaymy_charset_latin1longlong2strendpwentmy_statnet_clearvio_fastsendisdigitto_uni_latin1_danish_ciX_chdirmy_longlong10_to_str_8bitDebugstr_to_datetimeX_shellX_dt2strX_io_pclosefwritePrintTMset_mysql_errorGETenvX_ERRMSGGET_parserX_sqlexecgethostbyname_rmy_well_formed_len_mbfind_type_or_exitfopen64__dtollX_while_valuesmake_password_from_saltpage0A2dataX_str2dtX_debugmy_collation_any_uca_handlersf_min_adressstrstrmy_strnxfrm_simplecalc_daynrpage013datapage00Cdatamysql_real_query_PROCEDURE_LINKAGE_TABLE_mysql_fetch_rowpage04DdataX_fflushmy_net_init__umoddi3page029datamy_getwdX_PAGEfatal_error_handler_hookclient_errorsmy_strcasecmp_8bitdim_ORpattvio_newmy_charset_utf8_hungarian_uca_cimy_umask_dir_environmy_once_strdupmy_collation_mb_bin_handlermysql_embeddedmulti_alloc_rootmy_date_to_strmy_TIME_to_strsf_malloc_countmy_casedn_str_8bitmysql_stmt_bind_resultX_io_fopenvio_deletecli_list_fieldsmy_charset_utf8_esperanto_uca_cimysql_commitmemmovemysql_enable_reads_from_masterX_heap_freepage0FDdata_etextcli_unbuffered_fetchyyerrorpage004datato_lower_latin1_german1_cimysql_field_count_Q_qtollX_execX_putcharstrnlenset_stmt_errorgetlinemysql_initmysql_hex_stringpage020datamy_readlinkX_user_cmpint10_to_strcli_read_rowsstrmakedays_in_monthmysql_killsort_order_latin1_general_csmy_dirvio_timeoutGET_path_Jv_RegisterClassesmy_xml_error_stringX_get_intX_forkyylvalmysql_reads_from_master_enabledmysql_fetch_fieldsmy_strtoll10_8bitX_exitmysql_next_resultmy_charset_utf8_unicode_cinet_reallocpage0F9datafmakewordmake_typemy_time_to_wait_for_locksort_order_latin1_general_cimysql_fetch_field_directsort_order_latin1_danish_cimy_fdopenmy_strcasecmp_mbmy_hash_sort_binmy_message_no_curses.udivinet_addr_Q_stoqmy_charset_utf8_persian_uca_cipage025datapage01Edatato_lower_latin1_spanish_cimy_prognameset_zero_timex_BUFFERSsystemmy_init_timemy_pipe_sig_handlermy_stream_openedX_whilegetpwnam__dso_handlevio_should_retrymy_xml_set_value_handlermysql_stmt_row_seekmake_password_from_salt_323my_charset_utf8_slovak_uca_cifinish_client_errs_dig_vec_lowermy_numcells_8bitfree_rowsmy_charset_utf8_spanish_uca_cishmgetmy_vsnprintfX_notfoundnet_endlist_deletemysql_get_server_info_edataaccessmake_scrambled_passwordstr_to_timedefault_charset_info_Q_divmysql_stmt_attr_set__dtoullX_valuesmy_xml_error_linenoX_actionlist_reversepage00Fdatapage016datato_upper_latin1_spanish_ciyear_2000_handlinggetloginstrmake_rootmy_mbcharlen_8bitmy_charset_utf8_polish_uca_cimy_inet_ntoavio_read_bufflist_consmy_charset_utf8_czech_uca_citest_if_hard_pathX_cookieatoiatolsha_const_keyX_quitstrtolX_cryptmy_hash_sort_simplereaddir64page0A0datadelete_dynamicstrendto_uni_latin1_spanish_cimysql_eofmy_caseup_8bit__moddi3X_heap_reducelist_walkget_salt_from_passwordpage00Adatapage011datafn_formatmy_qsortstr2intmy_net_writechcharmy_wildcmp_unicodemy_error_registermy_charset_utf8_spanish2_uca_civio_poll_readX_check_datemysql_detach_stmt_listmy_charset_utf8_general_cilstat64my_charset_8bit_handlersf_malloc_prehuncnet_flushmy_unicase_turkishset_stmt_errmsgmysql_stmt_param_countfinitemy_strntod_8bitX_optionmysql_rollbackuni_to_csclosedirmy_file_limitpage00Bdatapage012datamy_hash_sort_8bit_binsocketX_printvaluepage028datavsprintf_Q_addmysql_stmt_data_seekmysql_list_dbsPOST_errmsgfloorX_user_icmprindcheck_scramble_323timed_mutexesget_charsets_dirlonglong10_to_strcli_stmt_executestrlengthmysql_get_ssl_ciphermy_strntoul_8bitmysql_set_server_optionmy_caseup_str_mbyycharX_setvio_was_interruptedTIME_to_ulonglong_datemysql_affected_rowsmy_charpos_mbX_get_basemysql_list_fieldsX_CMPpattmy_net_set_write_timeoutreset_root_defaultslocaltimeX_select_sqlctype_latin1_german1_cimy_thread_stack_sizepage007datainit_alloc_rootuca_weightmysql_init_character_set__floatdidfnormalize_dirnamemysql_stmt_initcreate_random_string_Q_submy_setwdX_check_intuppercasepage033datamysql_stmt_affected_rowssf_malloc_max_memorymysql_set_local_infile_handlermysql_sha1_resetlist_addmy_charset_filenameAVL_searchcli_read_prepare_resultmysql_change_userhash_passwordvio_readX_noselect_sqlmy_caseup_mbmysql_ssl_setvio_is_blockingcli_safe_readmy_propagate_simplecant_connect_sqlstateis_prefixX_CMPexecmy_mb_ctype_8bitget_charset_numbervio_keepalivemysql_send_queryyyparseGetMethodmysql_get_host_infohandle_local_infilemysql_stmt_errormy_parse_charset_xmlpage01Ddatapage024datastrmovmy_charset_utf8_romanian_uca_civio_fdget_charsetto_upper_latin1_general_cipollmy_register_filenamemy_instr_simpleget_index_dynamicX_default_namesx2cX_sqlnamesunpackfrmX_fplocaltime_rmy_umaskmy_hash_sort_latin1_deto_lower_latin1_danish_cimy_direndmysys_uses_cursesmy_net_local_initmy_syncmy_strntoull_8bitX_translineprint_defaultsputenvmy_disable_lockinggetcwdpage0FCdataerrbuffmy_charset_utf8_binmy_propagate_complexpage003datamy_print_default_filessf_malloc_cur_memorypage019datamysql_dump_debug_infomy_once_allocmysql_stmt_errno_dig_vec_upperto_upper_latin1_general_csinit_dynamic_array2mysql_num_fieldslog_10_intbmove_uppX_clearmy_long10_to_str_8bitmysql_pingX_get_valueX_iffree_charsetsmy_init_donemysql_list_tablesdirname_lengthmysql_stmt_send_long_datastrnmovX_io_vfputsmy_charset_utf8_slovenian_uca_cinet_real_writeX_letmy_xml_parser_createcheck_scrambleCheckEnctypeMethodsf_max_adressadd_compiled_collationfind_typesetmysql_stmt_free_resultpage010datamysql_get_proto_infomy_charset_samemy_disable_async_iomysql_statftelldate_DAYpage02Fdatato_upper_latin1_danish_cimy_filenameX_returnX_avlcmpmysql_use_resultgeteuid__udivdi3vio_closenet_write_commandnet_store_length_my_signalsmy_like_range_mb__floatdisfall_charsetsmy_error_unregisterX_arg_stringX_usleepfree_old_querypage0A4dataX_sqlmysql_list_processesallocate_dynamiccli_read_statisticsmy_xml_set_enter_handlerstrcat.remmysql_thread_endmy_charset_utf8_latvian_uca_cimy_strnncollsp_simpleX_addvio_in_addrpage015datapage00Edatalowercaseto_lower_latin1_general_cipage031datapage02Adatavio_errnosoundex_mapX_trans_printfilemy_errorX_user_fcmpsql_protocol_typelibmysql_server_endfgetcmy_file_info_defaultpl00init_dynamic_arraypl01pl02mysql_stmt_store_resultmy_tmp_file_createdmysql_stmt_closemy_sync_dir_by_filedim_LOADpattmy_charset_utf8_estonian_uca_cimy_mb_ctype_mbtolowerresolve_charsetX_put_valueTIME_to_ulonglong_datetimepop_dynamicpage0FFdatamy_file_total_openedmy_memduppage006datamysql_real_escape_stringmy_xml_set_user_dataoctet2hexX_check_floatmy_strntoull10rnd_8bitgetservbynamemy_readcopy_typelibdelete_dynamic_elementto_lower_latin1_general_csmy_use_symdirpage032datapage02BdataX_check_namepl20mysql_stmt_sqlstatepl21dirname_partAVL_removestrtoulplustospacemy_xml_set_leave_handlermy_once_extramysql_enable_rpl_parsemysql_get_client_versionmy_lengthsp_binaryget_salt_from_password_323mysql_row_tell__ftollstrrchrmy_charset_latin1_german2_ciunpack_filenamemysql_thread_initAVL_insertX_sqltrapmysql_optionsmysql_fetch_lengthsarray_append_string_uniquecalc_days_in_yearpage0FAdata__divdi3_DYNAMIClog_10page001dataend_servernumber_to_datetimemy_charset_utf8_danish_uca_ciX_commandpage027datamysql_escape_stringmy_string_repertoiremysql_warning_countalloc_dynamicmysql_insert_idmy_search_option_filesmy_charset_utf8_swedish_uca_cimake_scrambled_password_323X_get_cidstrchrmy_casedn_mbuca_lengthfn_exthome_dir_buffmy_wc_mb_8bitX_INSERT_IDmyodbc_remove_escapemysql_select_dbgetpidX_clear_valueget_typeX_take_stringmy_fill_8bitcleanup_dirnamesetsockoptX_ERRORmysql_master_send_querymy_wildcmp_8bitmy_wildcmp_binmy_xml_error_pospage0FBdataopendirpage002dataconvert_dirnameinit_client_errsfilenopage018data__ashldi3atexitmy_datetime_to_strmy_realpathX_heap_allocfdatasync_Q_lltoqctype_latin1_danish_cimy_once_root_blocksort_order_latin1_german1_cimysql_thread_safeX_callmy_once_memdupget_charset_by_nameread_user_namesystem_filenameX_while_loopmysql_slave_send_querymy_compressX_headermy_strntoll_8bitvio_resetrandominitgetpeername_Q_qtos__register_frame_infomysql_rpl_probeX_BASE_holdX_add_valuemysql_store_resulthome_dirmemchrmy_defaults_filelibrt.so.1SUNW_1.2libz.so.1SUNW_1.1libnsl.so.1SUNW_0.7libsocket.so.1SISCD_2.3libm.so.2libc.so.1/usr/sfw/lib3 ='33 ='33 =(33 zt33 ='33 ='3d`$h /y   $ ,8DwPC\h2tv>%D-W/k(4 @[LXsdp| C>7  o$0K<HT`Plx[JxWND(@p ,8cDP\>htbVHS2VaMI(4@LX.dp| ;M{" @$^0<`HTi`lx06B% @D# @@I @@@q, @ ˖"@@@@@㿐#/@$`  @  `@@`" `@$@```0``@@`  +㿐㿐/@ͮl`8 ` @@ ```4 `@@㿐㿐\II` ``ؖ @@#`@@ b` ([@D#f$ $$ ($ $ $ $ $ @$ [ c` @@  N`/@@|@@} /,* @@yI@ 0/@@i@@j /,+ @@f @@Z I?\[+\#"@C%`f$`$$`$`$`($` $`$`@$` [!I c@!@!@GǨ  `i)I  + -I/I@"+`@L`-`@@H ?\` 퀤 #`II@?`#@?``  I@3@@4 `\``7  +I@m\``dI0 \@ " X@.0@+0T@(ap0@?ΒP  @@@`@b @!0 : @ )I'I#` @?%@?`@G4 tt@GN  /I@?-@?`!t#I @Ia 2%ʐ @Ha/I@F`瀢 @/I0@ @ [ca HI@?! [#\$` 8)I` !@?~#Ia@?} 6 +\`)+@?u  =(O8 #"+@?n% @?T@KtG` -@?M@?_@?`@?C +@?O  =ܐ@?U-I@?=؀ \I"#`@?* J\@+tGD#`Ia%I$` @?#@? "8I $` @?@? "8Ib $` @? @> "8'I $` @>@> u8%I0p$`  I"8@>@>?c#\``2I@C@>?I@X\ @>Ґ@>`` I#@>`@>@"H0@`#㿐!\ 'T'X'H'L'P`%;```?? `;”H#`@>a -I![#耣"1I;[c 7f&#@" ?0I`@̐"`@>7f'c@>" 3I5I@>aa?;["p@a0b㿈 @>`#``` ` `#`$`  #`` "+`$ . #+ @ , ` "   I#@>lc@$` $  #``,'X'H'L'P'T`@;\` 2 #`!` ( Ym `(`W @>F```F9` #` `'   " , #(`#*  .@  " Ic@#@>+' $ `(@>&H;\` 909\ IcP@=@=  @= 2,*@=Ԓ   '`$`,9`'`@= $ (@=9I7\#`@=͐3I@=̒cp$`(@=`( #\` 'H'L'P'T'Xϰ?9` 4`B;\``5\Ű `7` 0@=```;`09` #` `'   "+`$ (`#+  ,  @  I" c@#@=' $ H@=`0@=b`0`3I`j9[@=Y00Ic@=k` @=S  1I[` #`0'`1I#@=W` `@=> I@=` I\ @=DI@=Cc`5\ `0&I` c@=7``@=  @=@5I1\ @=%I@=$` !\"0$  k' 49`;[c9I&0# @=4 f #5I`(@=&`0@<`0J`(@=`0@<`0`(`?@V ;J`@=0}cx  @=`0t㿐fK#䀠` )[ [+#䀣`#    @@W @"` 2`@>#ܡ,  @=#܀ ?R 㿐*   @<ۑ: . *  㿐*   @<͑: . *  㿐c   c̀` @ & @:& 6 $6 6 "㿐  @:l` @@ ` @&@㿐 1 T `%  " ,``,`2#`,  ,``,`2#`, @4 ?" $ ,㿐\``GK[c̀ ) T C   " ,``,`2#`,  ,``,`2#`,`&?%[``,@;8̰ @;m@= (@:&`2` &#0[@4D ?" $ ,㿐\``.K[c@; 5[T` ``24`"24` `(@=@9 @=?$`$`@9\ 4`$`27K2 )T`"@9`+ #P[㐒W 㼒 ( 22` `"` @;J #\`2 "K’@9~а?㿐[#@: 'R `2?R $`2   ` ( @`22@9N @<ݐ&@9`\`K  t # @<Ȓ &"㿐[#@:w "\  `K`c i a ?+``` "f"ĝ㿐fcX @8, `   0 a"  㿐``8``   ``7   K "+`'L%?Y%?S!@t #?T+?, L  * @5;`,@`L@  @?4@5L@5L  (``@5  L @5t : L,@5Y c@5T c ;? :L,;?b@@5[b@5W9? :,[?ު"Ȓ'@4L(@585?@-@F @5!@5 B7? @5e@ ``/??2 '?/f5L@   @@5 0??#M@ @5H (`:`@fJ@,L , ` 6""x"M!@5  _La@5  jL"@5  L"@4  L@4  +L +; :@ %?ހ @ ?' @*@  '`@-@ O@:@ @ @)?ޠ"@?*@4ސ@!$# J  ?8$# ?3$#` -?*@@ `'K@4b , ?, y)L@4P /?  %L`@4P@4Y -@? ,  V7L@4- !?"1L `@4-@46ِb@4W  b!L?ޖ"N  ' ??   !?N :` +@N`'?@/?ހ4?#?b aN `:,,@ N #@@3ݐ ?ޞ@+??- @3̐?aؔ%L(@3Аd,0V 0d" @3  ])LN    p ? (@ Nf+`< `:  (@ @3?Y??ߠaM@ -@@ @9L!xɒM@`  (`` ˢ    L (`: ` ``   0-+@F @3]"0@3  ?%L -`?`:@ %??ހb@ ' ,  ' *  L :@ @ @)?ސ"?ߦa +"J `'c7?O@3k8@3J  +L9?N "' `:   `;?ߔa`  J@`: @` ?ނ(@ ``N' @?ިb+ d/?ޡ=`@. :`]#[c@4 "F @@2ޒ s ")?@@2̐{ ޒ0ܐ`' 1L"(@3  7? K "+"L'LL    - 4-?L  +`=` `  -?->@@2L`  (`@2 Lb@@2  "5L#a`X   !L@@ `@2O 􀤠@29?߶! 1L !(H@2  [%LX@2  M;Lb`@21 >Lbh@2r  .5Lp@2k  )L"x@2d  /L‐@2]  5L@2V  L!aL L@2.@2k , L@2j?ޠL?a(@2: 9L"@23 t+Lb@2, dLbȐ@2%  $L?'['` @1` &'b` @^1?ޘ#"L b@1ϐ~А@1  $5L;?9[b#'` @1` &'9` @5+?ޤb@bL@1^@1 =-L"@1 [Na?޴#0%L#ʠ(a?ޮX;Lb(#@2   *`+KL+Kc&5?ހ +K)K#?ް#L)fb(#?ޢ@1o aJB`,a-a  D*B%D$` #?ުcm;?ߤ`p @1V`0L# b '?ެ@1?ߚ`xL !(@1$ܐD"@+  @ -'@/  D .  $"Dϔ#@!?L (h@;T@*@19/?@0  9K#-?ޤ @)  L#0, V?! 'L?H@07?߰@0ߒ c 2)?@0ْ f 7?1L#L'L %L@1 H? ;?ߠ@?a`@@0m@0 e 7?ސ@0 g 7?'L/L@0(?@ R"P`"R/?'Kx?ߚ`L (@07?5?ޤ@oc ?ccĀ`N`  [ +`K` <? %[' L.@` + 6`:  $`N  (` +``  8``(&`)& ,0 +``  ?*pB`"N@0@N2ʰ `"c%f.@ޖܖ ̒ c`5f#``8`2  +```#     ` `*` (``$ $`82 @ `"Paf㼀``"@0 c`c`"c`"<@ &#@c`2``"`+@`e"` +'[ &)+c #/̀ @/0c`: `"@/ް D @* @* `"ł@ܐ ?cLcP@/  l?\``?Ld ?  \BL3?`# @/Ð@1@/T@@1N ! se ؠ   @/7 $#[ $L㘐 j 0){#`. t a u. . . . . . ㈒3?c@0d @0c@3" (@/T@/y & ?cLc@/@  ?\``sL )? '\`v+L3?`# @/L@1)@.ݐ @1!@//@1@/'@@1@/@1 @/@1N  6 seؠ `  @. "\1[ `$5?eؘ   +`` $-LaВؔ @.3LbP  0}А#.  t a u.`.`.`.`.`.`c;3?@.ޔ#?.L @.۔ ?- $ )K# %[@/ '  @" 2 2 "'LÒ㘐#@/ @/͐#@2T (@.@.` $` ’ M$ В   `  `@.  ̀ `$#!MaВ ( !@/f  @/@2# (@.U@.z` $` ?cM`P@.A  ?\``RMw ?@  \UL?`@# @.M@0*@-ސ@@0"@-֐`@0@-ΐ@0N $ saX     @- $ !L"P  0) `. t a u,,,,,,㈒]?@.@-@. !LL֒㘁?cM`@- ?)\ `]M ?  \``L3? @-Đ@/@@-U @/@-M@/N8 s[c@. d   "? %M@-+ 6#M`@-% B5aX   ``@- M`L(bP] . t a u,,,,,,#Ȕ3?!@-D ?  'L㘔 " 0)!@-2 ?L3c  @,2)K #  @-?Lc 2ؐ@,Ԑ?cM`@,  ?\``RM ?@  7\UL)?@ @-@.@,@ @.ڐ@,@.ҒN - sM`@,x 7M@,r DaX   ` @,b C`1L)"P . t a u,,,,,,㈒)?!@, ?1L#` 'L㘔 m 0!@,} ?# @,@,p?"1L% 2@,ߐ?cMa @,N  ?\``pM ?  \pL)? # @,Z@.7@@+ @./L R b@@+ߐ @.#L `w c@4@+ΐ @@.L ` ? s,  t a u,,,,,, M`@+ /3a`X  ` @+ F?`$'L7P!0,  f u- - - - ㈒O)?1?%@+ +?@+ 2*@+ 2*  -L  0 @+ ۔?cMah@+ f?\``BM^ ?@ ̒\ E%L3?`@# @+@-v@+*`@-nL` $ sa`X ` ` @+  $`LP = 0 N!x,` t a u,,,,,,칔3?@+jL$@ߒ?cMa@+ f?\``BM^ ?@ [\ E%L3?`@# @+(@-@*`@,L` $ sa`X ` ` @* $`LP ̖ 0 ݐ!,` t a u,,,,,,H3?@*L$@ߒ?cMa@*  z?\``YMr ?  \\L?`# @*@,@@*H @,@*@@,@@*8@,|N`+ saX  `2`@ `@* )L@@*_ @%L$@, D 0U!. t a u.`.`.`.`.`.`㈒?LP?cMb(@*&  z?\``YMr ?  e\\L?`# @*2@,@@)Ð @,@)@+@@)@+N`+ saX  `2`@ `@) )L@@)ڔ @%L$@, ᅱ 0А"8. t a u.`.`.`.`.`.`㈒;?LP?cMbh @) >?#\``#M6 ?  ߒ\`L` !#M1f#܀  ff3f c"c&c 뀐"xۀ㈒`@)A bq1f?chMb @)V /?\`MȀ`"?#ؖ ` 3\`L @+=@!E  :??b@Mb @) ?/\`zM ?  Z\`}L'?〒@+ @+Ⱀ@@+ a+ML ^c 3?c-[@) "|  l`]'?)?#@("@(?, L@# c  @+@`L@ @@( @@(@L@ ?1? +@  5M< ꤐ"c 顒3?@Ꙕ* #'?〔Ⱂ !M #h ꇔ)?`" ?#%M{  2K cq McД @(X 6?\`M`(`#ؖ# % L\ @*A@(}L(@' "  5ޔ?bN`@( a?\``ONY ( X\IL`@*#N`@3?@'ŐbpNH@'.@ (?@' #?@'N@ `; @ @ @ ,@ J @ ; @  ?bp@ , @1@ ?bp@   0ː #A`?cN`X @' }?#\``]Nu ?  \`cL@)` W#K1[#̀ ) T `E   " ,``,`2#`,֒  ,``,`2#`,`3 1[``,@(d#̴#@(@+ (@'R`2` P h@!n ?" $ ,c0B1[㈒踔?cN` @'! ,?\`N` ? `  [1\ L# @) @&  ??cN`Д @& '?\`N` ? ` #1\ L# ِ0?L0?cNa@&  &?!N@&! UN#\``"N ?  \ `L!@& !?* @( 쀖 0a 葖܀1N!@&z g? *@( @&[#@'{ `   @&? %L(@&)ϐa@&T #\N!H@&M #\NP@&F #\NX@&? #\N!`@&8 #\Nah@&1 #\Np@&* #\#Nax@&# 2y#\%N@& q?0㈒硔!NaH@& $? *@( @&"[#@' k`   @&? @&%L@%(a3Na`@% +? *@' @% " [@& "J`   @%?@&֔2#KY c̒T Nah@% 5? *@' @%ɐ " [@& v`   @%? @%1K #眒 `2#K c璒 3Nap@%{ ? *@' @%[@&| "H`   @%?%L"(NX@%X >N@%, @'Z!?1[,#@&W p` `#@%#@&K [` `"1?3?@$1? !K #6 2#K c, aP@% ?.@[,#@& v` `?@$ ? @$Đ@' `s!N!x@$ 2[*c@& "`   @%1?%L(`"1?K1? "#!K##̀" 3Kcגڐ Na@$ "!`*[#@%Ȓ `   @$? #Lb(N`" K汒 "?N橐! ?" #Kc栒 ?cNa @$ 8?\`N`!&?@  & \L 3?@@&k@$ @&cꪒ `?3?@?cNa @$A ;?\`N`!)?@  ) {\L 5?@@&&@#ڐ @&   ?5??cN @#b -??@ % =\N"(!\ N"8 @$)?1N"H   0Y!\ ۰ ?cNb` @# 6?\``$N. ?  \21N!N"@# 3f&c5N@#  f"c 垐"pڀ"(!N?cNb @#} ,?\`N`"Ж? ` 1\ N"( @%f@#  d??cNc @#E 3?\`N`#"?  ! 1\ N"(5?3Lb(@#8   @#n0 %?5??cNc@ @# 3?\`N`#P"?  ! @1\ N"(5?3Lb(@"   @#20 ?^5??cNc @"Ǡ M?\``NE ?  \21N!N#@" 3&c/ 䯐#〦"(%!NNc@"  5& Nc@" ""   N@"} ? "  ?cNc @"n 6?\``$O. ?  \21N!N#@"P 3&c5N@"H  "c M ڀ"(Ô!N?cO`0 @", 4?\``"O, ? @ k\21N!N#@" 2&@5N@"  &@ @  @܀"(ピ!N?cO`p @! ް?\``yOְ ? @ +'\N@!@ @#ؐ@@!@#ВL @ * @!;`.N`L` * @!:, L  O@!] ">'OO @!V "7'O!O @!O JNO`@!H OO`@!A "o)O!@!: "v1O@!3 COO@!, ]!O#" b @v @! )O%$Q @!!  ?1&#F "(ה0x@! 5N3f&c7 @  O #f$c, !@  =!O!@  Oa@ ߐ OO @ ؐ O" %#  !@ ː DO '$   &# (@  eO5O@  O)%# @!?dOh@    ecX,  -@!;@" а L`̒ @ ݐ%@!*ð @@  ")5Op@ | "1Ka8@ u O'f$Ȑ@" Eec  @@ א@  > #$$b  @ @  0aX@ S  O#O`@ L L!O&@ 2eOaᗒe@ : zO ##o @ /a O @ ) O$` O!@  )'O| a@  O1 &#L '?Ob!0E@  2'? $< !@ O &@2 @ OO @ )OG !@ 5O? @ڐ 1O7 !@Ґ 3O/ b@ʐ 2O' ?c? R@@`@"@0?cOb @ 0?\`O`"$ \ K5? ` @@!Ґ@  …G?c@9N@`<2?N` @ ?   T*@ K``> ` M fJ+ +[ *[  -@"ܐ`" 2 @!cܦС,`  c@ Ѐ "'R `)8#+(``X@1K "@e \``O/Kg \ CK: `"] V`  O  F  =  4 ؐ# + ϐĔ " Ɛ|    L  Ȕ  @u  @   -Mh@ה %\ 2d5M?װ MⰐ@Ŕ  t%\Y;Mǰ '?㸢`\`+?!L#3+?c@ @@ @  G@k  =@ x  3@ n  )@  { F r @ d h  @  ^  U % L  C ;N`@/ '\ )N1 -?ߪ` n#\`1L#ߝ@ @ N`А@  \`N  !?#`F\Lcv`  O   ܰ N b@Ȑ wϰ )?#` #\` 1\+Nb(<1\ 5N8߸@?2 /NHޱ Nb`@ I\`2QN ?מ` ْ\ "3N%N(3Nb@w f c!N@o"  ;f'cx #Nb@f  1\ ]Nh ? `쥒5\/N(Ԕ@Q@P q I N#@5  \%%O7 !?#`t\``"3N'N(ޣ3Nc@ )%#+N@ c @ #$c 'N@ #\` +N ?ϰc` @-\"?5N(o?Lb(@  @,0N#@@Ҕ  \%N԰ ?Ǻ#`\` +?'N(@+?c)L"(@ǔ  @0#O`0@ 2S1\ LO ?# ` /\`NN(N@ 2&%N@y  &  |  xvbo h4 aU`@ZcSMpLc` 뇒7\"Lcݶ`fM2f#܀  @ %f!ff$$##! ݛ0ȒـbВ P.*L)'<'(( &x%|$$$$##T#0# """"t"L"$!!!    h D lH$x?a؝)\ `'H? /aP` ??H @  +[c`+-?Ha`"&3O`@! 2a` @`  2a`< 0@ 2a @`L 2a`  ]&``:P3ObH@P 'c!@`(?H 0`@`(&`&@0 &`@` !@o`c&a%c@ `@@`+ `2O` d\`2@@,P %P-?O`[ c@J \ O"h@  @@+ @@ / 2*L ? /,,bВ e%? 1# `IK``@  ``@$  @ @`&`*`,@8` ` ,`H/ 2)fcԀ`" )f%##cP?%%P&` K!`` `"߀`K"8Ҕ؀````  H OPܿ"pPOܺ?O"۶![# 6O@# c!#c  +c̀] [r?+[#Oܓc?O`[ c@ 2B \`+K; P}``̐`@'O( @2@nc'  Og#00 -OPd![# Och@9# " ̀`  !?c `@0@0#Oc6``?c(#\``'H? #'f -f`" 3Kb       $ ` +`.@;` & ` `0,`e3fc؀2 Ѐ`2 H( `O㰐@ה  MOc@Д  "$`" O#`K!  ` ̀`Kb8`3f0'O#@   `$%``" Oِ2` H`ffPcԔۙ p ?cHP`` @~ ?+\``P 1?;f5?#cܢ$'cܐ 趒?\#`"!?#@a@* ( 2*#[c@Z P  "  1[@J#̶#̀ @~`" `,2? @ ( c@J @ )?㬘 @ "* P!?#-P 0 " [@`5P :``zP@ @@`@ ݔ@ "ִ@D , Д*  " [@_`"P `֔ ` "+ #[@c̶c@@~(@2?㬢@. 7[@' , !?"`#'c%f;f/f$'c%( ڏ h ڊ 7L㈒!?@CӠ+\` "1Pu!`r`b@e?#X`*. P@ 0K  @\ P`H\`!P  !H  0 ?\ٷb  `1e`!fPcȞ?fah# $"0"fPcȞ?fah# "@\` P# x  t1P1P!8%fĀ`7 +` )!f`` $+`1! *?"@  *% #Pa 7@b f#Ț?f`b"#Pa @#X" P!#[ c@ x\  m&Pc@ r\ `PL ` c@ }\ J` @Ģ @+P1Ęa@E!% kfȚ?f "cP`#eh@2c\ 2H1P`!e1P#!h@$\+%P  #PFaf X@ P"0@<$Nzf !P8k '``K ` K x4#Ր/w *#~ !x%cƐ`K #} !f?c!?)fP%#̒b`@L` * @:,@`L@  @? Ph@ %cȀ Pbx@ה  \?P"@ϔ  T!P"@Ȕ  M @2 F ?@a ?+``` "#f$c5  @U 'P1PaВ"@kfȚ?%#?P!h!e@]#\` %Pxؕ#  ?"׌?cPc @o F?#\``)P> 1?@ 宒\ -3Lh` !5fLX @.`   I# Հ "   #PcP=ސc׳0с?cPPch@  ?1\ `nPf? ` Z\`iL%?@@ђ ( 2*)[#@+[ Zc$$$ @ ( "9  +P)P-Pc@I#`'@ .@&@ @@& `&c@$#`ݐ   0&ײ#x@$ ##%? (@@R @@d$$ #@㿈\``<P[c'f#f$$cԒ@  ",R $2( `"$ '' `@$ $& 7 cԀ 23f@`$3fc$`$ $ %#Ԓ! 0L#[ ?c\``?Q[c)f'f%#$Ԓ@6  . R $2+ `"'?   & $Ԁ %#А@{ `@ #fc؀ $%#$ԐԔ 0  [ʔ #f 㿐\``Q#f%f$$c &  cԀ`"$f؀ $$Ԓ֐ 0#f ?bQ`P@  z?'\`2?Q7? `\`VL7?@ 2〠 @@@ $,3Q`@C ?7Q@< 25Q0<W8 ր `}0, 2$#Q3f!f$#&c & ; cԀ"$#1f#؀2 $#$cԐ#ה7?0`0Q3f?c\``'D'H'L'P+?`.? '[L $%f#f`$$c"@  +?`D H@ f?/\21Q9\ Q?@L@ " 4 +Q#?a|`%KQ7fဢ`U@ @: ,  *  @ `O\PQ@  Ζ Uܢ` p9aP ' TL@H7fԀ 2z +?;f`'cА D H@R  ?ff)a"#cЀn% T#a`T LCP@: ,  +` @ `\$ Q @՘ @  | 4 ?@> ;-@@+?`@8@`e? x[9\Qq!0+?= 0\-?/Q  M(9aP ' T.L@HH7fԀ +? ?3[ff)a&c"#cЀ% T? @ /%Q8?/-QВX@'ff | c#e9P!h@c7\ 3P+\``)P!xԙc  b#aaxc+\ ?cQa@  ?+\``Q?# `6\`L``)P"`@OЀ  Г* @Ñ:`, L  Q)h1f%!T&#̒a@v Q!@p XQ@7??\p    @A V@J!" `2})PP’bЖ!@`fcȒ?`v&#̒g 7?p? \@ @L-fX @-,  o  o Fj o!r@aȀ ?cT 2 -f @ߐ @!Tf#a`T%!TcX @,  .  . 'Q4MА㈒Ӫ0@"+PPh!e@#` 2 +P  ~ax#) !$ ?cQa@  ?\``cQ[?@ `2\oL@@ b#Q%aX  ` ` @| "@`$'a!?X@ ` `  `)Q"H@{ A3Q@~ #$7?@+Qҭbx#f!c#$c$#̐q $#$c- j( ӓ!'a#f!c#$c$#̐U $#$cb ҁ%a㈒bPv?cQb@Z  G?\``0Q(? `\(#L@I%Q@ H $'Q1f!##̒ &#$# $#@ &#  ,"΀cҢג#1f?bQ'Lc @  Qc@  -?*  +\` QNa@`  ,@ %?@-L/\  <@ܒ`̶ Qc8@ 'Q@{@ |@Q#H@t #Q@ncP ВcPQX@g #Q@ac` Qc`@[ " @@[@@@S`@#?'Qc`p@cXp@@@ &`  "  2  ?"%` nQOc@b "  +f%c N @T 2 .L LWZ@@ " @H@@@@@@8@   @ܐ #Q@֒c 3Qc@А " ``#\Q@` Q#![#@  x` `` QQc xLtr cP@ " @@`@ߐ@@ @א@@@  J `?L  %?@ 7f ``2UK   $ ` +`;,@ &` ` ,?)\`Ѐ@? -Q@  #f`?ÔL "`O@r  O㸐@k &2$c )Q#mc``"KdKa]` "`;Kb8T`Oc@?   'f$$cЦ   "`RА R`@@*  1"w` rLq`'L㈒Ф "E <,@@Ԑ@@ΐ@``8 R`H 3QxOЀ`2  "1Rt XcЀ 2 L̖   )O#@А "  -f5f%m&Вh@} #R@w`h 'Q`h@q " @@q @[#@ Φ   "R`p@T %Rx@N )R @H 3R@ǐ   " #KcЍ `ϊc@- #R@'` R@!` " [`@ @ #R@` R`@ " @T@ ͦ  @  #R@ `Ȁ R`@  " @9!?#x@ @   < @ @  @ Ґ #R@ ̒`؀ ?`@ Ɛ " @%?x@@b   )<@ @ @@@ @@@ `@@> @T @P ``"3 Kޒ- 㼈'[쀠`221[%\ kR@ pR@p ~?1<  w?`iR!R  Ә!02!0`$%R8ϥ1[#耤`^@ h@  / r / x . e o** * * * * * * * %\5R@ Ւ耢 ><  80R!R  Z!H!H`)R!Pg0#RcahR@ "R UP ːK!!R!F!R㼨@ `!xR@ `@ ( g@ `!R@ !@ ` !R@ !@  @ ːJ   ' +R -R * L` (`;`@a/*@  4 RL` !\ `27'R@ 5  R1< ) @/ x```@ | . 0Ra@ `!R``Đ!x0@ i̦@@`(@ k @`(&`@ }0ήɐ`"`!R!Υ`@;\``R@ Ua R@ ]@ W :   9\+Ra @ D!R!@ C "/R)f+g 'R/-`@ ~-#@  -# d@ . #`@ 0M#耢  #`R@ R( 8 R"0  2 @ #gR8@ `9R`ؔ  %"@ /@  "%R1R"H`  M`S`![R"P$#@ А`?#[/R#$cX ` ;R-t`   , @ ` ` J@ ", F@ , @ `R#[a0@ c̠ %[# $c#R@ aH # [###쀥 q%R0UR![bRԐ"R@ a ;R@  X#R%R@  T'R)R"@ y 9\+Ra @ r!R!@ q 1)f/R@ R 1R)f#@ Q M#+g B#Rc(̙`>Rb͐09b``c͉#q-ṫ0HP@ 2 :- 8 0***cu)fb?cR#P .?@'\/R-R+R@ S@ `Ґ JH@ cS <@@ 6!SѸ  N#?/S-R+\)S@ !?@  Ѡ J`*@ ` `@ 0!~@ƒ@V@ `n@j@B0@ ڠ?(`9ː?'! a̺ Ȧ  !@25% ;#@ N`#/`@@   A@ @@ Ҫ,@ ͔`@ ?@Sb8J!؀!!؀`$'!؀a S!0  1!S J@ -SS @`/S  $@,  ? Q?-c   `/`3a̘ &aS8%SS  "W ??UK``1J  @ a >a>  d S!؀`0?#$ag2l?? @ ?А  S!S - x&  %=MU ؀`1> S`L S/SpJ0 S 2?`@@ 0g8 #ga!g$ "#g`J`   # J` g`L !g%!%!؀`Da'!F  @ c!؀˔?'!a >a> f` -g %@    M 0;`$`!g`$ `@ J@  `K@ .yg$`#SbX@ g:!%g`"a?????^%g 2z??@ QC #ga 2??@ Gc g2??@@?ga`2??@6?,?ga`"M ??(%g 2s??@h?g!`2M??  @ 3ga 9g??  ` T JN%`#  `$ `@ sJ@  `$`-S`@ #ga ˞a;;{! ޘ` ? #@????@ O?p????@ F ??@ ? #@''@ 9?T????@ * ??@ #@Ð#@'???@  ??@ Ҡ? ??#@??Ȑ@ ? ????#@@? #@????Ȑ@} #@@k@M "M ` $ `@J@ 2 `$`#SȒbh??@ǐ;aʂ!0`Mx`@M `` $`!g $ `@J@ 2 `-S$`p3 7g??>> sswwvDvpvvvwHwpsw㿀gg ##!@ג .@ g,"gg!`@`&@??@t&㿐\``Sa0` a0 @ `,` 2S0 ڐ"€ %\S `"#Sbx@k !?@ @ @S3  @ 2 *0ɢSɞ0#\``:SS@;b >?@  @@ `-S - @. (?N@   "@(`;N@ ` @ +`< @ 2 .@  N@ `@   Y# SS0с!\ S `#@-Sb@ +?@ 6@ 3@S `ͳ  @@S#@ߐ  0S0 @ 6*@ ?Ђ`` ( *@ `2*@ J`-2 ?*@ `@ & *@  㿐@   N Ѐ`.`` (   2 N-2 ? &   ?@ d?N `-`?N  -\X  ?В ` ( * `2* N-N?* ``& *  h ?Р ` (* `"3J* ``& *  x ?Ж (,@ `"&J,@ ``& ,@ @ ? ?@, #aP@  ?2@ ` `-"* ?`-",@ ?㿐@ @6  Ђ `` ( ```N-2?@&  `@f@Đ   Slc@@ @ @㿐'g  @٠  >  #h, ` 8#ha<2` ?$+`$a@J a*@  a*`$a*@@ $@ !%h+`@? $ * @ @(``@c@`@_$aS'S㿐#Sc@ɐSc  , | ?, @  ,? & ,?㿐\``[SSc@T QS@N ?S@H TT @B VT@< CT`@5 <T`@. "5T @' T`(@   T0@ 4T@: &0`{  v?8o@?P#S@2 ` h8X` Đ S 8@ T@ے׀ @@֐ T@В:` H@ʐ  T`P@Ð  T@?@0`% `X@ " T `@  T@82  h@ @` 1T p㿐\``;TT`@  T@ Tm k?@w T @p "T(@i T`0@b T`8@[ TE@?ƥ T< :? @@F T`H@?  TP@8  T# !? ` X@*  T `@# T  ?h@ 1T i㿀\``?'B'T`@ 4T@ -T@ &T @ 0T(@ )1T 0@ "3T`8@ِ 2"7TDe c? \ T T;M K?@@  9TL? =? H@  T`P@  T-* (?`X@  T `@  T) ?`h@{  X ?TŒ@%h;h/h-h+h)h'h$<%!8%a4%0%,'a($ @*`X#h8`?`1 T9(`#Ta@    Ta@  #  $a$ jЖ   +T/?! @`;(. ?$ ' . ` $<a$@@*`  ". $a$ $a$Ta(@E    Ta0@=  $  $a$ qА 8  /?T+! @:`;(. ?$ ' . ` %!8T8 @ @0@. . .  .  .  glN6Ta@@    TH@  #  $a$ qО   (T+! @`(. ?$ ' . `  k%a4T8 @ TP@   TX@   T!`@    Th@  $  $a$ bВ `   *T*?a @ (.  ?$ '. `  %0T!8 @= 9T!p@i    Tax@a  $  $a$ +Ж   +ظTa /?ؐ@_ (.  ?$ '. ` %,Ta8 @ T8 @ T@Ta@   Tᐐ@   T!@     T᠐@  (!T $a$ Ђ ``   *К+Ta @6`= 'a( @!@ה   Tᰐ@ϔ   T!@ǔ    T@  !T $a$ nЂ ``   *њ+є?W$ @. F$a$!Ȑ@   TА@   T!ؐ@    T@  2@ $a$ Ђ ``   *Қ+Ҡ €`Y  `y `A`ay  $a$Ж  /à a+Ӡ mà i ؝㿐ha(6ha,6@ha063ha461h!87ha<7@㿈'D@D/ / / / / gl74 ` ,8'''''''@V&@P 쀣@q&㿈 &  @ C@`2   @ ?+`:8+ `?''耢 "8 `*; *`    J&^$#""$` `"N `"I`T`":. d ``2  ` `+`< `#T ''耢 "%`(`;``.`?C @  J$/$"# +(`/ ?+ + . & % .` * . "#. (`2. *  , . # ` `"$@&@"㿈"@@ @ & @ _'耤 $ڐ ``' '耢 "`* ?; .` Ð ?J`2&"# *``?+ `2 ```2\&&?`"V&N`` c @`2&@ &` .`&N``  '耢 #@`, ;  .`?o? l  J`"%&`":&# ` `"&##J `"%`1`"* K?I??+ ** "# ?* @ ^+ ```2+  , * "# *(`!?2* *  . * #@ @"& # $&"#+(`㿈`   € " @耢' '    耣 'h\`` '@ /  `T!@ % `€ "@ @`' `'Ԓ  @`'`'̒ȁh!\ `T`' 6? € `",?( Ta"  @`' 'Ԓi6 ? ' '̒ȁh!\ `` `'@ &`&@.`9 T` h" ` `'T`a@ `€ @ ?0 @@`'`'Ԓ 6&`@ '`'̒〢 J` # +`8` +` J ` +` "*@ *@ J ` " *@  J ` *@    +` 㿐N` J/`>` /` N/`>`^ >:`{`'" C`[`"   /`.` .>`+@N N`>` @`?`?+@ O`\2>`. Ѵ }`{`~``2˴ ɵ>2Ǵ ŵ>2ô  ]㿐CN`"@NN ` .8`(`8`@`N`/`  `+@N  (`8`/`8`@  N`N ``+@N`v tN` /`>` /` N/`>`^ >0/`>`^ >0`{`'>M`[`"2  /`.` .>`+@N  N`>` @`?`?+@* (ڴ }`{`~``2Դ ҵ>O`\2>`. /` | N`dr2 >2  ]㿐@ڐ  !@&  ! &@\T`0R Tɐ"X TĐbX@ 㿐%\`J`X a7`@T @!  2T @ \!@@$$@!T @ @@ `B4 T @ '   "@ /4 @ =@n 4@ `&6 $`0 Tbpi "`T␒_R`"aT"Va*TbN:Δ*Tc;`F!TC"X 㿐\`` T2# 20@$$ 2   @$   2@0?㿐\`` T #8 @`20`  " $ @$   2$ ?㿈haX   @ @ 1 2& c )\ 2!+T2?@@kNhP#\h@hHh#`!LhaDr @nD $@$@cP??0 %\` ?@t!T#p?㿐%\`5TTc#r [$`@ ; , *`,  @h+ah@  #`* $. @@`ʀ` #ԕ+`?" *`#؀   $@&#9 c#T@gL  ``` (?+`# ?,`c؀  $$c?*" *`@s%T>`@g' ?T0?㿐)\ `2;UhaX  -U "    ($@k  #2 c؀ $c&@f$c&$ !rh$  #a@#U h`@㿐U@`X\` `` ]UԐ`!h  $!D@@ $!D@1h` &!H@v@ &!H@3h &aL@k@ &aL@~U5h3r&@x@h&`!Dh`"P @l @  `(@&@@e : "1U*@ &`1U !r$  ?  * 5h#@X.`c؀   $&c  U @fd 㿐-\` 'r  f#r?U _ 'rh\ @   ?`$@. $+h- aX@q6cؤ ذ r *"@ *cH`'0    ?``  T# + " *`c $@.``"$ @$  V z$ @- ``  T  7h\` @ Zc  ?`f$``  +`$ )h!X,`c؀ F $$cx 2u?`?U%r _$@% ; , *, $,`hh@@  <(`'@/ @" &c؀ L  "H?+`# *@r@U<?U@e$0",?-U@&? ""?;Ua? "?. %-`@q%Uu8 ?? ?U!Ph㿐r`+`" h*ah` @@qU@!x hU!hက  @q1U@!0@b 㿈U@d!U@aU `aU@ZU@֒ U!U@R"H@2'\G'쀢  : š ` 4+ c +U)U@ @3  &@ђ = "p*`"$ 쀢,` 2 & @,$ `ِbX0դ&$ ߀#UؐbU"#aа?㿐U@"U@rc@ 㿐U@#(U@fc8U c@ @^` 㻘-\`#U@ccH (U %¢0)U /!*/@B@Cݺ @]Uc`@B#X@B@T'!@' 2u/` yUUc@\  J "   +@`K "  -@@ @L /`&@ \Uc@; "b\J  `"   *@`K "  +@@ /  @@ \  @/\ O0`!@ʔ O`!@!@" `!@ /`' `& #pUUcUc@ܐ 2J \  U @ !@ O2 @' @   # ``U)U#c!@a`7UВ0 U0#@c)U@b#X!@ ! @ ` @  U#U@>cH UڲP-Vx V r<V`0lO0`"L@:V@@@@O $ @")V@ P!@ O2 @@%@]  @ @g   @s$c@@#V`X##?@@6  @c ;@$   @/  @Q 8+㿐V@ h `  @@  , @2@ +@# $@@ #`$@  @"` 㿐V@ xV@s` 5V@ 6 L@`', c &@S,@f&`L@@ @/@ @``&@n = * &`L`2 &,"&- V#a'?V@F h %VL`ؤ  (`= &L` @i& @k ,& & &㿐N`  .`8`L@`@2 @I @K.?ς`8.`?0`cO>`  @,* & L")? &`$ @,* &L2 )?Ϟ@ +@@@0'V%0L)?Ϥ@ +@@@'V%0@P J ?߀`@ɚ?J +` ߛ;`@ @?ɘ@?Б(`: 㿐N`  *N "/`>`%.  O ߀`@ɺN/`?` ߲ @ɂж.N .㿐N`  #%V `` ` А@  `.@`N  .@` @ @C `.@J`  0J ` (`8``+2` * `J ` 㿐@?? .`8`L??2L?㿐 N`? `? 2.@". @* : ` .@.N`? `? 逦@. 4  J`  *`8`+`8`@  K` ?㿐@N` 1V( (+ ` *8`;`@ ?  @ (``;`N ` 0"    . ?   \. N ` 㿐@V a@㿐  @ 㿀@q '@`*`?`!@  $ " "" `\5* `@ n`[  `^`y   `-D v@|  $ "" " * ` ۰ @6٢` ]2 ?  `* `\ɀ`!`\ŀ`[`\`]`\2*  `^`\2*  `-`\2*  `\2* * ` A@:  M$ "" " *  * ` @*  =$"" " @   3$ $ $$@  ($ `   @  $"" " * @  $"" " *  * ` {   &$ @ 㿐/H P? `L(`"@ H B  0>=?H`9   04 H 0? `,  ֒ 0'H @t   H@n    H0H @b  H @\   ? `  H 4hͰ㿐 D @; `%9?@ 4? ",  `&@`$   @?@    @ @? 㿐ra ` #a 1@!  r` !  *  r @ @ @ &@  㿐rJ&`; r , r*&@*a%*  0 @1s#쀢 ,1s#耣`V @G   &#VV@ua V &#@" "1s@&#V&#@ 2&# 㿐!rL!&`#r@@wLa%` @',a%,!&@.D,a%,!&! axa 㿈#     `#\@e+#`   ,## #\#`$c`  @ * : 㿈#     `#\@e#`   ,## #\#`$c   * : ` c@* ; 㿈#`"#c     `&#&##\@d#`   ,## #\#``   * : 㿈#`/c     `$c$c#\@d#`   ,## #\#`   * : `  c@* ; # *#X*#XJ#X*#Y *#YJ#Y`? :1 c0 @ ``2$  * " H@ `8 (`p@  c0 `$J h   b  c0  $K@ `h`?@ H@@@㿐@\?-  " ( @`$ "3 #@@y, * `@yn*  U@[' @\}?ڂ h"@a) &"p `NV"hV@6S 0N` "29#  , @r ,  K@6; "4  "* 2`+   #\#`##   # 8#Vb0@aߐ#  &", %<@А b(@"t@"x@" @:&"t@6 &"x @/ &", <Vb("(㿐@z3VbH @5Ɓ@u @5ܕ 0@j@nV`"P@@V`bX@V`b`@ V߲h`"#tc`"#h`"#l`\"#p㿈 ("/ p` p  t`29 x` `\&#h&#l&#p&#t@h A p@ )V t@`6@x(*  1U"@Z' x@@j,6<` |ѐ( @x @xP%U@59"_ | _@!& X!U"@ZȒ' Vb(@w * ͐@x4*  2ǐ`& |Ʀ 㽐 @" V(&    , $ @%$  @[  !`$  r$ @9kc@ 㿐@   ! $ rb @9Tc㿐    @@@㿐  @4 @4aа'؁"#x"#h"#l"#p"#t㿐@@b"㻈` #\#`    @bK hV"x .#@n@b H@f? C@h b y` / ` -@@`@_ j`"c"t@’ W$#@ $#I$#@ "$#`=# 9 K,##$#&#@fk B2`"t"x _!@4^+b !@4Y""^#@@4T'& X2  _!@4K"!@4F""^" @4A' Ѭ @q $# "p`"#"x`"# "#0 `/`@[/`=㽐Vb@א@ao  @e " _@f  "&#`2%H@&#<* " `,@Z,]< _!@3!@3""^" @3'& XI  "&#@gH  `܀`0 @@^[  "t "#@ "x`($#@ $#$#@ "$#`  #   ,#&#т @ݒ $# ˂ "p`"##㿐#J#`)@^ 7 "*"t@ )$#@ $#`$# @"$#`  # ,#@ $# @_F0"p`"# "#0"x "#֐&#`?㿐@]ِ  *")"t@{ ($#@u $#`'$#@n "$#` #   ,##$#&# @\ $# ,#  "#0"x "#א"p`"#ؐ L(`@*H`@ +` "L     " " @C??``" " $ " " $ L" L㾐Vb@2`N@`V@틐@`# 5 @d\01@2"@* @ @ @ % \; `\ `?`' `?@" *  *  .` @  @ @; .`  ' %* ** @㾐Vb@2m`N@`V@?@_ג 5 @d01@2W"@* @ @ @ % \; `\ `?`' `?@" *  *  .` @  @ @; .`  ' %* ** @㿐"2 `@? @["   ,'""@Z 㾀 @2'  7 @2 @Wِ#\#`#$@    * `!#@ X  0@  ": (": 0": 8": @&""#" " H" * P Vʒb(㿀#\#`#      * `( @W '@VX"0`  @?# ` @"  @ZA"`&"  &#@cJ&"㿀/#\#`#`    * : 㿀/#\#`#`    * : 㿀6`6`6`////#\#`#`    * : 㿀6`//#\#`#`    * : 㿈#\#`#`     * : 㿐" +@  `'U@V _ 㿈#\#`#      * ` _c`0@㿈#\#`#`     * : 'Lc      #\#`c @* :`"""V"0#ҁJ P*`@ (`@ (`    L#b#b#b "_Ub܁""""`"@`"@"`` `"` "``T`"`"`#0`X "`"`sc"`  㿐#a!xL& (@u#@u#!a @ & @ & ,@ @ c @3` + @ ` + `@  #+  c\ bT "쀈b    `\"" bT 㿐" d` @ ` N@``L@2`N@0@ @ 2"+`:` \" N`, `N@`@,",`@ d  ??,?` ?2@@,㿐5+ ?` ""@/@@/㿐`X"b_" J`_`_ @/@/@/㿐#@V ?U  $"   *` + ,` &`  (`.    @ +*` 3`0`! 2(#`"&`"쀈`-`#    & "@XI &`8&`&`  +  +2$"#`    @UYр`$"㿐 0@u"( (@L @H H $ T @"#&#$ |U "$ ,$ $ ($ @/d"Ub@T'ؐ 㿀 `$z ` ,1 @`  *` 0 `@@*+`:`& | `"c "$c `c`2Ec`2 `  2. & G  H@!   < (& @& xU& @/" & 333////c#\#`     * Ҁ``X& L`_  b_@." &   @c`"$c +@$c@.ߒ`_b_㿀 ,`l &  . c #\#``   * `"c`X& L`_` "b_@.W  X* `P @.`_"@* 2`X  ,`@ 5& 0 *  & & 41  ."."& @&  333////c #\#`& `    * 2`Xca'U& @.e "3a'؁㿐  0 X` @F  ``,c . P``8& &  & H'U@.=$`b@.: ` @*@`" `S (@2` +  `" `@ * :`+` :`*:` +` `" ` (@ 3`*  2+`  2+  *  2*` 2+  2+` `" `#d g*@ f+  e*` d+  `" #`;` g*@ f+  e*` d+  c*` b+  a*` `+  `" #㿀`J@ //2`// / ////2// /`   `2 /` `"/ /  @Д & X`' ' ' ' ' ' ' ' 2'////''''//////’/À   2 `/@  & 㿀`2 // / / / / / / 2/ / / `    2/ 2/    `  `"/ /  @V @& 㿐@@  @R `@E& h `N"  ,#`"쀊X!'-U$`@,ސ`b@,ےs ,'  , $#55 5////պ #`/#\////ؐ Ж  @a *   ". "<`"$`<`E  X?$`L _ 2 _b"_@, 07#@*  "" @,`b"_@n'  4  " (@ ^ 2 X @ $ ``0 b, $ +`Lb $ ` " (@Ϥ 2 X`0:^  J9 @ 4*+ 7`- @ $ `0G 1?! -U@:> L:2,:M@``,, 3    .  * `"@ @m*  kU @$    @@  (@r i? X$`N _`|`"_@,bڂ   %@! r ``,`$#7`7`7`//// #\/////#`  @`ޘ*   ",<`"" $`<`  X?$`L _O`"_@+Őb ,b@ݐ0Y#@@* ""ަ @+"_ X!*/?@@+ _ y @m* 2 & @m* 2U @+$ @+ _"_!!'@+"_ X*@@+} _ @+y _"_@+t"_ X1!+ ? @+j _  x` @`"@" x"@ d 㿐 ,`; c`L @?ܘh!+ !?@ U$@+?@+<c /-$cc( 2 `X@ ! $c d$L`_ 2@+b_$c!'Ub$@+@+0@+ `_㿀 x`@`&@$ xS  `: H ,@   3`3`3`6 6 6 ////////c #\#` @  :`($ @   @ *  `X$ L`_ "@*ǒb_ @*Ò`_"& &@ dc <@    @b$ $ x  d㿐"(U& b@* "@* 㿐`` ` ,b U("$`@*`b@*  `U$` $```  ` `" b* "    㿐   ` U*@ 0  0*@ 6r%'!$(1)ጤl"#b`<  $ ,``, :$  4`"!$` `P /``"n$ M c$ `2 @ $ @ *  ,b,bc b$  $ ` `` "H80` $ $$ E`8$  $$ $ π`!`U@)֐b'$``#a  4@䵖. $$ $ $ $$ `$  $ `U'"($`@)`b@) a$  $ $$   $ $$ 㿀 @H.` 0 `4`42 L`:`2M  4 6`4 4 ////// , ,`:# #\#`  @ * `"/  X?& L _" _""_@)a! 5U@)["'&  1"<@<`, U"'8& @)J "@)G @)C "ߒ"_p@ 4''쀠`  Ã(`#@ $ @   @ , @  +@"" " 8@_ @L>N 9  8   耢`8 耢$+ +,@L$N 9 ɖ 8  5?@8 耣`*` *`.;2`,, @LN 9  8   耢8 耣 $. .:`:`:`,, , , 0 d\@* @'   耠@  +,, , , @KŔN 9?`W 耠 @ +, ,  ,  ,  ,  ,  ,  , @a耠  @ t,@^ 耦    4 2e+@ 2 _+@0 d`\@耠? @ *,, , , , , , @, 耠` ( 5 @ B 8n  gb @ B 8D  2=?6@`B 8 2`?  @ 2x w+   p  X P  T    X 4?`  Ń(`!t@/  @? ?Ȗ` @*`@@"0>`@`8@*r`#@@ 0`N 9` `  `2*Ā8 *  `+@N 9 ` `2 *#?Ėc 8 *S`3 ..N 9` ` ݘ`2*Ā8 * . <`.S .K ./ p @d ϛ, @n'@e......../ N 9>@   & * @dg? @ +@/  @% $, @/?@ @'?@@ d  ........s.@%'@@ @  ....].3  B  N9?#(J* F!  B Q(O* K`C  `(* Ā 2 .Ā@ 2 .*,   4`@ 4  `@@@w@4`@ 4  `@.@0tl80?Vb?9 +?@7?p 4?x`pƑ(`b@`D) J8!J  V"@?@' *`@@ "`@aIݐ0?@?p 45V@@&d`@,, , , , , , , N 9`?@?,, , , , , , , N 9  @~ @x P  .',, , , (T   *N 9`"AJV7~ȇJ'2 2 2 , , ,9, J',N 9& ' x؁ BN 9`2JJ'* 8`7 ,, N 9`O ' x B'6,, L'? ? ? , , ,, N 9`5 ' xN@A?,, , , , , , i!V"LxN@(`#@@઒ 0`@~hxf RT H'  .6 6@@~Q@N@<0p 4` ǃ(``@@d   @~" n, @~,? 0m@b ے0e@d " 0\ """ " " " " " "   @ D+ ### # ## # # #   @ ** """ "  " " " " "  * 2*   + 4`4 @ `@}@@```P``P`L`@`  ȃ(`" @@I9S@%&`+`@(`;;   `  (`;; ނ /t /u /v /wt(?֘ ʂ` `/h `/i `/j `/k `/l `/m `/n @/oh     * @,  *  @ (` * @ ,    B 2  ,   *`  (`   ;  x`@H   +@ *`:' ' &'''''/f'@H u /   * @ +@ * ' ' ' '   (`  *`  (` $ $ ` $@ + @ $ $ & .$ @HT 8x/  *`@ +; 'x '|  3' ' ' '   *`  +  *` &$ $ F0(`2` @`4 @`/ @`* '''`Ld` L   `@ (@3`J 9 @ @ 3  @ +@ " ` @`@* *`* 2+3`J 9 ` @ 2 @ + "㿐 /`  .(``@ /  3/` 3/  3/@6N 9 @ @ 3 @/ &㿈  /   /`(`@  . `@/   3 (`@ @N 9G @ ?@    耧 @0 @. ........`" +d +e +f +gd#`  `+ a+  b+  c+  "# +h +i +j +k +l +m +n +oh;`  `+ a+  b+  c+  d+  e+  f+  g+  "#㿐 @G  0  ,    +  *`@@ .  $  $ $   $   @ +$ $ @$$ $  *   +  .` @^ $ &㿐 @Fِ  @^  (`@ . ;$ $  , @&$ $ $ $ $ $ 㿐 @F ) ,   .`+ :$ $   $ $ $ $    *`@ .`+  $ $  $ @^ $ &$ 㿐@F  @"@ @ +&㿐@Fi  @ @" *" @ +& 0 "㿐@FG@&㿐@F?@` @&&` 㿐 4` q` ^``"3``"*3ʀ`퀣`2  &5Ȃ "`L@* a1!"# @   /`. `?8`>``?@@@@.`/`  2 ;ǰa0">a' "s [ _ 9ʺ!D" ]`9``  $*k` `a3  $3'bA - s7 H n 2+"1ʴ!$ ""`  "` "0"Y`>``t`2|  @/`` 1ʀ`2q *35 "9"e ( ' Z0̴  "0"` "1Z @`"V'@ "` "0"8H 3K`3` 0@ $ @7C؂ !K"0"` 8"}9ʀ@ . @ _ $&;,c\$ "` m"1Ȃ"X"#'@"0"` d" 3'b1Ȃ#"'@ 9& !0""0N"` 㿐 `  `'(#*a?U"` & @ a "@ ^C  4+`@ۡ 4@ 8 ` ; ( 8$ "$ "$ $ ,$ $*   @ `T ." ,Nce"  ." !U"@ $"'@&  `L@ 㿐@FD?    @``&@  㿈 |@쀢  "` '耢 =  e: #& da';& |   43* @ '耤 , 8 $  *@ @`T ` (@  +$   K@@ &  "  e 㿈. 4 `4 @($` `2(@`8&` (@  ") .@*@(` 8 @'쀢#" $ "% (#  8'U& @y "@v "|(     ** 2 ("㿐 , @`W c  @ @ ( @ "'$@ r  ``.?$@ڊ `(`C $<(@Eg ?ݚ  X?& M _`2" _""_ ` `* * 0`%b ` `- +2`%b !К'U& @ "@  0 @ ""_a'݁x , $ @ `#    #```@2]'U$@ܐ@ْ a'L "# "w#$@ 2g`L'@$  0`4* @'䀤 8 `T @  * 2@`(+<b $|$x="%#%#W   @瀎 ?444 ////#\////#`   @Sr * "L X?$M _`2 _"_@c 0*@`"_@ ]   =`(%#%@ + 4@ٕ 4* @   #`4#` `@@*#`44* ` r,㿐 ,Ű ֒ *  ` @  耢`)$ M+  *` ,` ,─ 8 4耣 ( !"U$@@ @"$$#c$| @ @:`D`H``L`@$ D$ H$ $ L$ @`T  TP @@*`D ",!&#"T$|,,#"+  ,` $*@   $8* @   $4!!'+` * 8"*`@ @@ @" @ v$` @ r$` @ n$` @ j$@ @ f H   L @ D$`$`H T$`$`L$`@$`D  $`$` `T@ @ @2 u@ F x" x x   @B @   @2` `?@ " x  " " | h㿐 * : 㿀 , H@ = @ : G  @#$#@B `="# "$##`2&# 2 2 2 ////# #\#``   @ * ;`? X& L _ "_@"0€#`"$# +@$#@ _"_@ @ 㿐 , ` 'U& @"@ڒ ~* :  " 㿐VcP@J> * : 㿐VcX@J4 * : 㿐.`V `chV@J$* : #b2  㿐#`'U@B5 @BM#??#c>"`?#4* : 㿐#` @㿐#@@* : 㿈c'쑠 > & @.&@*& 㿈@@  @& !@'& `V@ 㿐@ c5bq@  N@ `? @ ?`? ` `@*N@ @V@,  , @ @#  & &㿈@@ c5bq@  N@ `? @ `?`? ` `@*N@ @$,` ,@ @ @# @ %`%@#Vc@h".J`".@ְ #5bq` N `?  `?`? `@ *N @ ) %#5%q%@Ƞ L` `?`  `?`? @v *L# @ %%)Vc#Ȣ ?@H'@D@')V@; !@6'` N VcV c N?@!VcD@'@ ,@'ز`!@''܀`/5Vȭ#X?@@' -2 .@],` - @  n@S,`- @ V@#VcѕRX` c5bq@ N@ `? @ `?`? ` [`@*N@ @ && ' @??@֤'@֠M@A-V)V<'ҍ L?@֊#D@'N`.,@+?܂@@@x'@r !''܀ ו%Vӕ@@̯,,`@ @''ذ& : ز @ @L'آ`!@F''܀!譢!V#ةJ?@5 @@+'` @ *  `   @,`2  VߕL 㿐& `"&N@`@  @?Ђ? `?ɀ` .``?` #N@ @ V`@cPc㿈"@@@& !@ڒ'&`VcV F#JH'. *.V앢@@ @ c @0` * @` * `@  *@@Թ@@a@ @p@W *.  # 3 .  .    .@@Ԍ@p@3@{ @X@)@q @ @|@    @ + `  @S @b @^p@    *   @7 @FX@@Զ * :`㿐`)`@ '@Ђ ` ``ɲ```@Ђ`/ ɀ` ? ``@ . ** c` @3` * @ ` * `@  *!'ցbD( 'ցb( 㿈rJ,`r!(` *,!!##!("$b@D1s#Ԁ tY@А gY@ɐ# /J` 1#0 ` @    J `  @ 2*  * ;0 `  #  @wa$!Y@Ӗ# 5J`b. #0 `  ``  J `  @ 2* :`0`  c  @Fa $r@_c&#    rrcc!ː# S @@]@  R @)1 M# @ +` * @ӻ@'Z*`ؘ@̡+ #?@Ӫ'#`Z؁#h#\#d#p Y#x#|?#l#t###@&  1r@# @W 01r.!,㿐 " @& ` @F 0!ț6`r` c"b`` @ҫ  d@> ` `4㿐` @  @0@ !ț6r` c"b` @r  d@ `㿐@҆   @  ` @0@ے !ț6`r` c"b`  @?  d@Ґ  㿐` @ґ  @ҵ.@ҫ !ț6r` c"b` @  d@ `㿐!@?!Ȁ`r!!Ȁ`"#Ā@ #!r3,`b"!r0 !!r`"#@#!Ȓ $@o 3b@# !r#IJ$#ā㿐 `%Ā rcĐ`#c\'Q.  .$5r &!@Ҿ?1!Ȁ`!!Ȁ .&Ā  r  -rĖ#Ā "1?" @" $'?rr@""#  !@!Ȓ $@ # 55r&㿐b@m A %Ā rcĒ#c_'.  6$)r %#!@N?@ !Ȁ !!Ȁ;%#Ā : 3r '3rcĖ &c#" @ $*?')r%#"?%rr㼘`  $## a$ !@>!Ȓ $@ ā㿐#€$6 $aȒ@qaȀ`"?r&@?e c? _? 2$aȀ`'  Y/$aȒ@ԐL%raȀ`"?&@?:$? ;? 2$aȀ`2߰ 2ܰ31?&?в@ ΀`$aȒ@ѧ%raȀ`"??$@ $@ "&܀ @ $@  ?xcH'L'P'T'X`@`2` ["!@`@[&`*@ ""J""ؐ!@L⤒ƀxؔ!P'P'T'X@b@㿐b@㿐 M  " cH" `" " cH@ @   "#@  @ "" 4"Q 㿐cH`cH@ @ 2 @     #@ . 0 㿐#cL# cL cH"[ b  + b ` "[ [⨁㽀 //[b@@+``"`/ @ +```.N`/2@&<.&@Г 5@N~v+`8``.R* N N /"N ?:NN ~@p 2@ @ /*@ +```.d   N?/ @N? ."6N?@:@N?`~2@N?`/2@//@:  ?!sN?`/!s"!@Y  `!@LJ? /??`/̀@o?sN?/+`sԘ`b @0J? ? /z? ?w?@%&㽈@@@@@㻈@@@@@ڐ@` K=/  /+>+>@㻈@z@@ܐ"@Y$  @ήN`/`W k)s#Ԁ 9 `  @@ @  @ω "3NT`, @@ @#Ԑ@x L /; ~@ϒ <@pN`, . /.. 0. @dK`/âB?֚ /2π ~. @xȀ@P  @@h@c 0/@^Ð㿐@s!"㹀@V@@D@@  @J;`/ /*;*;NO耢~LO逢/;'@ / = @,@@@,@`8'`2$@ @) "K`/B?:@ܔ@ؐ@s#Ԓ@@@â@!"㽈@y@@ͭa!@!@"㿐@͊ 5 scА`0@ΏscА` @[b @Ͱ @Ő@| @i (``?8``/" ` @(``28`" "  㿐&4!@J?`/ @ @  /* *!㿐N@`  @(`: /" `K@ @# `@"!" 4!@b"J?/@ @ "& /* *"&㿐   & & & & & &&  & & & " " "㿐䀦-&  `+ @``" `@ 2 @&@@`2` "& @"& &@"  " & `@20& 㿐`  @*4  "   ;  2  3@ `*  -? @`"& " $@#" #@  $@ "& &  `` &  o8 &#& & "       㿐'L'P'T'X`'HH  L` ?@      H&  "   @<  2  2 @{  @*8  : & "" &#" #@  @& "& &  (`%#@ `0"    o & "& &   "  㿐``` `?#` @`2`  @#`@`2`& -& "&  `  @@ `` `@@` ` & `&#`#@ & & & `"@ 8@`@ @ 8" @`@ `@ 0 ` @ 8@`@ @ (@" 㿐  *G  "   N  2  4 @˩ `*&f  "'  `"& " $?#" #@  @$ "& &  *@˞%.B  2    `` &  8 &#& & "    㿐@   *G  "   N  2  4 @= `*&  "'  `"& " $?#" #@  @$ "& &  *@2%.֒  2    `` &  8 &#& & "    㿐  *F  "   M  2  4 @ `*%  "&  `"& " $?#" #@  @$ "& &  )@ɐ0$n  2    `` &  8 &#& & "    J`  (`: K@` ` 2` `K@  @ 2(`" 㻈ה쀢 @ l   !2wL@@ . p "L@  @(`:`K@` ` 2` `K@  @ (`["@ِ@֐a @u @ N@`@(`<K@` ` 2` `K@  @ (`"8!@ ; / @\ @T: 2 !@ؐ7 "!"@ϒ L@  @(`;K@`0 ` 2` `K@  @ (`""(@@" 6a!Z "@{@@v u"@L㿐!@I  .!r  c?  0@L㿐@+  !r    c?0  @ o 2?0|@ X   p< (@ " 㻐@ ! @'0ar#c  @  ?K㽐N@`~" N`@Sd "N@@ .`. [@ @ ۖ  /N`/[ @Ƞ$@"@S  ֒@@ȗ@ 㿐r a\? a\   @#@  2 +`"@ *@Ȳ ?"" " @$@" `  倎`   " @" @ȼ r`"c   $ 㿐@?ra\ a\   @'@  2+`b @*@a #""" @$"`  @w  ဎ` " @" @k0r`"  g $ 㿐ra\`a\    @'@  2 +`b @*@ #" "" @$"  @$  ဎ   " @"  @0r"   $ 㿐#ra\@ $a\`  @`2 `"#@"@" @`" ``#```2"@0㿐 `2    0 `   `2 㿐 f   ` " @`2 `"&@" "   `" `"    `㿐    @   2  㿐  @`  㿐!u  & Dq !n & H i  D      `P,  8  ``",  (   ,'    ,<          !,_,.,>,&,#,;,:,,\,/,*,@,`,",$,!,=,| `?`?, (    ,x,X,n,b,B,N  d@ 8,  `",,㿐 `{ v)ʢ!ء*@` l  "   " !ؕ* `   K$` "@  $@     ! $ Ȓ! ( ˒! , Β! 8 {"  !["@9  "*& %[@2  2!#` `X`d`h`L`\`^`T$` $`d$`h$`L4`\4`^$`T$`X  _$@  j  & && & & & , !ؚ# c0   `" `h @ 2  `&!ء*@`2k  lV $@ ҂ +@  @B l[``&  Y&   $`8   a$`   $`  y  V$` r  $`  j  K$`   $` * "C $ V $`  {&   7$`$|   4$`(u   1$`,n 9  2$`g !ا*` ],ܦ!إ*`"h!  Ā`"d$`X$`T" 8`` `(`$ ```  `,2  2 `!؞!ؗ*`  `" *`@`   #` A a  *` B!ؐ#` *`!@ *  "& + ` @ "` X@ ". @&  t Ð @| 㿈s[#ܴb !`@ m @Ob3[ c@ [[ #c  [[ @ ۘ P @ #\߲ ʛ+`"a @ " ށ` x%s`_ !ʠ!ؒ $@@&# s`" ` `t*  " $ *s[b耢`@ ! '[@ (P #$@N  ['[@   [# [@ r  [c [#\@ f Ք * > s c㿐 ʠaؚ# #0  : `" `h @ 2 @ 㿐o ʠaؚ# :! #0 `"  ``" `  *  h @ 2 @㿐E ʛ. !@ `[@@"`[8`[`#\@@ ( ?` ʕ. ! W` ``b L` !  d` h`5' a$ 8`䀈b!s#[耢`f@N%  '[@ܒ "q['[%[ @  [c@ @ ` ట@* "  `[!s#3[b耢`@! [(@p #/Ȓɔ @Ȗ  <@Mِ [%[@ 2[[[c ##\@V ֔ @f!#[ @H Ȕ  @* "t h c [#\c@4 xh  e'ʠؚ# _c0  X `" `h @ 2 `C ؓ(` 9 `b`b!s#[耢`i@! e[c@ @  b     d`2^ h`2b# a$ q`0 `l!s#3[b耢`@Д! /[@c(  0U@M  [%[@Ғ  [[c @  [# %[#\@ Ք @L  '[#[@c '[#[ c@z `@*  " h `@* "  [ [#\cc@\ lx  'ʠؚ# c0 `"  ``" `   * !s#5[耢`^@A! [@c( k 0h @ 2ޠ `ݰ ؓ(` 9 `b`b!s#[耢`O@! p[@ @  b     d@`M h@`? $ W0@L@  [%[@  [3[c c@  [ %[#\@  @L  '[#[@֒c '[#[ c@ ట@* "   @*  " h [c 3[#\cc@ 㿐 "  && 㿐=  && 㿐 d` @ # `> N`Z``'` "# nN` `. 0. ``@8 .@ ,&@ L.@J?D`'.`"`\" \. ``@9 \.@.``値`ƴ  d " d@#??.@?`?2"״ "֑."Ӵ rґ.ϴ Z`@N $NŴ ô ' 㿐 d` @   2 dN`'*`@8 .@ ,&@ $.@"? "N@??.@?`?2`@8 .`.@ۤ 㿐a1!01#a#cc"@1!h` $ccL"t"|y0v`s#Pb ` k l `   :Hc" ;j#&.`" "  `v0!" " " 2 $"  P .`&'.(`(@.@)``& @ ?@7 &     7ᙚ> .3`+`@@@@ 6.@@  @9z#? 6`.`@@@@ @6.@  @7#ܖ?`  6`@.`@@@ 6.@@  @92!ֶ? 6`.`@@@@ @6.@  @@@ " " " " " 2 $㿈 `6 V $`74?``@ 8?- &&$@@  &6 $', 4`@, 4`4`, 4   . b4 4 . `. a. c. ^. _. d4. e @ @   >&  8  `- 4@.@  0 @? @+`&$ &@m 6 $ &'  @d 8 86 $ 㿐 $++ 6 $;``@C : @`*&>`@2 $ 㿐!@?"!Ȁ`!Ȁ!r?$#` ` `? `? 2 `0  $#  !͐#  $  㿐   @Tm  Ёb@㿐N@`[p@J?`/ /** c|㿐`? @ ar#c   $ r0 h 㽀N` [#p@]J?`/ /** @N 0 @D + $  @R* {   @l9r@4 Y   '耎d''@R* `+a!r$#@ `@Sː  .`U # $] O - ' @D @쀠`?`2 @ " Ȁ`'#` $`!@ݐ  @ې b&& #$ ‎`+긒 ΐ׀`%@ 㾈`@ #`/ (`: '$@  :@8@(@&@ `@@&@$@&@@@( א$0u +*   +*  4 @ (4 @ e Š % ɀ Ҁ  $ Հ$$ ހ 䀥 ဥ n @R '@ &$@쀥  @@&@$$ $`$ڰ$$`݀@$%%%_Ԑ ڀ   R$ %&$ +*   +*  %& +*    +*   W@&&% =@%$ 4[%$$ 61$ɔ$$$$ ((@$$@ %a$& +*   +*  ڢ +*   +*   +*  Ӗ +*  ʠ$X$!&='& +*   +*  $ +*   +*   +*   +*  v *+  X  *+   O +*  Ȗ +*   +*  \ +*  S$ "҂ ё(` %$c$ +*  %N$ +*  E@&' +*   $$ +*  %% +*   $.$$$`,$$ % @*(``` ?#T#L#P#X`L @**`` ?` * *(``` 2 @*? (`` ? @(``"  (`@`   @(``2   Hcc`,"6 @/@В& ` /瀤 @@’&`? . .@(`  `$ "   -Ӵ .@` δ H$  @k/* @ & 0/瀢 @Ò *  & ?`0 ..@.  `0ߐ -.@`ٰ >>@"# ' !#P  ` *   `2 *=``+c?`-"c *;` 0 N0 p   У* <` `  ?Ш ?ɀ`? "@@`C !? ?,@?@ 1@D@ @@ p @ "@@@ "5'&Ȱ  - @ " @5š "1&!Ȱ *`:`J@ ` ? ? ! @? "@  `"  2`c? ` ` ` @ @ `?* 㿐@@  > ;;a(b0      @` @  ` @  @, @ @ @ @ @ @ @ @ @ @ ,  @ @ ?  @ @ @  , `?'@㿐@@ 0 -;a(b0      @` @  `` @  @- @@ @ @ @ @ @ #  ?@@  @ " @ @ @` ``  '@ ?㿐 @ @@ @ @0( @* `   *  @ @ @2 "@ 㿐@ @` @8@("0a(@ ? @@ ,  &'@ @ ` ? @,   &'@*㿐'@@ @@6@ ? @*HP`"d F 0/耦 Q㈬c @X @UԖ&@ ? @ - @`'㈒@z@A&`? `-.(`  .(` ..$`"   - Ѐ`&Ͱ`.` HG 2/ 0..O Fcc @X *` &@   . @`#c@ * @ & `  ..(` .(`  -.`Հ`&Ұ`p+` c0 8` %@"$@,@`+``8`ݰ$@N`-z*; *   l   `*, *@:`   `, *;` ."4?*: `l",*; sbqd `?u`?@2D&@x@c@ %,@&@ @N@MN*@   ƒ *.  @@ <@ *&@ " 2Л*;``d,?`u(  "CЀ$\@Й> $ @&@> @ @ A@ :ڤ"8 @?$0@@@t)@[|"$@,@$@,@㿐'P'T'XP㿐c `! @     2 0`*` "&*0 @ l 㿐c `! @g     2    ` *`@*p @ !c ` @@      (`L@ `u(`@@A! *+\@ c(@N@ `@ c(!\@N@ @`@ #(@`?@ @  @ ,@ ݰ B$ @ <$ @۔ 6$@@@! *+\@ c(@N@ `@ c(!\@N@ @`@ #(@ `?@   @ ,@ ݰ $@@A! *+\@ c(@N@ `@ c(!\@xN@ @`@ #(@`?@ @  @z ,@ ݰ $#\\\'\c0c8#@H''''ܪ$@,@ c\&cP@5$?B ?@,$@@B! ++\@ c(@"N@ `@ c(!\@N@ 2@`@ #(@`?@   @ 4@ ܰ q$@@A! *+\@ c(@N@ `@ c(!\@N@ @`@ #(@ `?@   @ ,@ ݰ @$\#X@ "+!\#`@ &'\`,$  @ ,!$8 @,$ @ $N   $h@  $ DDDDȜLDDÀLj8t\DƔp@~@b@}@}b\@{'Ē@@ @k㿈 T`@@쀢`8  d @ @  @ N@ `  X`  T``0  8`" T``{2 T    8      `  㿐 L`@D㿐 ,"@ *  * $@> 0 *  * 㿐/`@ @ @ ,  ? @ `2@@   @ `  @&㿐  , @@ @@`@&@   ?@ ' @:  @` ``   ( @@ + `*@  ` @ @ *  *@"@  $ @@ + `*@  ` @ @ *  *@"@ @  (@ *@`@ 2 @ @  $@ *@`@ 2 @ 㿐@ (`@.`` `@`@&  ? `8@? "@  `"  ?`< `"  8     `2  "@ @ @ `?*㿐'T'X{T㿐@  ,` @8@@ ? @ ,   &``@ '㿐@'@@ @``    ``2 "_ !L`-K `+T @??@s ! ?В ``  `? ?ɴ?? `8 @  ' 2'`   "'@`1 !#    2 "`2 0    ! '@' 㿐@'@@ @``    ``2 M !L`-A `+B @5??@ ! ?В ``  `? ?ɴ?? `8 @>   2'`2 0       ! '@'  "'@?㿐@'@@ @``  ``2~ !N`-j`+u ?? @R# ??#@Rc   % ?Ж   ?``?ɞ? ? @87+@@O?> @ B 29 2'`(  8  "5``#` "'@`1  13?#c)8 @Ֆ@ Հ 䀤` "` ` ! '@'  ΀`Ϥ " 㿐@'@@ @``  ``2c !N`-Y`+Z ?? @Qo# ??#@RAc   % ?Ж   ?``?ɞ? ? @8&@@N> @ B 2 2' !`$ !`8 @@ 怦  ! '@'   "1?3?'@#c㿐1#&@Fʁ9?#&@FāH逦/ !@ * @ ' 0.? ?@ * @ &? 0 /$8   -.@ `٢ @H@ /耗6 -c @P *`  '@ 0 . @ @ * @ '`0. $8뀧` 0/   ¶ -.@`` @h㿈\`?+ 8`@"@ 8`@ @ ,@  @ `2@r@ @쀦@ k + ;@ @+ ;`҃+ @ `N@@"ݠ@J N@@ @B?`< :@5?@, @"+`@, @`@"!`@ ", `#\#`v  @"?N2׀@?㿐\ X@@@` @  @ dhl' $./ /`8`;`; N@@@+``%8`@*@". **`@ @  @ ? 2N@"$ %$@ ** 0݀@ *** ^*ڔ "$@$* ^*   ( @ J@`." ` "" J``02"   "" J`0" " "@ ` @ `""@ `@ * @"@  `Ē " "  "  # @  J?` ? 8J?" 㿐\  @&`"4 &`, @@  2$ " '`'@'`@ @@@`ܘ @"   "@"`"` &"`"` "` @@ ` @ 㳐  8. Q . P. `   @,  8 2@ *@t`"t  4!! *`4 @ `?4 @ *"2  @ 2 2!!@E  4 ")44$@ @ <$4@m    8@ 4 8 4 `? @ @# 4+ $ ؠ ,@& <   **4"4$ *"$    , _  ` @ ( 2 ^(    `p   ? `  `"@ "@㿐@@ N@ `? `?  @`@*N@' !'@  :'N@`- `? *`+`@"'` @ @Р  *  `@ @@ ff '"ò @? ނ"'@ݞ` ײ`!&ff a&@ @?Ђ `` L g_&ff4`, ,`@C@ 2 @C `@ #  @9N@`e `?`E`?/`@+N@`-`?2``+@ @К ` +  `@+ :.ˀΔ `Â" $ 59?u`4D ᘀ@ 4` `` @ 4`@+ > 4  @#@?Ъ ` `@*@'@ǐ  pC "V'   8 "`'@`' !>`'@ 4y',!0 @@Mܖ2` @ @L͢ 2`Ȁ`ĠD 2` "''@3?;?cwc  s )?n#`@ 0P@   @ "'@ "'@Z@"n m ff&ffa !E54`,   ,`@ "6'@ "'@( "'@ '@ H+ +??`c#F 逤@О 8@`@݀N@ .ـ`@Հ@?К`` (`̀    2 ^ 㿐@c /``&& 㿐@O &㿐@@ /``&&㿐@ @@`& ?@&@:  @` ``( 0    b   ? "@  ?` * 㿐@ @` @8@ ?@@,   & `@ '㿐@@ ?@@,  &``@ '㿈\`?+ 8`@!@8`@ @x @**`@`2@i@ @퀦@ b + ; @+ 8`ԛ8`@ `N@"ݠ@A N@@ @9?`3 1@,? `! `@"`@2`@`#\#` @"?L@瀦@?" ` ݤ㿐@8@@& @㿐@8@@& @㿐\ @&@` &  @@   2"   '`'@'``  @@`   ## # &# # #  x d` \`Pd@ S 쀤h@ `?@ @ @ @ @ 7, -@쀥 ""++ 耢 `@ @  3  '耢 @  @  '쀦2@@ 耢 ~ @耣`쀤@ $h @b  @\?@ T 쀧@ C @.@ Ȁ"+ 耢 `@ @  * '耢 `@ @  '쀣 @ֲ@?@#\#`#d4 À@0@@   D?J` `"@< ``8 `` 1? ?, `* @ "@& $   ?  `?8 ` ?8 `   `* * @"@  -?`  ?@ %#@ " `?  "* g ?# @   `?2`* `??2`** 㿈?@ @c@ {N@B@`' .쀧 `@'쀦 d  '  [ ?@  '@" ?".`J@@ ζF&  ?6 .h ?7 . .``3``` 8.& `` ?(`. ' !` & ` `?& `? `?`(& `. `.?@ " & 㿈@@  @ ` 3@8 -`' *`쀣  `@    ? @',  &' ?6@~ ,  &'@@;N@ @``3```-` ?( `, @ ' !`` `?`? `?`  ` `* (`?@  $ 㿈? @c*' / 쀧 `@@'쀧` g  @ F7 `?.  ?7 .`9.@N@ 3@ Ӱ```,` `` ?%`. @'Ű & `` ?8.`?` ?`(& ``. /` ? @" & .㿈?@ @c@ |N@C@`' .쀧 `@`'쀦 d  '  [ @ ? @" ?".`J@@ ͶF&  ?6 .h ?7 . .``3``` 8.& `` ?(`. ' !` & ` `?& `? `?`(& `. `.?@ " & 㿈? @c+' / 쀧 `@@@`'쀠` g  @F`??7`(. `?7`.` 9.@N@ 3@ Ҵ```,` ``` ?%`(`'Ĵ 8& `` ?8& `?``?`(& ``/` .?@ # & .㿈@@@ @ @\ @<`' @ ?J@ W @`' ?  * 쀢 `@ @   `*'쀢 `@ @ @`'@@@ @ @@ " /`@Ȑ?N@ @`` `I``?`` ? `* ' /` u"@&# q&`` ```@? ` ? `(` '  `? ``? `?`?8 `18/` t `p?` `?8j `?`?8d `8" 8 \ # &@@O "'0@ @?`` `*+` ? @ &K  `*?+` @ &7 㿈@@@ @ @\ @<`' @ ?J@ e @`'   * 쀢 `@ @   `*'쀢 `@ @ @`'@ @ @@  &Ȟ?J `` `=` ?  ? `*@ ' &' @"   ?:z `  `s q `` `+``@? ` ? `(` '   |?  ?8v ? `?8p `81 8. h p `l? ``?f `?`?8` `!8`X ' &@b "&0@ @?` `+` ?*  &@4 ` `*+` ? @ &3 㿈@+` z @J@`w @Ğ @ @ '쀊B  @  @'`2& +` Y @J@ "V `  `   ```M`   ` ? `.  ' +    `@  @'`@ e `b`B`` \ `` ?W `*@ ' +  @  `@  @ ' @ ` C# ? ` ?9 ?` ?3`. `. `*?@  &@  `` ? `?`?`  `* `*?@  $ @0@㿀 @`\#`#d#\㿐@ @ 㿈@?@A @`' / @ `@@`7`.@.``@''쀦@N````` @` ?`(`'Һ @ @  .@.``@*.@@ *$.@0"@? `?ꀦ@?``?〧`? ߀@``/` . ?@ "  @ B J@` @`#d: ``6 `'``0` , ` ?& ` `?8  `(  `* * @  #d    ``? `(`@ #d #`  `  ` `  㿐c?N` ڸ bHN@`2#@ @U Q N?Ѐ P@ `/  @!`+/`1pк#i@ @@;ڂb@`,@`?`@`?"#@#  ?7O O & OO8.   . .@#@ #@ x\cc ``??` /ڔHJ`.z v? @@.?Q?"@  ?ְ@cȐ ? K P?⠚@ ` ?ְ@c? !@ ; P?P@ `?@?@ `? ְ@b? ! % P@7?6` 6`6` `  @@ @@ ?  ....! ג@cȐ@> ? P@ǐ 0.@ P 0.  @c? "  P? s#" "" `,`4`0" $" " " 㿈@ "3`$`$@ d` 얒 o3` 2l` ``@(h``8e`` *  `?@ c@ 2_``*` -*`@< @ ӂ $@`$ d` `` `@` /`@ 3 `$`$` $``ݗ*` @$ $`$ ױ*`?*? %?!`!4`@$@$` 4` :`>c$`?%? !! >>@$``` $` `$`$@4`x d'X` @ = `qX@s@ $ , `+@\5  ,4 @ @@ - 4@ @,``?@`?  @ Ȑ  @@ 2  @ 2 @ @耣`ז`\@ $ @ @ $  @}@  퀦@w?@ o X"P @F@ '5 ,*` @% 5 4 @ @,``?@`?  @ ,@Ҳ@ @@0  @% !?@߀ @  0\`#\#`X @  `. ``   @k  'X'`?P/p?@?H'\'d'h   X e  @` J `? `?  " &5<6 ` ` ` @`耢\?   @ :;J u6  $ ?К  ??`? ?ɀ`$  ,@ $  @8J X`" 8 ?-`#`/pb铒 ~  $ $HހX``hX`X??' N'D ` (I J@ `? `?@ @  "`&< ` ```  `\( ` @:# J`u"   @ @   @X`" 8 ѐ1`/`/p" $ `*$?X?`'h'H\d`$`)`0L H@%D# H# L# P# T#    Xh'@'L'P'T h'HT'T  P 'P'T$  W `'L'P'T`" 8 | !``/p"> &R @$ M  @$@! E @!0 @  `*- ?u`"      $ J`<    $  J`<`   +    $ + & ,& 4& 0 7@ & 0 @:  0 &p#?c *@?ϔ@ ̀`?ʀ`݂   0@2 *+Ӥ` +@@ ` "  '`` '`@ 44 'd4- 2"4 * @ $@  @ @ @Ɛ  @ڔ(4 @d@  @4d+   @@” @4 @ 4`" 8 ㄐ5`3`/pbF`" 8 uh!`;`/p"c7h`" 8 f9`7`/p"($ ` `   $ J@ <"   J@`<`  `$  z `w $ ?К`  ??`?i ?ɀ`&e  * $ ` 8J@[ @!UȔ!!!@  @> "`?2@ 2 /`8`?6& @!UȔ!!!@  >  "@`?2 @ 2 2:,4.@ @  # @& ,4*`      && h d UȔaa@` ?@ ,  &' ?@@ .  &'`ƀ : hUȖ@aa @  : .@.``@*  , @ 4*@ :`.@.``@*.@.@㿐!! BU! `    6$a` ` :/&@&@a&`aa$*'`1`#0a@Δ C` $a $aJ]2 J `]2 J `>2  $a&` D&@a&` E(@   1`1`@  #H $a#H  #H@  2&` $a&` CLc@@   $a&`@L@ "`? ' `?3  g$a@L  `$a@H`J@ &`aJK"U @&@` U!  @ `I   &@ @N SUa H U $a  `" @  $a` ` @ &`Ua `  &@ :# Ia ? " I? &` I@$a@!U! ` &`  P! @ L`/ ?@*L (`</"C@ @ "   Ф @D`',  @8`, cP@Ζ  !$`  ,&!` "x@,`x @ 㿀@ &!&! &!&!:AN K`<k '耣  K &!H``< ' @ =U! @ `"e   & @2 ,耢@ ̀! `Ȕ" @!!*KN `s ['XY! RUaxtE!ON& & & & & & ` ـ@ Ua ?@`Ҁ@ ?& `. C Ʀ D ?! ''쀠`#@ !!Ӑ  /΀ ! ?" I0!"@"y`&  /*!&!@c!&!* !`0`H"   ے I S/ђ =7 S `? I `?@ !#@"y &  /*! &!@!&!+!`!#@x@   I `? S `?@ !#@"y y&  /*! &!@!&!* !`! 䀣` @ @ƀ `!&x@ h `t!&x@i D I!" > 8>"!߀`3`(`"@€//?O  ђဦ>  ڀ>" !3Y\#S d` & & &     ˴?߀`3 '`'(`'`㨐 1`@# ?߀`3h'`'(`4߀`3:5`5(`d@Ā!`# 1`@˒#؂ %` 1a@Ò Ђ #a`0a 8!a @a`Pa X'a`a`hapaxaޔ`3a۔`5`ؔa͔ 0aʔ`8aǔ`@aĔP5aX#a``a`hapa x3a`%a'`5` 1a@s  a0a Pa`X#a|``3ay`havpasx5ap%am!`j#ag 0ad`8aa`@aҔ8aϔ`@a̔`P3aɔ`X!aƔ `%aÔha`pa x'a#a``#?߀`3 ` (` `㨐 1a@ & `##a`0%a8!a @'aPa Xa``a`h3a`p5aޔxa۔`aؔ766666666666667t6666666666667h7\7P7D666787,7 666766666666676444444444444444444444444444444444444x4l4444`4444444444T445\5h5h5h5h5h5h5h5h5h5h5h5h5h5P5h5h5h5h5h5h5h5h5h5h5h5h5D585,5 5h5h5h5545h5h5h45h5h5h5h5h5h5h5h5h445333333333333353333333333335555333556$33363333333336 666666666666666666666666666666x6l6`6666T6H6<6666066666666655t `Ĕ!("! "!"!$"! ! !  K@` " ` 8K@0` # !!   K@` b?` 8K@㿈`Ӥ  N` `?` `?    !L` `?` `? 2 " ! + : - &L+ + 3 ˃: cc\`0 ?И ` q ` 8   * Ц@ ` @ 2 |    ,а@``  @  ?К `` @  И 8 +`@ @ @ % Ф ݀8ڀ @4  4@@ D3`-`+`D3 *+ @@B@ѰF?+ #`{ !%& IJ   ?&!_ #}#+ c: `0x   " %L 0"t %`  <`N `? `? ǨL` `?` `? ?+ #`6 ! " !8 $ 沐  @4~b@B `p%m`$ U+ @ @4l @B `^%[` 2 , *  C3`* +`@C2 * * @c4*, @ B  2`* *4*`@C*@ B 3`, 2`+` @ BD%` "  8 ` ` ( `?  " 3 `&  @`?@@  "* &? #@  +   * *  #@ +   *  0`#@   + @*  #@ `" ; ?` 5c` `## *`  +`  *`+`  +`@ @ +` @ @ B # +   * ӓ0`#   +  * @  #㿐666 '(++@1?#6`?+@+` +`;?c6`6`?+@+`666.`.`.`.`.`.`.` ` +@?+@+`*`*`㿈 @08 @  @@3aȐ@ @  @  .#* @7'*@   &a ?` ?&aȐ?㿐.` _a"_@ ?@ V"XT"?1@L!* _" XUbc"_㿐!'T'X& X _ݺT7"_㿐  /G㿐"`" " &"&"&"&"㿐'€`Ƞ" "܃2 ax`  ``@"ܕ2  &@p"  "@d&@` ``@"ܕ2  0Ǭ &"&"$&"&"㿐"܃2 `  ܗ3 !8`?`?@1 `T`ax@$ @ܗ3 @ 8`!܃2 `k `` ܕ2 +$@IU X$$$` &!Ț ?#U$$g䀤;b#*a?`$Xj__gX?@ؐ $; .   (`2$X" L #>_!U"L_a_!c ?$3?? ˑ* c?`% / ?ax@ '+a?@` U"$X__ / Ű 㿐9?   `""  + *`3`&"  (`*2`&"㿐 4    Q#@ "$## "#  ؒ    (  ʒ  ܁@#`$# +@pa cX'ؚ'''''@%ɖ؀` J-"J  2J0-2 =J  *  -ڒ _J`2*3U c(@]  "8* <@  &  "ִ@& " @ 2   & u < & <n 8 & 8  &  aS "Y ( & ( "O  &  ,` |   ' ,@'С*  "7 "0 f y&  du& s. a "q  V i&    . ]c&  "a $F Y& $ "W@ R&  @ "J. m G. m D. l @ ?&  @ Ub@ 3& 51a#x@̔@  ")@$& X !. ` . _`& #` & ,  @'  }@MXOOOOMNOTONNNNMXMXMXMXNhNLO|NNN<POPMXPPtMXPdPPPPPDP*@ @   0`@  @`""#@  "`@  h.*`(`~ $@ "" }.:Ȁ D +@  @    `٦#@ " @ƚ &`Ɣ&  Ǝ&  ƈ&  Ƃ& |&&( &8&4&,&$&0`  ,*0`&H   *  ,(` & &L  , +2&@ &D  @ &@"&``~&&  T ͒  .7 8`%a C*   @    `K#@ " @}& & w& `   +` * @ &` @&&0&$&L&&8&4 B&,` (`  *0`&@  1&DC   &@"&``&&  T  #  #% &&<&&&< ׀ ` &@  gb _a\    . F 㿈S?ǐ  8 0       & > (& 0' ``C > (+ }.`$ v$ %@ ?@.% @ I"@@0,@@'쀦`  *$ ` @Tw?% @` @ T-`"?S '   (8 (%  ,`@ ,5 '"  +`@.6`'"H #UĜ #Ub䀧 !'' XlՏ _"_Ռ2 8`Հ Uā U䀧 '' X+'%cnl " h   #a[!А 㿐  d .  0#Ȁ #Ȓ @U"&"U&"&#&#&#="_  &#\.#e.#.#'ˀ ! .#'#c%!Ђ   㽐#4`A 1sc0`!#ܔ c4’ @ @ @ "$bb&#܀I c0 "4#U!b! '#4:  &#c4͢ @ @ @ $b  "$bbȪ* a$baca#(   1sҐ1U'"͚#$Q Hc4$b㿈@#\#`#`   * :   " &" 㿐#b`K c 0Ub, `X 0 ? cb* X$ $  w  1$ b< (b< 0b< 8b< @bb $ $ H$ L Q$c$c$ $ $$b$b$b$b$bb䀤` '$`X]`_b_Y 0 #!k㿐f#d#b#`#^# \#(Z#,X#0V#4T#`#$`""`@* @G @$ِ?" @d 㽐bؐ!`"&#U`(b``$ ,&㽈 `=" "Ɣ  #\#.##`` &"&"&"&"&#    %`"ܗ3 c ``@ "ܟ5 W&@C"e &"&"$&"&"t""t"x"##a&#&"&"x&"t&"c%#"!` #%U`(``$ ,%N# " ###.##"##`2#N# 0@ &ax@ ,€N#j qf 㿈#? "`'"" $"$"$"$" '`27"# PU* ;`f? " v . ِ<""bB<"0`   ` @* ,3``$"'$" @ D 0R`>`"4  @? ?`ڒ C  " ;$" $"$#6 "䀤 *'$ X _"_(   *@ *  0`'$"  ,` *2 $"'$"n쀢    $"'#!$aҼ" 㿈N#X`N# #\#`# &#   * ` ` ^* * :㿈N#X`N#  #\#`c`$c   * ;  c   .* * ;`ΐ* 㵈"܃2 `\`@ U#(&#&`&"#, ``"#,S#(Q#,&#,&#(`"#N@"#"#N ##a"&# "# O`"# `"#"# `?&"# `? `?"|#ts`!a@͒# 2p#޲# (  @ ?ע @ &  n@& 7 k n/" 23U`G&#@* `2 x@"`T#`V#P`2& ," `&"@*  29Uڐ?U  &"Ua'Z "ܻ4` `"U@ PbU`#耢`#`5U` ` )a'ᰒ!S`,  @ ?0 @! &  ? 7?@?":'7 " 2'`U'b& XlL _I"_"ܻ4` `/€`"ܳ4 `Y `` "ܷ2 3&@" '" &"&"9"'!&";&"9"t7"x5"3#`&#&"&"x&"t&"Ð ax@}  @t &'sy쀦܀ 'b@ِ ր )aӶ ``@'& X%U&ax@T     (` *`   -  &"Ш#    # @   (` *`2 &"  K &"  +`@* 2&"$  r "* &"N#d N`2@" 2S"@s @p  @j  "$ #\#`#d#h ""p@Κ"| ϒ z&"t'7U5& X$O`@t#`"#P@|#Pm!a#3`(& X3U%b t X2 "Ub-;b` ';a"5U`'7"ܐ#S N#d` -U;'aȒ(@B "9U 8  @e7s#c%U Ӓ'75b"⌘H';b 'aȐQ &"x""pb"|  "# #(@ b2`&"; 2"ߪ bJ5` ,4`4`/////&"N`RN, "3`[ ,    "`D$@q*  2 9U@* C9U7)b"⌘ xL',  &"| ,6`6`5`5`6`5`////////"/ @ ϑ 00"`'*"ܐτ   &"  ?̀ " `   . P"'#$@'#\#`#    *  X'2"U"b`'I" &"#$`"^N#W`@,`@U#.# :P.#@N#XN#T#\#`#`&#  @ * < 2"#€* 2"" "צR ""`  `Q#@"$##"q#`  ے `q`(` j.#N#WJ"ܫ4 `s@2 o B 2#\|*  Y` "2``T` Ŕ@h * `%U@* 5%UbbD' X2A"U"'bb7'~*  ""0"ܒr* @#`$#(@0d ` ? `  Xg2")U-!b"!'݁㿐#"`b #`2U"+$#`X0 0 D X#. P& #& "" 2& "> ("> 0"> 8"> @ (">"& & H<"& $#$"$"$"$"$"."䀤  '$ X  _"_  a##  1U"䀤 '$ Xa"##!a!А 㿈 `2+ N P 2  #`<UN Q @? ܖh (-*'?$ XĐ _"_ . P Q# $#& y `" & $`@& & $p$#& k ;ˑ*a'c9? ;ܐa H  Ɛ?ր   2  '쀥! ?` % @ 3@$'$@ `- 쀢?$$@ ,%-`C  >!& $   / @-5`$"  ,+ 2$"U䀤 '@$ X@;"a㿐 $`   `2    @ H 㿈`8 .`!x@ " ,  k   ' ,@ؒ*  "| &x &#t "#  "]# # `&# h #4H `  #0@ �X N`"G# #  &# .#K N @ .#eE .#dA # &#`; &#\8 &#4 &"0  &##   &# .#U& &"" #, &#, #( &#( &# +@&#  & ,  @ ||||{@}|{{{{{||{8||||t|d|L|<| H  Xc  _ːa㿈"@g  @a  @[ ,`(`"@. +@**@P's#0`$@ Z  R $@4 @.  @( ,`+ "*`(`@++  @' @P #ba(@@LX`L`- #\#`$`   * :2 $*  "$$#X#U!b'$  ђ ؗ* <җ* N#`Q"쀋`O " LU   ( " @" #@ "|#`#\/'T'P"p"t"x"F"؀ "H"J : ##/`B/!!' 'U`4$ ,}$ "z``"3 `  ` 'Ԓ Ub&"쀦  '& X` _"_\ 0W#!Ȑ @ L& XI _"_  @&#<.#@##"&##@"&##"&##@"#cc@@  +?)?c#>"  #@\+Ub'U'' '''   '//Z/㿐``_   ``2 "ܑ2` &#'"쀌 U'U%& Xߐ _"_ܒ *  2 ,``2 #x@@ ٪. _"_& XÐ`?/?c@ >"@ R&"`@ ۚ* ":, Xdm/`B@ " W"l &"&"%&"&"Ր*  ,`2"ܘ@ *  ",'#U;& Xbay _v"܀" "ܱ2 ,5=` @۫,0=`"ܗ3  ``€ "ܟ0` &@Ȑ &~8 `?&"ڦH ax@ '5U3& Xb㿐 d @ ! @`?@ @2!n!m!n㿐.``">66`2  6  "0  `", 62/   "+ 5UȖ   (# 2  2 @ d  @!`?@ @   &   8'P'T'' Z cP ``  "O  2 E'0 @  "> V / x" ` +` `> T" `*`""'J . `, c0 `    `   T&@E? 7 P '''''' ` ?  @ 8  + +  . =`c0  @  @ @ c0 `  `ޠТ  b* @ `Ѐ @  *@ &* #Ђb?{  ` ` @  "N !@#0 *`` @ `2` `" ` @ `     * "/   ` Ђ `` &  * @ &`?`?    ' ' x /X xҐ  8ϮN `M `?`m`? "ŮN p`? P `?"T   'c0  @ `#0  @  2 0 `  ` `  ``N`."    T2]   T%@ - @ /``?P`2ش "'  *     `*  , `'& +& +`@?& + & *?& *& (`@?`8 ? # U*`ظ?@3 $?&   o@  & `?@ . E'Ђ'l&` ` `` ` `;` ;H`` /P @  5`@2 @@ T$@& &&&& &&&&?&&&& &`& " U* ؂@`'& T&&&Ъ  T$CP3`` P `"TP7 ` UcȐ ?@ ,  T'@ `   /& P@"  @ ` T#`  & 3`ނ ܂ נ @ d  `@!`?@ Ǡ `Ġ ł  ;8/  ;( ) @@+      ;#F" " " " @ "@"  2 cF ;cF2  ;2  ;2  #F p.&0  `` ݒ @ 2 " N-Ѧ ̀` А ( c0 ` @   4`, ,`*`@E@ =`2?А < B  ! `  ``4`)#0  &@  &@  `2 &@     @ P ``'ئ  !V,0L     ``"$*`+ ;`О  " $ `   *`$O &@N@  @ `Ͱ  N M`?m`?@ Np`?P`?(a @  ' & &&`;耢 ; &&& &&< . / *Ԁ?.Ԁ`8`&'`?$ / VJ`N/  'ؐ@!4'ܔ  d@!. @" d' @" d'䀤$'N."F'耤*9VNe`?E`?" 9V cP  `2 + :`-`?`+`?  9V    2ְ 9V b0   [  W  @ ``0    ` "'?И    )  ```" Ђ 4, ?  ,D@7  E  `` @ 2Ѐ s Uث- @  :`@ 'y&@o@ <,ح,@ %@*@s _@ +  >  ;#F& &&&`&& 5P % 2E P  ` ""/ ''ذ    '̐+&@`?A`?2ڰ `&" 2 &#F8– ;#F`;&&& &&6'&'&@2& ;2&2 ;&'l'(gЁ㿐. (`@+ .`"@ @ .``` @&@ d`> 8`2` 2 @ ;:&@?8        O''''''耢`E'''Ш Ȁ  `"'g@ $ (`@+@* +`@ "  *  @ $@V d> 4`8` 3@ :@<& b#@ * *"$ +`,`*` @ # , . * @s#@1'@F r  #@N` @   "* +  "@ " (`* @ #. *@" @ '@```  @ 2`"D + " +"@*&@ ''s `^  `2^h'4?@ YW@$S   `ꀠ`B _? 'L@ 2 $@  ` @  " (`  *`" " +*& @ + +`"nq" * .4?@ $ . @ " ' .*"+"@ @ .' .8@~ '@}ؚ'lsЖ.?"c''''c" "" " " " " " " J  bb`a8a@bX  cP  b`@`cPa`㿈  #\#`b   @}ap㿈 ``. )(``@@.@% N b a8b!Xba@  @} 03ba` @} 0   b#\#`p  @} 㿐'&&&& &&&&&      #?   " & <%%'9P0 E cw% )Ѐ+2 aG E  & )Д "@@*`  + @ +`@*! %#@}&@}#@} d&@} d&#@}ؐ& @}#@}В d&@} d#@&   6/?7?ز '?9?Ѳ#`퀕;ꀕ ;瀕  (`"66  6  "'6   U#Ȥ  ` ' `Ú Q^#? ('lId(&  '-"Ā(& 'ǤA1&%-5d3`,`+`@  d*3+@ F@5 . -@- G2 @ C J& @5d*2*@ @b 5 .`- D+ 4 @ , 0'9P? p& )2#w))+"䀥(e& }o"H-5c6 - . @d3`+ +`@@D*2@*& `} { w @}V d  @}P!`?@ g d d 㿐/` .&@@/ . @. (`@ 6`. @.`f7`/ /`@f +`/` 6.(`& @ G(`.@ .7`. @(`/`@F +` *  @  @ * @ (`@ * *`@   +` *  @  @ * @ (`@ * *`@  㿐 `` l 3+(`a@@ / (`&.`/`@. .`@ R O / . @.`/`(`.`/ . &@/`(`@./`@ 6`. .`f7`/ /` f+@(`6.@.@ @C/ ./ 3`+ (`@@+`@G H㿐 T @{ה 7   & 0&&  . ,`X+& d,& `   |,  dm & T?0`-,7,3,`aTb\,& & l& |& x& h,,,9-5,!,c$# d!& & & & & & p& t㿐 ?  W @{ 6, $ 0$B$ +,#X,$ `$ d`|,d$ h,aT#,,ab,,,$ l"\c$#,,$ |$ ac$ x$ $ -,- d$ t`#b$ $ $ p$ `a 43ba@z  @|@|  $   $ T 2  0㿐  0` T @ Ta ab㿐 X \@  @ 8@{  X%$ X81" T@{@ 8 @  T@@$ \$ X@z0&!@{n`<㿐 2` .`.`  `& @  @{?&  2 ` 㿈    '@{  耢   ? '@{ 2?㿈 0`.` `2  '?c @{l 0''aȐ `?`?   aȘ `?  `?@㿐 0 ` @{F 2?@z 2???&& 0 4 0㿈bN a耠`6  ' @{!   $@' "6J `" $"@"@㿈.`#*@' 77*@z 8 0` `?㿈?c '耦``'`@z㿐& (  &    (@ & & `. \. ^& H& 4& 0& . _. P. L& & $& X& T& `|€ 㿐 & 㿐o 0 ,  @ $ & X. \@   & & & & ( $ 㿈.`` '7  @zn "  " `h @ ( 4 . \ & & 4& 0㿈'L`t@  \` ? LP X,LL@@ l$@ $2LP3 26-  ,L@ @ * @ `?@ "U@ : @ @ "@ ٦`d Ҁ$D? LP,\$X "В- > `pǒLɒ  0`L@yL@ *  2',`2,`,`L,@L3`,`L,`4 $4,`L'L p@뀢  1@ $,\$X,L   *  @@* $,\$Xq1@㿐N P` P?# (@ 8.   "/ @x   @ - 2  & &@ P+  " (?#& @  " " 8 @x &    (@* @ 㿈`C ?c 4? c 0 & 0/ ///* &@* `8 0 066 //& 0 //z*   m* @ 㿐   @ @  @ & N P`+` 4& 03`㿈@?`#/쀤  .? # #@? 0`& 0////6* R ,*  H"* B 8 0 04 4 //& 0//* , "* 2   @   " ? @ & N P "+` 4& 0+` 2  * `ܒ  㿈`t@ N P` ?  &@  $ . L   h $H$@29  $@ 0  c N P& 4  & 0   ,@ /`&@ (`  @@ ,  `@@*@ (@ 8@ , V$& X. \ `;`  $@`"j. L1-`@ * @ `?@`"+@ @ @" @  d  . \`@* $E?& X`9?-<`pŀ1. L p +@o o 0  @ה  "$& & & & (  * `  @@* $. \& X?+@. L㿈N P`U  `  , ?c$-   (`  +` z @  UD  $@ "$& & & . Mc, $  M*Ѧ$& $?<  $ @ *  / $@@w א? "# $ $  ?& (@/ $ $@@v @v @$ & X. \? @& $?# " $?2& $`㿐 `& <`@㿐 `& 8`@㿐  @w  `@aar`#c $ Րa㿐!sL!Ѐ`!Вǰ 0@u  $J?`/!В! /+@+`!r#c ?㿐N*``~: `/ `?N / s#Ԑ 2 㿐N` `/N `ba@u " L!r`/#c ~ +`>`/3ss"*В $ 0L /+`s#Ԁ s s3saO!J? /aК" /(@ @*`㿐@u /@ 㿐@` ``c 6 c0`T J @ ( KK @  `J  @+`* * :` 2* J  * :`S`* `,"V  2  +`"3 "0  . `ǀ`  L"? /8?`, @ ( K@K@ ’`J `  @# L #0ҪՐJ?`# @t֐?  @@ `0  `-``㿐 k -N``!ba@t b@@t `` @uP @t+ b!’!@tp b5b@ @ti`@ 2@ @ (b `*`bb @`@ ( b`+`@ cbc *㿐@` 1 &N  & &N @ , @   N @ `, @ @2  ?  @ Nߢ@ &    㿐`E   ? @(``$ 5 @+` `$ `$$$@   ` `  "@,`7 $@  . "$@  $ 㿐'X'L'P'T`'HH  L @  @` `#@  ` 㿈  c   @sT  쀢  '@7 *  i 㿐'&& %b'b)b " @ ":$@`` "'@`퀦 @z"` 瀦 @`'?   @ 2$@@d0 "@`&?ZH "@ &?pВ?@s_  ?bН@r?cG'D'X @(@@rِ8ư :t N~ . !b"   ?X@ H   `)< @# "+ @y  1?!0%?!???9?#48a#<@@@#@@"%/@r :!#0 @` i    ` 2 + <#`?; `?@ ސܒ/![?cG /``EF  < `*`8``#:`  *`;`\ `?+`?@2 J ( *`: ' `?"`?ݛ< +ڀ`< `"Ԡ@ Π 'b`@rG  *L  @* @r# = ;cP   `2?%0 `    `290` ?  ? ? 2?*N" `?'`? ?@:bL?"] ?b!bߐ@ &@ =* ?      \N \* 2N7?*@@D@  @5 ?@"*N`n"*`s`\"*߀`b`"ـ`'"*** Ԑ `sՀ`t`r2**X S@qi#0 ? 2?*b’b@q /@qd !@  ;   ]@q[-?G @ ".#0 ? `" "? ?` 2?" */7?8f?c8D  cP `      2 b"@qF q%bc0 ` ib "   `2 @p#0 ? `  ? ?`2? *!b #H@p 9  5` ;V.@ F``p@p "k `2@82)**2%**! !b@pД  0  "/b b   2 @py#0 ? `" ? ? `*?* bXD oː!b`#H@pz "?c45b D&!?#4b☂XD @Ic<-bMh&%?<@#+b`c@pE3/b`ȁ㿀/s'D@'T%"@* @ ''  +b-b;b`" @ @ "$@I"P 퀦`9b` 瀦`$` @  @ 2@% &`+s%c䀣  -s% 73T $T1b" š L !h9cb0 " $@²H "`$D T)t 'b c ,☠ N`"#s''@ DJ3V``TDx !7cH  @o 2@o6 T g  $Ϡ !5cc@oq 7c)c@oH x%  @of7c#bb''@ DJ%V T D7  2 6!7c@o + `U  `-`@@n%E *`%@o^@oZ`倣@+`%@ $$/㳐&  y c`$@$`$`$` $`$`$`X  @ o  c`ҐH  @ _  'bc ☀@  3  @ J  c@n   @ 5    @ %  c  @     h9b"''@ J`V`c@nTې t@n0S "4 `=@`3(+s .)c 'c`   "`@J@ `O! ~ A@n\  2@`@`2* 0* " 2@c(` @n' 4@m"㿐!c!`  @n @`  @n @n$  ` 1s#"1c@"1c @n͐  @n@#@n  `@ 1c@m!0" 'Ԑt `    4%c@"'̀ ' 'К `@ `'Ȧؐ  @ * `?3!c5 H @m 2@mf c@mwbЀ c, Œ$  @"   + @  #&"" " " " " " + Ģ " &${ Ș''8'@.`$ !cܕ,`&` `$@m*  "&&  ` cb@m` ",? 2 ܘ&&@&`&`&` &`&`&`+ Đ&`$ @&- ,* , `@mg`&&Ө 3cb@l  7b@l@lƐ #c, @lϐc8 47b㿈@(`"@ d@m*   &쀢  '@n@쀢  &@@ &@&00& 㿈@`1(`&) "@ d@mƑ*  &  '@m@쀢 &@@  &@&@@lŐ & `?㿈 `& 쀢  @m'쀢  &0@lȰ 㿀'쀦`1+ ' `N ^  G 6`6`6` , , ,, , , , , , 6 , , ,  @l&&* .` @ d@mG*  '5  '@mk䀢 '쀢 ''@lxG 'B耠 `?㿈, *,` , , @* (`  +* @ 6 @   .  @l=   `! $!&@ג   '@m  @l  㿐 #@l * @*&  & & & &  @k֐  & &  㿐#@l * @*"$ $ $ $ $@ko  $ $  㿐    @k` $`* "` `  @k`| P  ``  $@$```@kz<    `@kr`@k@`㿐   @k` & @kt4  @"   @kN > P    $$@k> @$   @k3     @k+ @kB㿐 `   @k& @㿐 @ @kޒ@k  @k  P  $`$@ @j     `@j`@k@$`$@㿐 1 @8 @k@jԒ , @j̒ P  $$ `- @j&@j @jƔ$@j@j @jd  ݂  @j @j$㿐 @  @j @j@@j㿐 @ ` `& && & 㿐 @jg & @j_ @@@k 㿐 `    @ @jH 8 & &㿐&@@ ?@k   @ ?㿈'@k4 @*(``` 2 @0?㿈+f@f`& `     Ӭ 0`  ` "+   "ƕ-  ` 2 + <``- `?``++   "-+ : `0 +    N 0+ ;``/`9`.f`?ЕL' H  L*;` / 9?Ѓ;``.&;``e `?`E `? "<#"8#(4# N`-`? `+  "0  @ `  #+*@ 8`  Ѐ     ` +  # 9- # @8`@ " a3  @" `聫F3 fa4{ P%f-  &t a4 cc +c@~)a4T [c@c@(`֕- &@ O-f&`.[/Y??@j, ?@j)  O~)a4ٝڂ~)a4Ӏ Y;` 0  ` f`+ ;`' L@  L  ``+ 5+ 3;`1 (`XG D     㿈? '㿐 @i͔ "㿐N@` ( d X @ " @@N@ 2 d &@ .@`N@ &@㿐N@` $ d X @ " @@N@ 2 d &@ .@`N@ &@㿐@@ ( d`@ "@@@* d0 @.@`@㿐@@ $ d`@ "@@@* d0 @.@`@㿐N@` (!@N  d X`@ ? ?@(`+? `?2N@@@. @  d @N 8  @  @ ` 㿈\`9?+ 8`@(+ @%+ 8`@= d @ '@@@.@h  "@+ 8`@ݠ + = @,+ :@D2̓+ @̐@ ʐ  ,@  @ `޶ @2Ķ d d@N@4 d`@ ` "ˤ@ d@N@@@"? d  `tr @m?c d`@ d`   d  , @@!`4@8 d@gk 2 d#\#`, 4@"2?M@ဦ@,?` `Բ d ˲ d 2 d@ , @2 dʲ`@" d@㿐@  d`@  ` 㿐@ @@ @ d  `@ @ & &@㿈' d@ d` @ 4@@ '&@㿐\   @3 '`'@/'`- "`@ h`    d@` " @逦@  &@'`'@'`@'`'`'`  㿐@f /``&&㿐@ @@`& ?@&@:  @` ``( 0 㿐@8@f=@& @f0 b 㿐@ @` @8@ ?@@e,   & `@ 'x\@f X` 0d@`'ܴ@ p @ @ @ @=;/ /`.::N@> v@(`8`@w@v  d @ 2`@@8ܐ?? @@,@,?``? @ @ @ 2N@ܰ$l'h|% ,@, `0s,`+@ K "',@N`.`+`H@",@*>`@  0?c `",@ @ ,@,` `@,@,  ``@(`   ܀$h%@l%  \,@ l&  %@eM 0 d$ ^ŀ* <` ,  @@e8 㿈\`9?+ 8`@(+ @%+ 8`@< d @ '@@@-@e&  "@+ 8`@ݠ + <`++ :@C2̓+ @ɐ@ ǐ @+ * `߶ @2Ŷ d d`@N@4 d` ` "̤@ dN@@@"? d `rp @k? @` d`@ d`   d  @!`4@8 d@d 2 d#\#`- 2@"0?Mဦ@*? `Բ d`@˲ d` 2 dN@2 d̲`@" d@㿈@! V` d @ *@` `K@ @* d0@ `㿈 d` @ŀ b2+@    &@ &@㿐 /@d  .@c  0@c| 㿐@dŐ@cx#€ rcȐ#c"Ā , !" `#`ar` ccaȒ $ s 㿈`6`  @? `a/(@@d `@d%Ā #rcȤ$cl` rc w` a r/ +*/@dg* )"r ($@d\@c 81r#Ȣ&##rĀ:  ", `2%#` $c"3 ` `cJ $) r#rȒ "#"@d."*   % a#r$cܠ 1#r!Ȁ$cא!Ȓ $# ā㿈*6  @? `a/(@@d "11r#`bĀ8"##. b",3rcĶ?&cb '# r w a r/ +*(@@cא r1!#r $c $Ր 0/ђ&㿐.@` @b?  `2     `2$$ 㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ @bZ@bV㿐  @ `/7@/@@ /@    @   @㿈'/aT` H H'``@HJ㿈;?9c/a@#7Fc $ g'@ H H'쀦`('쀒 "'? '@ xh H H'쀦`@HJ㿐/a  & #C   € $D` €  $$` $:  `   ?cW?c@` ``,2@  @  @K#@@@ `?@  ؖ 2 @bD  @ $@D@`@  $@$@@` $@:  € $D` €  $$` $: `8`y?8 2 6 ,4  *@ @ € #@ C@ `@ €  #@ #@ @ ` #@ : *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 `? @ @"G D   㿈/`(  &"N   $D`  $$` $;   =耤@ ??耥``?c@\`?c@` ``,4@  @  @P#@ @@ `?@d Ӥ= @aL  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; w``p?  64,  2,@  @ #@C@ `@  #@#@@ ` #@;  * . :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ `? @ @ c "B肦 d ,0@ @4 4=㿐/_$ >   $D`  $$` $;    ?cP?c@` ``,2@  @  @D#@@@ `?@    @`a  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; [   2 6 *@,4   @ #@ C@ `@  #@ #@ @ ` #@ ;  *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 ?`? @ @ ?   㿈/^ἢ"H  $D`  $$` $;  <耤@??c@V`?c@` ``,4@  @  @J#@ @@ `?@d٨< @_}  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $;   44,  2,@  @ #@C@ `@  #@#@@ ` #@;  * , :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ `? @ @c" 肤 d ,0@ @4 @<㿐/]`(@?㿐㿠㿠. WebX v.7.9 (c) Dimitri KRAVTCHUK (dim) 1995-2010X_PAGE==> WebX: started...Unknown http method-V-X_PAGE ==> X_values(); ==> X_action(); ==> EXIT; Content-Type: text/html X_HOME%s/x.envrTMP_DIR/tmp/WebX%s/x.config/etc/WebX/opt/WebX/apps/WebX.TMP_DIR=%sX_exit( %d );%s/X.%dX_exit: exit...X_ERRMSG: %sREQUEST_METHODERRMSG: locked= %d :: msgfmt= %s

 %s 


Usage: WebX script [-Var Value [-Var2 Value2 [..]]] ERROR: %s %5d.%06d [%6d] %s/X_DEBUG%s/X_DEBUG.%da


%s/X_TRACE%s/X_LOG%s/X_LOG3%s/X_LOG.%dw%s/X_LOG3.%d

 hp: %d  mb: %d m_used: %d =====
áéíóúýÓÁÍÉÚÝàèìòùÀÈÌÒÙäëïöüÄËÏÖÜâêîôûÂÊÎÔÛãñõÃÑÕçǺas;&questi;optioncompilehtmlsqltrapsleepusleepchdirsqlnamesquitshellsetaddincludeerrorunlinkclearcookieforkfilexfilereplacewhileifeliffunctioncallexecreturnsqlsqlexecfopenpopenfclosepclosefgetsfputsvfputsfseekshmatshmdtendcontinuebreakX_fgets:OUT fp->size= %d fp->offset= %d
X_fgets:IN fp->size= %d fp->offset= %d
X_fgets: return( %d )  buff={%s}
cut_cmd: IN= {%s}<@----@>cut_cmd: OUT= {%s}cut_cmd: No more memory...<@quit>X_quit: buff= %s; compile= %d ignore: %d 
%s 

==> MALLOC ERROR! no more memory?? ==> EXIT; 
X_clear_value: name_patt: [%s] X_put_value: name: [%s] value: [%s] fixed: %d cookie: %d  ** %s := %s 
## Fixed Value: %s  ** %s add:= %s 
X_get_value: not found {%s} 
date_YEAR: %sdate_MONTH: %s%.2sdate_DAY: %s%02xX_transvalue: [%s]\t\n\rsh:call:txt2url:url2txt:trim:lower:upper:crypt:dt2str:str2dt:### dt2str ==> %s 
Bad format for dt2str: %s 
Too long name(s) for dt2str: %s 
%ld
	==> call: CALL: [%s] ==> call: OUTPUT: [%s] 
trim_buff: IN= {%s}trim_buff: OUT= {%s}year:Bad format for str2dt: %s 
Too long name(s) for str2dt: %s 
month:day:len:cut:str:word:%dint:printf:ftell:expr:-1env:todayX_ROWSX_DTX_UDTX_DDTX_RANDOMX_SQLCODEX_VERSIONX_INSERT_IDX_NVALX_NFUN%d [%d]X_ERRMSGDIRX_transvalue: no value for: [%s]%ld.%06dEXPR error: %s 
%f<@shmdt>X_shmdt: {%s} compile: %d  ignore: %d 
%s // %s 
0<@shmat>X_shmat: {%s} compile: %d  ignore: %d 
## Reached MAX SHM list value## Cannot get SHM...## Cannot attach SHM...## Cannot assign SHM Variable...<@fseek>X_io_fseek: {%s} compile: %d  ignore: %d 
<@vfputs>X_io_vfputs: {%s} compile: %d  ignore: %d 
stdoutstderr<@fputs>X_io_fputs: {%s} compile: %d  ignore: %d 
<@fgets>X_io_fgets: {%s} compile: %d  ignore: %d 
stdin<@pclose>X_io_pclose: {%s} compile: %d  ignore: %d 
<@fclose>X_io_fclose: {%s} compile: %d  ignore: %d 
<@popen>X_io_popen: {%s} compile: %d  ignore: %d 
<@fopen>X_io_fopen: {%s} compile: %d  ignore: %d 
<@return>X_return: {%s} compile: %d ignore: %d 
X_return: {%s}<@exec>X_exec: {%s} compile: %d ignore: %d 
<@replace>X_replace: {%s} compile: %d ignore: %d 
Bad syntax in REPLACE: %s ...X_replace: NAME: [%s] NEWVAL: [%s]X_replace: NAME: [%s] VAL: [%s] replace: [%s] by: [%s]X_replace: NAME: [%s] not exist or NULL value<@fork>X_fork: {%s} compile: %d  ignore: %d 
<@cookie>X_cookie: {%s} compile: %d  ignore: %d 
%s=HTTP_COOKIE<@clear>X_clear: {%s} compile: %d  ignore: %d 
<@unlink>X_unlink: {%s} compile: %d  ignore: %d 
<@error>X_error: {%s} compile: %d  ignore: %d 
<@>=>+=X_let: {%s} compile: %d  ignore: %d 
>*=>;=>$=>/=>%=>-=>++>--X_let: ### ERROR : did not find a command!!!<@add>X_add: {%s} compile: %d  ignore: %d 
<@set>X_set: {%s} compile: %d  ignore: %d 
<@shell>%s // %s
X_shell: {%s}
Cannot run SHELL: %s 
<@sqlnames>X_sqlnames: buff= %s; compile= %d ignore: %d 
lowercaseuppercase<@chdir>X_chdir: buff= %s; compile= %d ignore: %d 
<@usleep>X_usleep: buff= %s; compile= %d ignore: %d 
<@sleep>X_sleep: buff= %s; compile= %d ignore: %d 
<@sqltrap>X_sqltrap: buff= %s; compile= %d ignore: %d 
OFF_TRANSACTIONSON_TRANSACTIONSOFFON<@html>X_html: buff= %s; compile= %d ignore: %d 
<@compile>X_compile: buff= %s; compile= %d ignore: %d 
<@option>X_option: buff= %s; compile= %d ignore: %d 
fflushoffflushsql_namessql_transactionssql_traponsignalalarmlatin_htmlignore_empty_linesoff_transactionstranslatesigtermon_transactionsdebug## Wrong or unsupported signal name: %s !!sigintsighupUnknown option: %ssigalrmsigpipesigusr1sigusr2sigchld<@include>X_include: {%s} compile: %d  ignore: %d 
rFile SIZE: %d
X_ROOT/X_printfile: %s compile: %d level: %d
X_printfile: DIR-new= %s
Cannot access file: %s 

Cannot access file: %s


X_printfile: DIR-curr= %s ./%sLAST 100 CHARS ===> %s ===> Cannot open file: %s

Cannot open file: %s


Reused, File SIZE: %d <@end><@continue>X_notfound: [continue] ==> %d <@break>X_notfound: [break] ==> Continue= %d X_notfound: compile: %d ignore: %d ## Continue: %d Break: %d <@call>X_call: {%s} compile: %d ignore: %d CALL: Unknown function name: %s ,X_call: add argument name: %s value: {%s} X_call: analyse arg_string: %sX_call: no more values...<@call> %s( %d ) ==> SIGTRAP call: CALL: [%s] <@call> %s ==> SQLTRAP call: CALL: [%s] none### SYSTEM ERROR: more than 10 DB Session in proccess!X_BASEX_USERX_PASSWD### Cannot open database: %s ERR: %d SQLERR: %sc%d### Database name was not specified...%24sdisconnectbegincommitrollback### DATABASE Query ERROR: QUERY: %s ; ### ERRMSG: %s ### DATABASE Query ERROR: QUERY: %.200s ; ### ERRMSG: %.200s <@sqlexec>X_sqlexec: {%s} compile: %d ignore: %d X_sqlexec: query: %s <@function>X_function: {%s} compile: %d ignore: %d ,)%sX_function: add argname: %s X_while_values: name: %s compile: %d X_while_words: name: %s sep: {%s} compile: %d X_while_loop: compile: %d <@while>X_while: {%s} compile: %d ignore: %d wordsvaluesUnknown option: %s in WHILE...Fetch: %d values ** SQL fetch row: %d columns Name: %s Value: %sX_found: cid: %s compile: %d X_sqlnames### DATABASE QUERY ERROR: %s ### DATABASE QUERY ERROR: %.200s <@sql>X_sql: {%s} compile: %d ignore: %d selectshowexecuteX_sql: query: %s <@xfile>X_xfile: {%s} compile: %d ignore: %d X_xfile: file name is too long: {%s} aX_xfile: Cannot open file: {%s} X_xfile: outpass MAX open for file: {%s} <@file>X_file: {%s} compile: %d ignore: %d X_file: Cannot open file: {%s} <@if><@elif>X_if: {%s} compile: %d ignore: %d cmp!cmpicmp!icmpfcmp!fcmpfmt%lfX_if: try as line command: {%s} filled!filledEOFFilled... Filled? {%s} NULLafter VAL{%s} = %s X_if: [continue] ==> %d X_if: [break] ==> Continue= %d <@else>X_if: {%s} <@else> !fmtintfloatdateUnknown option in FMT: %s !EOFexist!existisDir!isDirisFile!isFile%s/x.pageregular_file: %s ==> ? regular_file: %s ==> OK. X_PAGEdef: X_PAGE: %sX_ERRORdef: X_ERROR: %sdef: X_PAGEInvalid %s value: %s ///./...%s/%sHTTP_HOSTSERVER_NAME%s/x.configrshell:00%s%s%s%sX_ROOT ===> {%s} X_ROOTX_HOME%dX_PIDX_PROGholdX_BASE==> Server: %s Root: %s Base: %s Hold: %d ### Not found X_PAGE value...WebXX_values: entry shellSERVER_PORT00%s:%sCannot open X_HOME config file: %sNo X_ROOT configuration for SERVER: %s X_ServerCOOKIESSet-Cookie: %s=%s; path=/; expires=31-Dec-2037 23:55:00 GMT Set-Cookie: %s=%s Set-Cookie: %s=NULL; path=/; expires=Wednesday, 21-Aug-1996 01:21:36 GMT Del-Cookie: %s X_SessionCOOKIESSet-Cookie: %s=%s; path=/;                       ! &%lld%Lf%llo%llxstrcutchcharstrlenX_exec_call: name= %s args= %s EXEC: Unknown function name: %s cutstr: fname= %s args= %s cutstr: name= [%s] str= [%s] chchar: fname= %s args= %s strlen: fname= %s args= %s strlen: STRname= [%s] LENname= [%s] %d%04d-%02d-%02d### No memory...||&&X_user_cmp( %s, %s, %s )likevlike!like!vlike>=≥>=<=≤<=!===>><<=Unknown CMP operator: %s X_user_icmp( %d, %s, %d )Unknown ICMP operator: %s X_user_fcmp( %f, %s, %f )Unknown FCMP operator: %s SSss%dMImi%02dHHhhDDddJJjjMMmm%04dYYYYyyyyAAAAaaaaYYYyyyAAAaaaYYyyAAaaAVL_search key: [%s] AVL_remove key: [%s] AVL_insert key: [%s] X_heap_new: hp: %d mb: %d m_used: %d X_heap: NO MEMORY...X_heap_alloc: hp: %d size: %d X_heap_info hp: %d mb: %d m_used: %d WARNING: heap_alloc( size= %d ) rmalign ==> mb: %d m_used: %d rmalign: mb: %d m_used: %d X_heap_free: %d X_heap_reduce: %d ### No more empty cursors!!! ### Cannot connect to DB Server: X_noselect_sql: QUERY: %s_mysql_### QUERY ERROR: %s### ERROR: cannot get a new cursor _mysql_; code: %d X_finish() -- Begin### FREE CURSOR: %d X_finish() -- End-X_database: "%s"MYSQL_SOCKETmysqlNULLX_select_sql: cursor: %s cmd: %d PREPARE QUERY: %s### QUERY RESULT ERROR: %s ### No memory for VVAL: %s ### CURSOR NAME ERROR...### QUERY ERROR: %s ### CURSOR: %s is already in use...%.70s ### CURSOR Duplication.### No more cursors OR %.70s REQUEST_METHODPOSTThis script should be referenced with a METHOD of POST. CONTENT_TYPEapplication/x-www-form-urlencodedCONTENT_LENGTHfmakeword: [%s] makeword: name= [%s], val= [%s] POST: CONTENT_LENGTH= %dThis script can only be used to decode form results. CONTENT_TYPEapplication/x-www-form-urlencodedREQUEST_METHODPOSTGETTMP_DIR/tmpw+%s/post.buff.%dTAKE: %s name="filename="NAME: %s VALUE... VALUE: [%s] NULLSEP: %s SIZE: %d %s/post.inputE_POST_parser: END: %d values FILE-src: [%s] FILE: [%s] %s/%s..%d.%dwBroken Input...PATH_INFOREQUEST_METHODGETQUERY_STRINGThis script should be referenced with a METHOD GET.
WARNING: Value value size is over %d!!! [cut]...
%%%02x&;`'"|*?~<>^()[]{}$\ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqrstuvwxyz{|}~ݬ/tmp/mysql.sockmysqltcpMYSQL_TCP_PORTMYSQL_UNIX_PORTmysql_change_userrootUSERLOGNAMELOGINUNKNOWN_USERSHOW SLAVE HOSTSSHOW SLAVE STATUSshow databases like 'show tables5.1.30%-*.*g%.*fAA   commitrollbackset autocommit=1set autocommit=0A%08lx%08lxA@?@PAA@?@PA@W@@Unknown MySQL errorCan't create UNIX socket (%d)Can't connect to local MySQL server through socket '%-.100s' (%d)Can't connect to MySQL server on '%-.100s' (%d)Can't create TCP/IP socket (%d)Unknown MySQL server host '%-.100s' (%d)MySQL server has gone awayProtocol mismatch; server version = %d, client version = %dMySQL client ran out of memoryWrong host infoLocalhost via UNIX socket%-.100s via TCP/IPError in server handshakeLost connection to MySQL server during queryCommands out of sync; you can't run this command nowNamed pipe: %-.32sCan't wait for named pipe to host: %-.64s pipe: %-.32s (%lu)Can't open named pipe to host: %-.64s pipe: %-.32s (%lu)Can't set state of named pipe to host: %-.64s pipe: %-.32s (%lu)Can't initialize character set %-.32s (path: %-.100s)Got packet bigger than 'max_allowed_packet' bytesEmbedded serverError on SHOW SLAVE STATUS:Error on SHOW SLAVE HOSTS:Error connecting to slave:Error connecting to master:SSL connection errorMalformed packetThis client library is licensed only for use with MySQL servers having '%s' licenseInvalid use of null pointerStatement not preparedNo data supplied for parameters in prepared statementData truncatedNo parameters exist in the statementInvalid parameter numberCan't send long data for non-string/non-binary data types (parameter: %d)Using unsupported buffer type: %d (parameter: %d)Shared memory: %-.100sCan't open shared memory; client could not create request event (%lu)Can't open shared memory; no answer event received from server (%lu)Can't open shared memory; server could not allocate file mapping (%lu)Can't open shared memory; server could not get pointer to file mapping (%lu)Can't open shared memory; client could not allocate file mapping (%lu)Can't open shared memory; client could not get pointer to file mapping (%lu)Can't open shared memory; client could not create %s event (%lu)Can't open shared memory; no answer from server (%lu)Can't open shared memory; cannot send request event to server (%lu)Wrong or unknown protocolInvalid connection handleConnection using old (pre-4.1.1) authentication protocol refused (client option 'secure_auth' enabled)Row retrieval was canceled by mysql_stmt_close() callAttempt to read column without prior row fetchPrepared statement contains no metadataAttempt to read a row while there is no result set associated with the statementThis feature is not implemented yetLost connection to MySQL server at '%s', system error: %dStatement closed indirectly because of a preceeding %s() callThe number of columns in the result set differs from the number of bound buffers. You must reset the statement, rebind the result set columns, and execute the statement againHOMEUMASKUMASK_DIR User time %.2f, System time %.2f Maximum resident set size %ld, Integral resident set size %ld Non-physical pagefaults %ld, Physical pagefaults %ld, Swaps %ld Blocks in %ld out %ld, Messages in %ld out %ld, Signals %ld Voluntary context switches %ld, Involuntary context switches %ld @Y01230120022455012623010202Can't create/write to file '%s' (Errcode: %d)Error reading file '%s' (Errcode: %d)Error writing file '%s' (Errcode: %d)Error on close of '%s' (Errcode: %d)Out of memory (Needed %u bytes)Error on delete of '%s' (Errcode: %d)Error on rename of '%s' to '%s' (Errcode: %d)Unexpected eof found when reading file '%s' (Errcode: %d)Can't lock file (Errcode: %d)Can't unlock file (Errcode: %d)Can't read dir of '%s' (Errcode: %d)Can't get stat of '%s' (Errcode: %d)Can't change size of file (Errcode: %d)Can't open stream from handle (Errcode: %d)Can't get working dirctory (Errcode: %d)Can't change dir to '%s' (Errcode: %d)Warning: '%s' had %d linksWarning: %d files and %d streams is left open Disk is full writing '%s' (Errcode: %d). Waiting for someone to free space... Retry in %d secsCan't create directory '%s' (Errcode: %d)Character set '%s' is not a compiled character set and is not specified in the '%s' fileOut of resources when opening file '%s' (Errcode: %d)Can't read value for symlink '%s' (Error %d)Can't create symlink '%s' pointing at '%s' (Error %d)Error on realpath() on '%s' (Error %d)Can't sync file '%s' to disk (Errcode: %d)Collation '%s' is not a compiled collation and is not specified in the '%s' fileFile '%s' not found (Errcode: %d)File '%s' (fileno: %d) was not closedUnknown error %dUNKNOWNUNOPENED..: ..ucs2utf8/apps/mysql/share/mysql/apps/mysqlcharsets//Index.xml?.xmlgE#ͫ2TvZyn롏b.latin1latin1_binlatin1_german2_cilatin1_swedish_ci(null)xmlxml/versionxml/encodingcharsetscharsets/max-idcharsets/charsetcharsets/charset/primary-idcharsets/charset/binary-idcharsets/charset/namecharsets/charset/familycharsets/charset/descriptioncharsets/charset/aliascharsets/charset/ctypecharsets/charset/ctype/mapcharsets/charset/uppercharsets/charset/upper/mapcharsets/charset/lowercharsets/charset/lower/mapcharsets/charset/unicodecharsets/charset/unicode/mapcharsets/charset/collationcharsets/charset/collation/namecharsets/charset/collation/idcharsets/charset/collation/ordercharsets/charset/collation/flagcharsets/charset/collation/mapcharsets/charset/collation/rules/resetcharsets/charset/collation/rules/pcharsets/charset/collation/rules/scharsets/charset/collation/rules/t <&<<<<< %s %sprimarybinarycompiledbinaryfilenameutf8utf8_binutf8_general_ci0123456789abcdeflatin1latin1_german1_cilatin1_danish_cilatin1_general_cilatin1_general_cslatin1_spanish_ciutf8utf8_hungarian_ci&O < \u00F6 <<< \u00D6 << \u0151 <<< \u0150&U < \u00FC <<< \u00DC << \u0171 <<< \u0170utf8_esperanto_ci& C < \u0109 <<< \u0108& G < \u011D <<< \u011C& H < \u0125 <<< \u0124& J < \u0135 <<< \u0134& S < \u015d <<< \u015c& U < \u016d <<< \u016cutf8_persian_ci& \u066D < \u064E < \uFE76 < \uFE77 < \u0650 < \uFE7A < \uFE7B < \u064F < \uFE78 < \uFE79 < \u064B < \uFE70 < \uFE71 < \u064D < \uFE74 < \u064C < \uFE72& \uFE7F < \u0653 < \u0654 < \u0655 < \u0670& \u0669 < \u0622 < \u0627 < \u0671 < \u0621 < \u0623 < \u0625 < \u0624 < \u0626& \u0642 < \u06A9 < \u0643& \u0648 < \u0647 < \u0629 < \u06C0 < \u06CC < \u0649 < \u064A& \uFE80 < \uFE81 < \uFE82 < \uFE8D < \uFE8E < \uFB50 < \uFB51 < \uFE80 < \uFE83 < \uFE84 < \uFE87 < \uFE88 < \uFE85 < \uFE86 < \u0689 < \u068A& \uFEAE < \uFDFC& \uFED8 < \uFB8E < \uFB8F < \uFB90 < \uFB91 < \uFED9 < \uFEDA < \uFEDB < \uFEDC& \uFEEE < \uFEE9 < \uFEEA < \uFEEB < \uFEEC < \uFE93 < \uFE94 < \uFBA4 < \uFBA5 < \uFBFC < \uFBFD < \uFBFE < \uFBFF < \uFEEF < \uFEF0 < \uFEF1 < \uFEF2 < \uFEF3 < \uFEF4 < \uFEF5 < \uFEF6 < \uFEF7 < \uFEF8 < \uFEF9 < \uFEFA < \uFEFB < \uFEFCutf8_roman_ci& I << j <<< J & V << u <<< U utf8_spanish2_ci&C < ch <<< Ch <<< CH&L < ll <<< Ll <<< LL&N < \u00F1 <<< \u00D1utf8_slovak_ci& A < \u00E4 <<< \u00C4& C < \u010D <<< \u010C& H < ch <<< Ch <<< CH& O < \u00F4 <<< \u00D4& S < \u0161 <<< \u0160& Z < \u017E <<< \u017Dutf8_lithuanian_ci& C << ch <<< Ch <<< CH< \u010D <<< \u010C& E << \u0119 <<< \u0118 << \u0117 <<< \u0116& I << y <<< Y& S < \u0161 <<< \u0160& Z < \u017E <<< \u017Dutf8_danish_ci& Y << \u00FC <<< \u00DC << \u0171 <<< \u0170& Z < \u00E6 <<< \u00C6 << \u00E4 <<< \u00C4 < \u00F8 <<< \u00D8 << \u00F6 <<< \u00D6 << \u0151 <<< \u0150 < \u00E5 <<< \u00C5 << aa <<< Aa <<< AAutf8_czech_ci& C < \u010D <<< \u010C & H < ch <<< Ch <<< CH& R < \u0159 <<< \u0158& S < \u0161 <<< \u0160& Z < \u017E <<< \u017Dutf8_turkish_ci& C < \u00E7 <<< \u00C7 & G < \u011F <<< \u011E & H < \u0131 <<< \u0049 & O < \u00F6 <<< \u00D6 & S < \u015F <<< \u015E & U < \u00FC <<< \u00DC utf8_swedish_ci& Y <<\u00FC <<< \u00DC & Z < \u00E5 <<< \u00C5 < \u00E4 <<< \u00C4 << \u00E6 <<< \u00C6 < \u00F6 <<< \u00D6 << \u00F8 <<< \u00D8 utf8_spanish_ci& N < \u00F1 <<< \u00D1 utf8_estonian_ci& S < \u0161 <<< \u0160 < \u007A <<< \u005A < \u017E <<< \u017D & W < \u00F5 <<< \u00D5 < \u00E4 <<< \u00C4 < \u00F6 <<< \u00D6 < \u00FC <<< \u00DC utf8_polish_ci& A < \u0105 <<< \u0104 & C < \u0107 <<< \u0106 & E < \u0119 <<< \u0118 & L < \u0142 <<< \u0141 & N < \u0144 <<< \u0143 & O < \u00F3 <<< \u00D3 & S < \u015B <<< \u015A & Z < \u017A <<< \u0179 < \u017C <<< \u017Butf8_slovenian_ci& C < \u010D <<< \u010C & S < \u0161 <<< \u0160 & Z < \u017E <<< \u017D utf8_romanian_ci& A < \u0103 <<< \u0102 < \u00E2 <<< \u00C2 & I < \u00EE <<< \u00CE & S < \u0219 <<< \u0218 << \u015F <<< \u015E & T < \u021B <<< \u021A << \u0163 <<< \u0162 utf8_latvian_ci& C < \u010D <<< \u010C & G < \u0123 <<< \u0122 & I < \u0079 <<< \u0059 & K < \u0137 <<< \u0136 & L < \u013C <<< \u013B & N < \u0146 <<< \u0145 & R < \u0157 <<< \u0156 & S < \u0161 <<< \u0160 & Z < \u017E <<< \u017D utf8_icelandic_ci& A < \u00E1 <<< \u00C1 & D < \u00F0 <<< \u00D0 & E < \u00E9 <<< \u00C9 & I < \u00ED <<< \u00CD & O < \u00F3 <<< \u00D3 & U < \u00FA <<< \u00DA & Y < \u00FD <<< \u00DD & Z < \u00FE <<< \u00DE < \u00E6 <<< \u00C6 << \u00E4 <<< \u00C4 < \u00F6 <<< \u00D6 << \u00F8 <<< \u00D8 < \u00E5 <<< \u00C5 utf8_unicode_ci%s at '%s'& expected& or < expectedUnknown charactercharacter expectedShould never happenToo many rules'' unexpected ('' wanted)'' unexpected (END-OF-INPUT wanted)unknown token%s unexpected (ident or string wanted)TEXT%s unexpected (ident or '/' wanted)%s unexpected ('?' wanted)STRINGIDENTEND-OF-INPUTCDATACOMMENT'?''>''=''<''/''!'%s unexpected ('>' wanted)%s unexpected (ident wanted)TCPSOCKETPIPEMEMORY0800100000HY000optionsportsocketcompresspasswordpipetimeoutuserinit-commandhostdatabasedebugreturn-found-rowsssl-keyssl-certssl-cassl-capathcharacter-sets-dirdefault-character-setinteractive-timeoutconnect-timeoutlocal-infiledisable-local-infilereplication-probeenable-reads-from-masterrepl-parse-queryssl-ciphermax-allowed-packetprotocolshared-memory-base-namemulti-resultsmulti-statementsmulti-queriessecure-authreport-data-truncationclientd:t:o,/tmp/client.traceUnknown option to protocol: %s COLLATION %s is not valid for CHARACTER SET %slatin1_swedish_cilatin1mysql_closelocalhostmyMYSQL_PWDreading initial communication packetwaiting for initial communication packetsending authentication informationSetting intital databasesending password informationreading authorization packetreading final connect informationSET NAMES %s-%s%02u:%02u:%02u%04u-%02u-%02u%04u-%02u-%02u %02u:%02u:%02usocket (%d)TCP/IP (%d)127.0.0.1/No option given to %s Alternatives are: '%s'Unknown option to %s: %s ,'%s'?.cnf--defaults-file=--defaults-extra-file=--defaults-group-suffix=includedirincludeWarning: World-writable config file '%s' is ignored --Warning: skipping '%s' directive as maximum includerecursion level was reached in file %s at line %d error: Wrong '!%s' directive in config file: %s at line %d error: Wrong group definition in config file: %s at line %d error: Found option without preceding group in config file: %s at line: %d Could not open required defaults file: %s Fatal error in defaults handling. Program aborted MYSQL_GROUP_SUFFIX/etc//etc/mysql//apps/mysql/etcMYSQL_HOME~/ Default options are read from the following files in the given order: Internal error initializing default directories listThe following groups are read: The following options may be given as the first argument: --print-defaults Print the program argument list and exit --no-defaults Don't read default options from any options file --defaults-file=# Only read default options from the given file # --defaults-extra-file=# Read this file after the global files are readdefaults--no-defaults--print-defaults%s would have been started with the following arguments: %s ?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒD-JDxCyٝE *,(ET25EqE'/E1!F)>Y9F_$FnFȦ"FɜFЛ|G3BarMGhy GCWiG*HJH=c)\Hr]7HxaHܲyIY}LIFkC\I|T3I'\I1sJ^~:JQ~dJavJG}0Jlln>K$ᇈKZjAKP1P=Kd>ZMK}M`WL/ܡnmLcDL^LupMrifaM8O?MnbrM9GM׽)zN tF:NBȫdNw.=Ni9 NCOuԔOLLIOO̧O뢿[P!EⅿPU%'/PQ_P6PDbQ*[U{Q`xUmQV4*Qɼ߫5zR XlR4.Ri"rm9Rk )YRӢeS(N$S>aSs-W} S]\OSubسcT ]pTGh9L%T}B.TI%}Tn\UqsUQFUR`UxUpd+?V%=5V[@=̃NV&VJ0GƔVY:=W0$fWds&WW>)±XMs3]X9a!5kXoiBX8)XƠ4*YxHA5YC\-(Yx4%rYA/vYiZ?ZMOZwH02Z7|$~Zb[-["}CX[V/;[-C; [JS[\ =\+4"M\a2I0\HA|\R[]pKsy]4MPW]j=Hm]f-]]ԀW8u^ ma^@D$M|^tU-`^x^HUW_5.P_Hpy[_~]r_:'_k _`WE˷`RVR`N.'`"W:(`5vYa&%oa\s.a5?}xa:C,\a4 b1]zbe噄b"bS_ c27c:REcpkcxFg2cVXB@d,5)hdD7CtdyER0xdYfVd6 6euCCeNNTseGee1eZ~xaf" =fW̶ fj_fbfj8g,}Dga#JgqZg$hWwh5,ʔhke7: hbDHhgZi gzJi@ବNitbZi :iThDjiBV jIzkj HYsj4-7j8 k%LkSw(V0kU12kkjk^od*l'~6 =5l]]Î l8l4@l#7m2!V:s#mfBOmTmѴ5;pn!Š n;3-rnqJRgnn!}ao},oE:*kvozbo}Eq$=o䜖mpü\pPU}9p DCp)&êTpso4q#%qX/1AVqYkq24zqr-rSrbCrnɉrJ{1sNs|_ s60[vslrTs"tsXyRt WtAuqtuUtztGјt 2cuOsvgN/vjzav+}w(v/Zw_T-pwb2&w:~wI@4\x2!xg:)Tx0x|5pJ^gyB\y<t3yr L/1y;=y4 wzMzfpzF ;-Wz{`8oz76|#lez,G{E!Y^{P5:{={D߃+F{k 8L|$Ξz_|YBF|kT| *8| Vs}/Pf}ck;}w!= }Δ\)L~9~7<u~mK~OJ@[~Tr *B:Qnٺv#){?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H HAoxoo(  ,DݬLXx8p  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~AAAAA\CEEEEIIIIDNOOOOUUUYAAAAA\CEEEEIIIIDNOOOOUUUYYEEESEEE  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~AAAAAA\CEEEEIIIIDNOOOOOUUUUYSAAAAAA\CEEEEIIIIDNOOOOOUUUUYY!oxoo    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~AAAA\[\CEEEEIIIIDNOOOO]UUUYYAAAA\[\CEEEEIIIIDNOOOO]UUUYY  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0` 9R}     "  !"a :S~xooooppp0pPpppppppq q(qH q`q q qqrr rH rhrrrs̨tDݬLXxh( @(hxͼ,Ϭ(d\֬P8 d'B@;T Hvԥ NrZz@~ƀ#ocEx] ඳd#?1sxsxs h<Dݬ\<h( 0Ph  Ϭ(d\֬P8  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H x\Dݬ\<xhsss  tx   L,p `xt@ <T X<Ϭ(d\֬P8  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H Ssss   X!sss  x   L,p `xt@ < X<Ϭ(d\֬P8܄քЄʄ  !A!"B"#C#$D$%E%&F&'G'(H()I)*J*+K+,L,-M-.N./O/0P01Q12R23S34T45U56V67W78X89Y9:Z:;;;<<<===>>>???@@@!A!"B"#C#$D$%E%&F&'G'(H()I)*J*+K+,L,-M-.N./O/0P01Q12R23S34T45U56V67W78X89Y9:Z:[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $ $ $!$!$!$"$"$"$#$#$#$$$$$$$%$%$%$&$&$&$'$'$'$($($($)$)$)$*$*$*$+$+$+$,$,$,$-$-$-$.$.$.$/$/$/$0$0$0$1$1$1$2$2$2$3$3$3$4$4$4$5$5$5$6$6$6$7$7$7$8$8$8$9$9$9$:$:$:$;$;$;$<$<$<$=$=$=$>$>$>$?$?$?$@$@$@$A$A$A$B$B$B$C$C$C$D$D$D$E$E$E$F$F$F$G$G$G$H$H$H$I$I$I$J$J$J$K$K$K$L$L$L$M$M$M$N$N$N$O$O$O$P$P$P$Q$Q$Q$R$R$R$S$S$S$T$T$T$U$U$U$V$V$V$W$W$W$X$X$X$Y$Y$Y$Z$Z$Z$[$[$[$\$\$\$]$]$]$^$^$^$_$_$_$`$`$`$a$a$a$b$b$b$c$c$c$d$d$d$e$e$e$f$f$f$g$g$g$h$h$h$i$i$i$j$j$j$k$k$k$l$l$l$m$m$m$n$n$n$o$o$o$p$p$p$q$q$q$r$r$r$s$s$s$t$t$t$u$u$u$v$v$v$w$w$w$x$x$x$y$y$y$z$z$z${${${$|$|$|$}$}$}$~$~$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! !!!!!!!"!"!"!#!#!#!$!$!$!%!%!%!&!&!'!'!'!(!(!(!)!)!)!*k!*!+!+!,!,!,!-!-!-!.!.!.!/!/!/!0!0!0!1!1!1!2!2!2!3!3!3!4!4!4!5!5!5!6!6!6!7!7!7!8!8!8!9!9!9!:!:!:!;!;!;!!>!>!?!?!?!@!@!@!A!A!A!B!B!B!C!C!C!D!D!D!E!E!E!F!F!F!G!G!G!H!H!H!I!I!I!J!J!J!K!K!K!L!L!L!M!M!M!N!N!N!O!O!O!P!P!P!Q!Q!Q!R!R!R!S!S!S!T!T!T!U!U!U!V!V!V!W!W!W!X!X!X!Y!Y!Y!Z!Z!Z![![![!\!\!\!]!]!]!^!^!^!_!_!_!`!p!`!a!q!a!b!r!b!c!s!c!d!t!d!e!u!e!f!v!f!g!w!g!h!x!h!i!y!i!j!z!j!k!{!k!l!|!l!m!}!m!n!~!n!o!!o!`!p!`!a!q!a!b!r!b!c!s!c!d!t!d!e!u!e!f!v!f!g!w!g!h!x!h!i!y!i!j!z!j!k!{!k!l!|!l!m!}!m!n!~!n!o!!o!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!          ( )!*"+#,$-%.&/'( )!*"+#,$-%.&/'8091:2;3<4=5>6?78091:2;3<4=5>6?7H@IAJBKCLDMEFFFGGGH@IAJBKCLDMENNNOOOPPYQRR[STT]UVV_WXXXYQZZZ[S\\\]U^^^_Wh`iajbkcldmenfogh`iajbkcldmenfogpqrstuvwxyz{|}~~~pqrstuvwz{xy|}AABBBBBB C C  D  D  D  DDDDDDDEEEEEEEEEEFF !G !G"#H"#H$%H$%H&'H&'H()H()H*+H*+H,-I,-I./I./I01K01K23K23K45K45K67L67L89L89L:;L:;L<=L<=L>?M>?M@AM@AMBCMBCMDENDENFGNFGNHINHINJKNJKNLMOLMONOONOOPQOPQORSORSOTUPTUPVWPVWPXYRXYRZ[RZ[R\]R\]R^_R^_R`aS`aSbcSbcSdeSdeSfgSfgShiShiSjkTjkTlmTlmTnoTnoTpqTpqTrsUrsUtuUtuUvwUvwUxyUxyUz{Uz{U|}V|}V~V~VWWWWWWWWWWXXXXYYZZZZZZHTWY`SAAAAAAAAAAAAAAAAAAAAAAAAEEEEEEEEEEEEEEEEIIIIOOOOOOOOOOOOOOOOOOOOOOOOUUUUUUUUUUUUUUYYYYYYYY                  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///0001a12b23c34d45e56f67g78h89i9:j:;k;<l<=m=>n>?o?@p@AqABrBCsCDtDEuEFvFGwGHxHIyIJzJK{KL|LM}MN~NOOPPQQRRSSTTUUVVWWWXXXYYYZZZ[[[\\\]]]^^^___```1a12b23c34d45e56f67g78h89i9:j:;k;<l<=m=>n>?o?@p@AqABrBCsCDtDEuEFvFGwGHxHIyIJzJK{KL|LM}MN~NOOPPQQRRSSTTUUVVPQRSTUVWX Y  Z  [  \ ]^#_0123456789:;<=>? @ !A!"B"#C#$D$%E%&F&'G'(H()I)*J*+K+,L,-M-.N./O/0123456789:;<=>? @ !A!"B"#C#$D$%E%&F&'G'(H()I)*J*+K+,L,-M-.N./O/PQRSTUVWX Y  Z  [  \ ]^#_`a``a`bcbbcbdeddedfgffgfhihhihjkjjkjlmllmlnonnonpqppqprsrrsrtuttutvwtvwtxyxxyxz{zz{z|}||}|~~~~--######''++                  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~AAAAEEEE I I  I  I  O  OOORRRRUUUUSSTTHH   !!!"#""#"$%$$%$&'A&'A()E()E*+O*+O,-O,-O./O./O01O01O23Y23Y444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSTUUUVWXXXYZZZ[\\\]]]^^^___`aaabbbcdddeeefffggghijjjkkklllmmmnnnopppqqqrssstttuvvvwwwxxxyyyzzz{{{|||}}}~~~AAAAAACC C C  C  C  C  CDDEEEEEEEEEEGGGG !G !G"#G"#G$%H$%H&'&&'&()I()I*+I*+I,-I,-I./I./I0iII1I23223245J45J67K67K8889:L9:L;<L;<L=>L=>L?@??@?ABAABACDNCDNEFNEFNGHNGHNIIIJKJJKJLMOLMONOONOOPQOPQORSRRSRTURTURVWRVWRXYRXYRZ[SZ[S\]S\]S^_S^_S`aS`aSbcTbcTdeTdeTfgffgfhiUhiUjkUjkUlmUlmUnoUnoUpqUpqUrsUrsUtuWtuWvwYvwYxYyzZyzZ{|Z{|Z}~Z}~ZSSSTVWY[`cihoruOOUUAAIIOOUUUUUUUUUUAAAAGGKKOOOOJGGNNAA  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AaABbBCcCDdDEeEFfFGgGHhHI1IJjJKkKLlLMmMNnNOoOPpPQqQRrRSsSTtTUuUVvVWwWXxXYyYZzZ[[[\\\]]]^^^___```AaABbBCcCDdDEeEFfFGgGHhH0iIJjJKkKLlLMmMNnNOoOPpPQqQRrRSsSTtTUuUVvVWwWXxXYyYZzZ{{{|||}}}~~~AAAAAACEEEEIIIINOOOOOUUUUYAAAAAACEEEEIIIINOOOOOUUUUYxY܄քЄʄ  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AaABbBCcCDdDEeEFfFGgGHhHIiIJjJKkKLlLMmMNnNOoOPpPQqQRrRSsSTtTUuUVvVWwWXxXYyYZzZ[[[\\\]]]^^^___```AaABbBCcCDdDEeEFfFGgGHhHIiIJjJKkKLlLMmMNnNOoOPpPQqQRrRSsSTtTUuUVvVWwWXxXYyYZzZ{{{|||}}}~~~AAAAAACEEEEIIIINOOOOOUUUUYSAAAAAACEEEEIIIINOOOOOUUUUYxYYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!              `P@0 p  ` P @ 0`P@0 p`P@0 !"#$%&'()*123456789:;<=>?@ABCDEFGHIJ9)y  i Y I 9)yi YIll  \\ LL   <<   ,, ||   ll   \\mm  ]] MM   ==   -- }}   mm   ]]nn^^ NN p >>   .. ~~   nn   ^^oo__ OO   ??   //  o_p  PP   @@   00    pp   ``qqaa  QQ   AA   11   !! qq   aarrbb  RR   BBscSsc  S C3 C 3 ctd  ctd TD4 T D 4 $td $ t  dUE  E uevf u  evfVF6&vwgWwg  W G7' G 7 'wgxh w  gxhX   8x V F hy  h I9 & 9 6 v  !"#$%&'()*ghiklmnopq789:;<=>?@ABCDEFGHIJstuvwxyz'( ) * + , -./0123456789:WwXxYyZz[{\|]}^~_`abcrdefa  QQ v  R f  AAW G ' 1  !! qq    a Y QQ Ibb yR B  22   "" rr   bb  RccSS CC  3   ## ss   cc   SSddTT DD   44   $ tt   dd   TTeeUE 55 1 % 6&vfVgWG7'wgWhXH8(xhXi YI9)yi Yj ZJ:*zj Zk STUWX  HKLNOPQR !"#$%&'()*ghijklmnopqrstuwxYZ    A 1 !2"r  b0 p  ` P @ 0 1!q  a  Q 0 p`P@0 1!qaQA1!2"rb   RR   BB   22   ""33##ss  cc   SS   CC   33   ##44$$tt  dd   TT   D   44   $$55%%uu  ee   UU   EE   55   %%66  VV   FF   66'w  g  W G 7 '8(x  h  X H 8 'wgWG7'8(xhXH8x      "$&(*,.246!#%')+-/13579;=?ACEGJLNPRTVXZ\8:<>@BDFHIKMOQSUWY[]^`bdfhjlnprtvy{}_acegikmoqsuwz|~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$!"#$%&$xD!`'0(Px`*l% z1E!a( 2*Rz +m& |2F!b) ,T| ,n' ~3G!c*.V~ -o( 4H!d+0X .) 5I!e, 2Z /Y*6J!f- 4\8+7K!g.6^9[,`8L!h/:8:-b9M!i0=;:b;].d:N!j1><d</f;O!k2 >f=_h<P!l3@h>j=Q!m4"Bj?l >R!n5$DlHn ?S!o6&AFnI p@T7( HpJh!rAU8*"JrKi"tB9,$Lt(Lj#vC:.&Nv)MkABCDEF0DXyt!pG 1]q)Qy"d1EY{au!qH 3^r+S{#e2FZ}bv!rI 4_s-U}$f3G[cw!sJ5`t/W%g4H\dx!tK6au 1Y&Pp5I]ey!uL7bv 3['Qq6J^fz!vM8cw 5]0Rr7K_g{!wN9Pdx7_1Ss8Lah|!xOQey9a2Tt9Mci}!yP<Rfz;c3Uu:Nej~!zQSg{=e4Vv;Ogk!{R?Th|?g5Ww<Pil!|S!@Ui}Ai6x=Qk m!}T#Vj~Ck7y>Rm n!~U%WkEm@z?So o!V'XlGoA{@TqpW)Ym!IqB`|AUsqX+Zn#KsCa}BVurY-[o%Mu DbCWwsZ/\p'Ow!Ec sstHHHHB  stt@@@@:  0st t88882  1st8t0000*  ^stPt(((((      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0` 9R}     "  !"a :S~x  !"#$%&'()*+,-./0123456789:;<=>?@AQSW[egikuwy{}AQSW[egikuwy{}AAAAAAAS[[[[kkkkWAAAAAAAS[[[[kkkkW  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0` 9R}     "  !"a :S~x  !"#$%&'()*+,-./0123456789:;<=>?@AQSW[egikuwy{}BRTX\fhjlvxz|~CEGIKMOU]_acmoqsYDFHJLNPV^`bdnprtZ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0` 9R}     "  !"a :S~x  !"#$%&'()*+,-./0123456789:;<=>?@AQSW[egikuwy{}AQSW[egikuwy{}CEGIKMOU]_acmoqsYCEGIKMOU]_acmoqsY  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0` 9R}     "  !"a :S~x  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~AAAA[][CEEEEIIIIDNOOOO\\UUUYYAAAA[][CEEEEIIIIDNOOOO\\UUUYY  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0` 9R}     "  !"a :S~x  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~AAAAAAACEEEEIIIINOOOOOOUUUUYSAAAAAAACEEEEIIIINOOOOOOUUUUY  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H Hthtptt  \ ((((( H thttu  \thutu  \thxty  \thy ty8  \thyty  \thz tz8  \thztz  \th{t{  \th|8t|HƄ \th|t|  \th}xt}  \th}t}  \th~Xt~h  \th@tX  \tht  \th`tp  \thPth  \thttȈĈ  \D#$d&xD%p M G A 9 3 - ' !    ߈وՈψɈÈ{uokg]WQKE?/ ՈψɈ  Q~w(/!])*+,-./012=:,-.U3J`m!.[dDQZ^j 3J`m!.[dDQZ^j03f7.RSTUVuvwc RSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}bcdefg     |hijklmnopqrst/1  $%&'()*+,-./]]('89/7]S:=UQ((!,.-glmnouGHHIILLMMOOOOPPRRRRVVWWWWXXXX^^^^ddddeeeeiijjuuvvHHIIMMPPd^^ee^deuuuudd^^ee^deuuuu^de^de^dePP@ABCDEFGHIJKLMNOW^Wd^Wd^WdWeW^WdWe^d^dddd^^d^dd^dddddd^eedeedd^eedddd^^^^eeddd^dd^d^e^e^e^dd^^^ReW^W^WeWeWW^^d^eddd^d^ddd^de^^^d^dd^^Rd^e^PPRudiu^ ^PuPOO^OdOOOR^RdReRRRW^WdWeWWWX^XXX^d^d^de^ede^ded^ded^^^dedP^de^de^de^de^^dejuOuOvOOOORuRvRRRRWuWvWWWWXuXvXXXXPPuvuvO^OdOeOOR^RdReRRW^WdWeWWX^d^d^de^e^dede^ded^^^ded^de^de^de^de^^deOORRWWXXd.. ':::@145;<=DF(EEEE11123456779:;;<==?>?BAAEBCDEF62;A1<KKSSSSTTTTUUUUZZZZ]]]]YYYY````____aaaaccccppooqqkk~~wwGOPOPOOOOOOOOOOOOOOOO@@ަ@@@ۅ@@A;ALAMA@@@@AA@ZA@tAA@@*@@<@^@e@AV@@AAA!AA#A$A8AA'A(A)AAA(A./@Ϯ@@M@@@Q@՝@@h@@@ب@d@n@@h@@@O@@@@w@@"@n@+@"@@>@I@H@P@V@]@@@@@@@@ @A@rAAAyAyAWAAAA9AAAA8AAA;klmnopqrstuvwxyz{|}~AH@AA@@2@AA@QA@Շ@H@@i@A?AAA@@@@A=AjA@΂@u@@A-A@P@AAd@AA@@@j@A@φ@ѷ@@@@@AAA\AA2AoA@@@AAAA@@@`A~@b@AA@@b@@@@/@7AK@A@@@@AAuA@@A@9@@@@p@@@Ͽ@ߩ@ @@x@"@@^@AIA@A@@A@@e@ή@i@@@AoAA@@B@s@@@@*AAjAA@қ@@wAb@t@@@@#@I@@@AoA&AA#AJ@@ң@Խ@AA@@@{@@>@u@@@@ݺ@@@i@AFA4AAHA@ϋ@AA@@Ά@@@?@@@@BAA|A@A.@҉@{@@A@@ @Y@k@A^@m@.Ax@+@@A*@ߋ@D@@A@)@@e@@N@@@@@yAAAA@?@@@@AAAWA@@A@@ @@@AX@A6@:"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""########## # # # # ################### #!#"###$#%#&#'#(#)#*#+#,#-#.#/#0#1#2#3#4#5#6#7#8#9#:#;#<#=    !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""""" " " " " """"""""""""""""""" "!"""#"$"%"&"'"(")"*"+","-"."/"0"1"2"3"4"5"6"7"8"9":";"<"=">"?"@"A"B"C"D"E"F"G"H"I"J"K"L"M"N"O"P"Q"R"S"T"U"V"W"X"Y"Z"["\"]"^"_"`"a"b"c"d"e"f"g"h"i"j"k"l"m"n"o"p"q"r"s"t"u"v"w"x"y"z"{"|"}"~"""""""""""""""""""""""""""""""""""""""""""""""""" !!!!!!!!!! ! ! ! ! !!!!!!!!!!!!!!!!!!! !!!"!#!$!%!&!'!(!)!*!+!,!-!.!/!0!1!2!3!4!5!6!7!8!9!:!;!<!=!>!?!@!A!B!C!D!E!F!G!H!I!J!K!L!M!N!O!P!Q!R!S!T!U!V!W!X!Y!Z![!\!]!^!_!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~        !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~͇͈͉͍͎̀́͂̓̈́͆͊͋͌ͅ͏͓͔͕͖͙͚͐͑͒͗͛ͣͤͥͦͧͨͩͪͫͬͭͮͯ͘͜͟͢͝͞͠͡ͰͱͲͳʹ͵Ͷͷ͸͹ͺͻͼͽ;Ϳ 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u vRk eRzmRRnRR zSgYSbTVU^Y eU W V^V rWSyWxceW|y W|WpXWXg Xvy Xza X|X|YxrX|s ezX|}ceYxrYxreYz_S|Y| iZ ^[zf[ o\SYz\b r]yY_b_ea ^d]ezefjjcekSck _ek ck {zlR^ezlYzl[lzmRxcemS emc]UzmxnYa zn`nglnzcn^n ]n aoSeozeooeo zo pSY|pSzpckpzYp]wqY|qyqyk zsWsWes ezu eu zvRycezyxzl z mz{r{eZ}ce)@*@+@,@-@.@/@0@1@2@*)@**@*+@*,@*-@*.@*/@*0@*1@*2@+)@+*@++@+,@+-@3m33J3D`m[m[+m[,@s@@-@Ԍ@'@c@@@*@@@>3d33[3!3!J[JJ`3.!`3.d[!j!j[jjj.[.m.!.[d[[[[`[![[[+`[+[+![+[[,`[,[,![,[7[7+3!3[333m3m73m7+d[DdDD[D!D[DQdQQ[Q!Q[Q! [ 3][]J```m`7!`]mJ^3d!!![!.[.d..Z[J[.[.][][DQJD7[37[*@+@,@-@.@/@0@1@2@*)@**@*+@*,@*-@*.@*/@*0@*1@*2@+)@+*@++@+,@+-@+.@+/@+0@+1@+2@,)@,*@3.bdeghikmnpqrstbdeghikmnpqrstnmnmt@@Ό@ @@Δ@m@@k@]@A@@k@4@(A@@@*@ @>@ @yA@]@Ҵ@@|@f@@A@T@m@AADEFGHIJKLMNO+*+++,+-+.+/+0+1+2,),*,+,,,-,.bdeghikmnpqrstbdeghikmnpqrstpbnm~ @@Ό@ @@Δ@m@@k@]@A@@k@4@(A@@@*@ @>@ @yA@]@Ҵ@@7@sAi@*@p@A@@љ@c@ @-@ @@@;@ۗ@f@@A@T@,/,0,1,2-)-*-+-,---.-/-0-1-2.)*@+@,@-@.@/@0@1@2@*)@**@*+@D.mRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~-./0bcdefg     |hijklmnopqrstvw $&+/1~57IJ @@Ό@ @@ @-@ @2@Y@@@)@0@κY]^ehklmnorxyz{| 7f ]s) + *+,-./012, @A@D@Ep^ @RRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbcccddeefghijkkklllmmmnnnooopqrstuuvvwwxyz{|}}~TWZ  wy-RRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbcccddeefghijkkklllmmmnnnooopqrstuuvvwwxyz{|}}~TWZ}~.   [e@@(@6@?@Y@΅@Ό@Π@κ@?@e@k@т@і@ѫ@@@@қ@@@@8@A@\@i@ӂ@Ӷ@@@@@@@ @@'@s@P@ۀ@@@"@8@n@q@@@@@r@z@@@@ @@P@a@s@@@6@K@/@4@@@@@@@@@(@ @b@y@@@@@@@4@k@*@6@;@?@G@Y@[@@@@@@@@(@0@@@v@}@@@@@@@:@@@t@@@s@@6@Q@@AA AA3AAAAAAA AAAnArAxAMAkA@ALAcA~AAAA7AFAUAxAAdApAAAAAAAAIAAAAwAAAAAAQA^AbAiAAAAAAAAAAAAAA%A/A2A<AZAAuAAAAAAAAAAA A;AJARAAA   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@6@ӂ@[@Z@Y@λ@т@@@@\@i@@@"@#@"@#@@z@Q@P@@@L@5@@@@z@@@5@:@l@+@+@,@[@@@@@:@;@@@@S@R@S@S@R@@@AAAAAAyAyAyANAdAAAAAAAAAfAAAAAAwAxAAAAAARAAuAAAAAAcAAlAA<A|AAuAAAAJAPARAAAAAA      ! " # $ % & ' ( !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ! " # $ % & ' ( ) * +KKKK , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  ==------                     89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' (|}~ (LNSTUW_`*+,-./012*)*+,-./012*)*+,-./012*)      !"#$%&'()*+,-./01234567      !"#$%&'()* / 0 1 2 3 4 5 6+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ + , -`abcdefghijklm~nopqrstuvw ) * + , - .xyz{      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~'()*+,-./0123456789:;<=>?KLMNOPQRSTUVWXYZ[\]^_*+,-./012*)***+*,*-*.*/*0*1*2+)*+,-./012*)***+*,*-*.*/*0*1*2+)*]+],]-].]/]0]1]2]*)]**]*+]*,]*-]*.]*/]*0]*1]*2]+)]3J`m!.[dDQZ^j3J`m!.[dDQZ^j3J`m!.[dDQZ^j)***+*,*-*.*/*0*1*2+)*+,-./012*))      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !!"$%&'456789:;<=>?@ABCDEEFFGHIJKKKKKKLLLLLLMNOPQRSTUVWXYZ[\X]^^_`_aabcdefghijklmnopqrstuvw-xxyz{|}~e,.z{3`3`J```J..dd[.[j j!3J`[12343Z<'mmLMNOPQR*,+,*.+.,.-.*/./*1,1.101*DDDDDZZZZ.`m[DDDDDZZZZ.`m[                 %%&'()2xyz{]]]]]] |}QQ\UUUQQU<*UVXYZ[\]^ defghi)rs-./012(4-d)*+,-./012(4- !"#$%&'(FGNOXZ\^                  ~                          33JJJJJJ``mmmmmmmmmm!!!!!!........[[[[[[ddddddddDDDDQQQQQQQQQQZZZZ^^jjjjjjQ^3333333333333333333333333^^^^^^^^7<=Wdq%:_m#$%;HUn38JVm!.[dlQ3>B=Jm![~$7DD&lmnopqrstuvwxyz{|}~,-./<=>? ABCT[)*+,-./012nouvwxyz{|}~{|}~^5cJK#$6d)*+,-./012   !$&(+0148;<=>2"',69?@- )7:35A#.%* xyz{|}~/BDEGHKMNPRTUIS CFJLQVWOX   jk789:;<=>?   TUVWXYZ[\]^_ !"#$%&'()*+m,-.q/0tuvwxyz{|}~lmnopqrstuvwxyz{|}~noM)*+,-./012)*+,-./012      !e*;DEFGHIwxyz{|}~ "#$%&'()*+,-./0123456789:;<<=Y==>>??WX???@ABCCCCCD\EFFFFGGGHHIIJJKLMNNNNNOOOPPPLQRRRSSTTUVZ^_[]`aaaENNOPJSRR>>      !"#$%&'([)+,-./0123456789:<=>?@ABCJKLMNOPQRSTUVWXYZ\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEGFGHIJKLMNOPQRSTUVWX[\]^_`EbFGHIZr*+,-./012 }~YZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`aGbIcdefNOghijklmWnYopqr^_stuvwxyz{|}~bcdefghijklmnopqrstuvwxyz{|}~Z[\]^      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ123456789:;<=>?@ABCDEFGHIJKLMNQRST"UVWXY(Z[+`abcdef345k:;<=>?)*+,-./012lmOP\]^_ghijZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ qZ[\   ]L^_`abcdef)*+,-./012*+,-./012)ghijkVXZZ\^`bHdfhjjlnprrtvxzz|~Vklmnop WY[[]_acegikkmoqssuwy{{}Wlmnopqrstuvwxyz     ;<=> !"#$%Y)*+,-./012\]^_`abcdefghijklmnopqrstuvwxyz{|}~&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTU)*+,-./012>1>8UVWXYZ[] _`abcdefghijklmnopqrstuvwx)yz{|}~:;<=DEINOPQRSTUVXYZ[\]^_\^bcde)*+,-./012pqrstuvwxyz{|}~ )4:;<=E I    NOPQRSTWXYZ[\]^_bcde)*+,-./012pqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<C=>?@ABEFGHIJKLMNOPQRSTD)*+,-./012]^_`abce ghijklmnopqrstuvwxyz{|}~)14:;DEFIJNOPQRSTUXYZ[wx^dfbcde)*+,-./012Qrstuvwxyz{|}~*+,-./012 RSTUVWX )   1  4 7:;=CDEFIJNOPQRSTUVWX]_`abcde)*+,-./012uvwxyz{|}~ "$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSVWXYZ[\!#TU)*+,-./012Z[\]^_`acefghijklmnopqrstuvwxyz{|}~:;NOYUVWmnotyzbdhi)*+,-./012qrstuvwxyz{|}~)*+,-./012*+,- Pp`a?@ABCDYKLPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      12LM;X GHILMOPRVWX^deijuv;<=>? YZ[\]^_)*+,-./01234QKJNGPGGGGYZS[\T]Ufg_`hacklmnopqrswxyz{|}~b_Nt)*+,-./012GDDIInn{{ !"#$%&'()*+,-./0     !"#$%&'()*+,-./WX0S0W`     !"#$%&'()*+,-./+>"123456789:;;<==>>?@AABBCDEF666:::RREJZs|!},04@R^j| 9=Ya,04@R^j| 9=YaRREJZs|!}II55UUQQMMK4488<<ffNN--11AA]]iiqqEEuuyy^^mm((VV  $$bbooww||%%))eeXYZ[\3`m[DZpqrsvwxy{|}: g        #    3333rss33^^Kz789:;<=>?@ABCDEFGHIJKLMNO>BFXivz+ ?CGO7<`nvh'@IMVWbw{N*2mjmm{i~..j/3Q^ !"#$%&'()*+,-./.Z0123456789:;<=>?@ABCDEFGHI333333````````mmrr!!.......g.g66ddddddd~~QQ^^^jjjjjjRX\\eevz~~jQ &&;S7nr @Iffoomjmjmj...ddd33333388!!mjmjmjdd3388 Q~w(/!])*+,-./012=:,-.U3J`m!.[dDQZ^j 3J`m!.[dDQZ^j03 R 13/ J)+, g**-*+,-V3333338`d+^3333338`d*^^ d'B@ V0b8W]@QK428/Tb828" W8 (8HPX`px 0@Xp 0@ d'B@;T Hvԥ NrZz@~ƀ#ocEx] ඳd#:(D(h m l k j i h g f e d c b a `zR|P H - zR|P  - zR|P d - zR|P  l -  n[44< $| $ $ 0 l n n n o o o !" 1' o0;$ JZ u U  n n np< o o o o p  p", 5A (F 0K ,R 4Y ] bn t ~ X(  @ X@0  Xd P B  @    %7 < @B L`X W T_`e 8l Ls z   < D4  (  Lp L  L2 L2 LP M0 !Lx ) 3 > HL ML R  \N8 cn0 s  P0X   4  8 ( , < 0 $  (  ! @( D/D 3 : A PJ X&P LW H\fqz  ܠD [$, < \D [  $h $)td =N8 j` )$  [  x "h [     )D0 -% ? 4 V &h 0( T (t )  (@\  P  '\ 6TD O $an @ & l @ "XL  %  $X >, P(D b sl| #  %0  #      ' 2H BL V _ i u             " 7 E Lo\ N`| f p y           L l  ( 8, X j( 8P   ,` X      % )\ 2 ; D S8 e, j0 nP    hl  x H  P( \  T )< ?<, [ m< zT H 0   j.   < - . 1 jH0,/:6H5V4d3r2[_  JIPHOGNFM-L;EIKWDeCsB<;A@:9?>8= 7Y)X7WEVSUaToS}RQl"! $ '&%%3#A)O(],k+y* ,  [@  ` [Zt,(,@  Qx c L@ s x< X x քЄ܄ #T8 5 G Sʄ[iwy8C |H D p p 8 ~h  | y z L {~  4 !y ' UB% W `h' jtW tz8 } u $dH XI &x uO } #  U'4  +8\ ' V$ b/8]@D GQt d W8t W(^  V@F< b8 K  X  Xx-3BHH W0@ dq|    ͘  Xπ l ߰ )?1;DNYT l XwH  m l i h g k j f e d c b a ` ( (   ".9IIIIS Y IS Y( IIIIIJ_ nq$$ l$p  n n o oD h {t G<H p t 4#Z $ .T =xD PBl r V- P H 4p $F@X $VQ $`d  $u  $H $ $@ $hPp $ $ $($bp $Tl %L %P %"L%($ %;%D %V %ed %uT %P $ %8 %  %0 %%T4h % & F  &d| &(H &-&9 &I~ &a 1&u&z,&\ &@8 &H &!qO & `P&8 &P0 'R< 'VL 'L '$X '( '/'= ɴ'Oӄ 'aÄl' 'fp ' ' -' ' ' '|x '0P (D ( o(P (+(4(;$ (HɈ(T (\U$ (d; (wX ( (( ((|0 ( ( ()| (p (p (( ) p #~) ʠ` )'l)D )MBD )^ 2)z )} ) ) ) )2))() /*~t$ * *0o *<**U*\D *z18 *p *}  ****h *0l* *+` + +h z+%+-:+G`+ML +g p+mh  +}  +4d +++ +~ +( +\< + +BDH +$+td ,Ɉ ,,,&F  ,5K$P ,M ,Y ,bD ,j\,.T,,,t , ,߈, ,e ,l,x( - -H -" -. l -8g-D -M o-T-m-{X -̴l -|| -Pl-- /!-z X - X,.X .i .# ( $`8 .2p < .A D.QͼD .d-| .{l .X .` .l.<( .(!~\.x .d /Ո/0 //TL /*p /2 3/>H/Y  /k /t /{ /t, /H / /ZX /T / /@/, %#8/ /W< /(D 0 W 0\ 000< 0CD  0O 0X 0l; 0h 0<0 -0Ԍ 0p 0P 00=, 0l1x 11*d 13ʔT 1=1V81sP  1@1L 1p 1\ 1d 11120l2 {2,28(2S 2_( 2m o,2wT2~(x 2x 2 2I 222D 2; 2: 3 G  3(tl3FK 3Y`%3h 3yF0 3l33 33t 3 3},< 3 3 o33H, 0 4 4\4249P 4M0 4Vi 4_<4< 4s}hx 4} 4~@4 44ψ4(4 K0 4t4md 4( 5l5, 5,| 5:}` 5Dl5aŐl 5s N @"5|55oH 5 55x4 5 555D 5l 5(6H 6 , 6 6% 63~D 6=Jp $ <6T + 6`6lrL 6v  6\ 6  16}, 6@ 6ZD 6l6<` 6  6_@h 7ŀl7-X75l7M X7_` Ƅ6L 7iT 7yX 77T 7P 7<( 7777 77x C 8P 8k8(P8087: p 8L0 8[ )8g8m 8yP 8~Ct 8 8 8Dl 8@ 8rXl 8[8 8\ 9XL 9 9, -93  99( 9MT 9d  9x Q1)(t 1l  9| 9 +<98 9gh 9898 9H9: !:fp :/Ĉ::[@ :Sh :__| :q :G( +::$ :h :D ::` : H: ;\ ;&|8 ;/l ;CP ;N4p ;f֔ +E  ;x> ;d ; ;h  8;[0 ; ;Hl ;h ; V<X < \ + 8<h8 <& <9\\  > ֬( >` >)t >8>? 48zT >R>Y>e />ml>p > 9%$ > > L>>@ 5">x4 =d >hl(3D^ p DmDu8 Dt !hD D8 DɈD ˼DPD D 'D4D E; EGL E' E5 EL\EZV Eb$ EoL E0E E/EWEgT EE  I$ > I !I/  : ;I  : ; ' II : ; .? : ; I 4: ; I.1@ 41 .? : ; ' I@ : ; I .? : ; I .? : ; I< 41.1< .: ; ' I@ 4: ; I .? : ; I< .? : ; I< !.? : ; I< "!I/#.1$1% U& U'1( ).? : ; I *.? : ; I +4: ; I? < ,4: ; I?  % $ > $ >  I.? : ; I@ .? : ; I< 4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; I@ 4: ; I 4: ; I 1 41  U U.? : ; I<  I!I/.: ; I .? : ; ' I@ : ; I .? : ; I< .? : ; ' < I!I/ 4: ; I? < %  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > .? : ; ' I@ : ; I  4: ; I4: ; I .? : ; I<  .? : ; I< 4: ; I? < I!I/%  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > I !I/ : ;I ' II : ;  : ; .? : ; ' I : ; I4: ; I.1@ 1 41 .? : ; ' I@ : ; I 4: ; I .111   .? : ; I< !.? : ; I< ".? : ; ' I #.? : ; I< $ U%.? : ; I< &4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ;  : ; I8 ' II : ;  : ; : ;I8 .? : ; ' I : ; I4: ; I .1@ 1 41  : ; I.? : ; I< .1< .: ;' I@ !: ;I ": ;I #4: ;I $.? : ; I< %1&1'1( U).? : ;I< *!I/+.: ; ' I ,.? : ;' I -: ;I..? : ;I< /.1< 04: ;I1.: ;' I 2: ;I34: ;I4.? : ;I< 5 6417.? : ;' I@ 8.? : ;I 9.? : ;' I :.? : ;' I@ ;.? : ;I <.? : ;I@ =4: ;I >.? : ;' I< ? U@.? : ;I< A B.1C.? : ;' I D.? : ;' I E.? : ;' I< F.? : ;' I< G.? : ;I@ H.? : ;I I4: ; I? < J4: ; I K4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; ' I@ : ; I 4: ; I 4: ; I U.? : ; I< 11 U41 1 .? : ; I< !I/ .: ; ' I !: ; I"4: ; I #.? : ; I< $: ; I%.? : ; ' I@ &.? : ; ' I< ' (.? : ; I< ).? : ; ' I< *.? : ;I@ +4: ;I ,.? : ;I< -.? : ;I< .4: ; I? < % $ > $ >  : ;  : ; I: ; I: ;I.? : ; I .1@ .? : ;' I@ 4: ;I : ; .1  4: ;I 4: ;I.? : ;I< 141  UI!I/  I.: ; I 4: ; I.? : ; I< .? : ; ' I@ : ; I 4: ; I !I/!&I"4: ;I?  % $ > $ >  I : ;  : ; I8 I : ; I .? : ; ' I@ : ; I 4: ; I .? : ; I< 4: ; I.? : ; I< I!I/ 4: ; I? < % $ > $ > : ; I : ;  : ; I8  I  : ; .? : ; ' I : ; I 4: ; I .1@ 1 41 .? : ; ' I@ : ; I 4: ; I .? : ; I< 11  U1I!I/ .? : ; ' I@ .? : ; ' I< I.? : ; I< U!.? : ; I< ".? : ; I< #.? : ; ' I< $ %.? : ;' I@ &: ;I '4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.: ;' I@ : ;I 4: ;I 1 1 U41 1.: ; ' I : ; I4: ; I4: ; I.? : ; ' I< I .? : ; ' I< I!I/ &I .? : ;I@ : ;I .? : ;' I@ 4: ;I !4: ;I"4: ; I % $ > $ >   : ;  : ; I8  I: ; I ' I I .: ; ' I@ : ; I U4: ; I 11 4141 11 .: ; ' : ; I4: ; I4: ; I  U.: ; ' I .: ;' I : ;I4: ;I  !.1@ " #.? : ;' I $.? : ; I< %&.1< '.? : ;' I@ (: ;I ).? : ; ' I@ *4: ; I? < % $ > $ >  I.? : ; ' I@ : ; I 4: ; I .? : ; ' I : ; I 4: ; I  1 .: ; ' I .1@ 1 41 11  U.: ; ' I % $ > $ >  I  : ;  : ; I8 : ; I .? : ; I@ 4: ; I .? : ; ' I< I .? : ; I<  .? : ; I<  .? : ; I< .? : ; ' I@ : ; I  U.? : ; ' I< 11 U41 .: ; I : ; I4: ; I.? : ; I< 4: ; I? < % $ >  I$ > : ; I  : ;  : ; I8  : ;  : ; ( <  : ;  : ; I8  : ;I8  : ;I8 I!I/!I/ : ;I : ;' &I' II'  : ; : ; : ; .: ; ' I@ : ; I 4: ; I !.? : ; I< "# $.? : ; I< %.? : ; ' I@ &4: ; I'1(1 )1*.: ;' I +: ;I,.? : ; I@ -1. /.? : ; ' I< 0.? : ; I< 1.? : ;' I@ 2: ;I 34: ;I 44: ;I541 6.: ; ' I 7: ; I84: ; I? < 94: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; ' I@ : ; I 4: ; I 4: ; I.? : ; ' I< I.? : ; I<  U.? : ; ' I< &II!I/ 4: ; I? < 4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; I@ .? : ; ' I< I &I4: ; I .? : ; ' I@ : ; I 4: ; I.? : ; I< .? : ; ' I<  U11 41  UI!I/!I/ &.: ; ' I : ; I! "4: ; I? < % $ >  : ;  : ; I8  I: ; I.? : ; ' I@ : ; I 4: ; I .? : ; I<  .? : ; ' I< I&I4: ; I.? : ; ' I<    4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; ' I@ : ; I 4: ; I 4: ; I .? : ; ' I< I.? : ; ' I<  &II!I/&.? : ; ' I : ; I.1@ 1 41 .? : ; ' @ 1 11.? : ; ' I@ .? : ; I< !% $ > $ >   : ;  : ; I8  I: ; I .? : ;I : ;I .? : ;I<  .1@ 1 .1< .? : ; I@ : ; I 4: ; I 4: ; I 4: ; I U.? : ; ' I< I1.? : ;I@ : ;I : ;I  .? : ; I@ : ; I % $ > $ > .? : ; I@ : ; I 4: ; I 4: ; I I I !I/ % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I &I% $ > $ > : ; I.? : ;' I@ : ;I 4: ;I % $ > $ > : ; I.? : ;' I@ : ;I 4: ;I % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U.: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 1 11  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U.: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; II!I/ &I4: ;I?  HGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)WebX.c/SOFT/WebX/WebX/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned charlong long intFILEJblong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _5 ino_t Jblkcnt_t blksize_t long double mode_t mJ gid_t y dev_t J nlink_t Jtimespec&tv_sec'#tv_nsec(#timestruc_t> 1 statst_dev#st_pad1#st_inoa#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksize~#Pst_blocksn#Tst_fstype#Xst_pad4!#h     'name%Y#val&Y#entry'heapblock&m_next'#m_used(#heapblock_t*_heapalloc,smallreq-_#bigreq._#X_heap0(avlleft#right#balance#key_# data _#savl_t"savl_tree%root&#cmp'+#+c__avl_tree_t)qX_varinextjq#valuekY#CX_varmC X_USER0pavlq#namerY#varsw#fixedt# cookieu#"cleanv#$hpw #(nextx#,eX_USERzX_FILEtextY#offset#size#stat1# path#next#  &X_FILE&"X_FUN(avl#nameY#file"#offset#var(# next.#$wX_FUN ,files"#functions#x_USER#freelist# vtree1#ftree1#ctree1# hp #(4X_BUFFERSA scprintedtc ,Hn p eX_avlcmpc^v1_Xv2_Y X_startcbuff err X_envc  c en z   fX_checkpagecnpageYhbuff f} 9accessc LUc \!Uc w"+ maincnargcchargv iic]shellcd#  X_trace#c X_debug$c GetMethod&c 3X_valuesec PX_set_cookiesgc# [ $ sX_actionkc X_exitnc$ e z % z & *( CheckEnctypeMethod)c GET_parser3c  +cGET_path4c& Ppage>ccbuff? f|%x iUc  Gc''<P( dp E_POST_parser+c! +c% POST_parser/c! +cY)X_startc*sc Ab +__iob 1+POST_errmsgY,Tracec p,X_INSERT_ID" ) "',ent  ,Debugc p,Cookiec p,X_eofc o,X_fp  o,X_BASEY o,X_BASE_holdc o,X_PAGEY o,X_ERRORY o,X_HOMEY p ,TMP_DIRY p ",X_ERRMSG ,DIRY,x_BUFFERS  o[O(GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ACT.c/SOFT/WebX/WebX/srcintunsigned char)long long intlong int)charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleNX_actione(^X_printfileeX_PAGE}\(GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ENV.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned char6long long intFILEJelong int6charshort intshort unsigned intlong long unsigned intlong unsigned intlong double !X_env'f(n host( dir( name( chp( env( buff_env)! p buff*2h len+fc fp,Cb I,H ]e ]eputenv=fputenv=f2C }getHOMEf fname}accessfAX_exitTf\ncodeSfh buffUA iVfX_traceXfX_finishifgetpidjf/unlinkkfexitfRbe__iobRTracesfX_HOMETMP_DIR; \GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_MSG.c/SOFT/WebX/WebX/src__va_listieva_list5g__FILE__FILE_cnt##_ptr$#_base&#_flag'# _file(# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intunsigned char Clong long intFILEJlong int Ccharshort intshort unsigned intlong long unsigned intlong unsigned intlong double ERRMSG\n fmt7l apxlocked  lenX_trace  X_header* X_printfile> X_exit4 DxX_exit4 TracesX_fpx;X_ERROR~7cX_ERRMSGRX_stdout; NdGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TRACE.c/SOFT/WebX/WebX/src__va_listigva_list5i__FILE__FILE_cnt##_ptr$#_base&#_flag'# _file(# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intunsigned char Xlong long intFILEJlong intoff_ttime_t@   Xcharshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _O ino_t dblkcnt_t blksize_t long double suseconds_t 9 mode_t md uid_t u gid_t y dev_t d nlink_t dJtimespec &tv_sec '#tv_nsec (#timestruc_t >timeval 1tv_sec 2#tv_usec 3#statst_dev#st_pad1#st_ino{#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atimJ#8st_mtimJ#@st_ctimJ#Hst_blksize#Pst_blocks#Tst_fstype#Xst_pad4#h      Lheapblock&m_next'L#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#RX_heap0e avlleft #right #balance #keyy# data y#avl_t"Mavl_tree%root&M#cmp'h# hyySavl_tree_t)X_varXnextY#valueZs#X_var\IX_USER0_avl`#nameas#varb#fixedc# cookied#"cleane#$hpfI#(nextgO#,X_USERiX_FILEtexts#offset#size#stat# path#next#  cX_FILEc_X_FUN(avl#names#file_#offset#vare# nextk#$X_FUN ,files_#functions #x_USER #freelist # vtreen#ftreen#ctreen# hpI#(qUX_BUFFERS~ cPfp cFtp]tv] )Dn ;X E  N  Xh ~X_debugTDTnfmtSshapUzfpV c (InitW ,buffX ~   c D )@ |@ X dh access&@!e/  c"P X_traceTnfmtsiapzfp c 0Init 4buff ~# PB @ )X |a$ X% _access& |$h!e/!e/&Traces&Debugt&X_fpx c&X_HOMEs&TMP_DIRs&x_BUFFERS uEdGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TRANS.c/SOFT/WebX/WebX/src__FILEuh__FILE_cnt#h#_ptr$o#_base&o#_flag'u# _file(u# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intuunsigned charlong long intFILEJglong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _: ino_t Oblkcnt_t blksize_t long double suseconds_t 9 mode_t mO gid_t y dev_t O nlink_t O'timespec&tv_sec'#tv_nsec(#timestruc_t>ntimeval1tv_sec2#tv_usec3# ~ statst_dev#st_pad1#st_inof#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim'#8st_mtim'#@st_ctim'#Hst_blksize#Pst_blockss#Tst_fstype#Xst_pad4n#h     ' "^#^#len h#X_val"iheapblock&m_next'i#m_used(#4heapblock_t*4heapalloc,smallreq-#bigreq.#oX_heap0(avlleft(#right(#balance#keyd# data d#avl_t"javl_tree%root&j#cmp'#.hddpavl_tree_t);X_varij#k^#X_varmaX_USER0pavlq.#r^#vars#fixedt# cookieu#"cleanv#$hpwa#(xg#,X_USERzX_FILEtext^###stat~# path##  {X_FILE{mX_FUN(avl.#^#filem##vars# y#$ X_FUN X_CMDavl.#code#X_CMD S,filesm#functions S#x_USER Y#freelist Y# vtree#ftree#ctree# hpa#(mX_BUFFERS 3fp0 #1 #  X_OPEN3 p $>< #shm=^#  X_SHM> vcmdt^#codeuh#cmd_tv  WQhtmlN^#textO^# HTML_codeQ - X_search_commandh^initcmd hpanh itn h   Y cP b /lowercasehstr^ J tn #h nuppercasehstr^ Jn bh X_fflushhfp  Dn X X_fgetsh^hfpmnhh M D4n ` i j h  cut_cmdh4n!fpmh"oi#ih[#nhY#in }$ h%  L& & LaY' ,& (& /& 6( `% M & (& /& 6( `(0) f ;h' & & aY' & (& /& 6(H ` u*++cut_commenthfpm^first^last^,X_quitWh-V^-Vh-Vh$hh)|_h.K]hn1`=ZIj/U/h| }X_USER_new Y`n!hpXah"^i"^j0nh#p^h#hpa`0u Y $kh.K]h1count_tree%h2a$j2len$0n&hh}`naiX1Oscan_tree5 Y2a4j2patt4^0curr6 Y36 Y0p6 Y4X_CMPpatt;hn`ih"X.]8,6X_clear_valueYh2name_pattX^0uZ Y0prevZ Y3Z Y$h5&O6[&66&b&i66"6.1vX_USER_delh-^0u Y.h1X_USER_extract Y-^0u Y0prev YonhQ6a/%)Tb`&i(`a"X.]'6dlO`(x6['vhl&(h67kX_put_valuehln"^h"^i!fixedhj!cookiehk0nh#hpa`#u Ya$h)_h%@k & 6()Yh._h1X_USER_get Y-^0u Y7AX_add_valuehlhn"^`"^j0nh#hpai#u YX#vsk)_h'kp&p6,X_get_value^-^0u Y$h&6Ahn\h6h/r'kl|&l|68gh0ih^]9C h2id^0i hePn-h8`,HTML_string^2ch0inith0HTML_char0str0chp^0ih ^   CePn_ 8 < @mlm,}X_putchar wh2ch v&66C0n\\%e,\h(](]:uCh0n!val^h!out^i#lenha#ih`#chb%C @ X'e|&(]];GetDDT 0Init 0tp :0tv :0D u$n B Dh69?!h2date ^0i"h0n"h3#?h O $|n`66#P/9/h2date.^0i0h0n0h31?h |n`66P9YB>h2date=^0i?h0n?h3@?h ln`6)63=PI<X_get_base^lx^,X_crypt;h2in:o2out:o0key< 0n=h0len=h&'&2&>1Kcrypt_char1u2ch0u2key0^2len0hxnhiP`a''a&2&>:& hPn" ^h!out ^i0i h#n h}= &0env ^0val ^$/h>MCh^^?#format Z&~#val Z&~0chp Z^#dt [}) ;h@X_dt2str oh.C hA .C hA0.C hA/08.C h?0= K'}0pos L#i Mhb)uC h(P.C h?p)Ph.C h?0#fmt $'}0val $^#chp $^Y#f %'/})C h'A&(6hAN.C hA0@|escape_shell_cmd h.C hA0d#url &~@escape_url h.C h? )C h' Àô BaA(ô.C h?m)EC h''8Ĭ&'P('\`'faAL)C h' J @ a?,(#format x&~#val x&~0chp x^#dt y}) ;h@X_str2dt h.C hAƀ0crypted L^B]'oo)qC h'Ƭ&^&eƬ~a`'<'a2c&>? '@B'^)C h'Ɉɴ&b(X66#~? pB ?'^) SC h',&(66~? B '^) C h' \ʸ&l(6)63=~?!9#string &Ȼ~#s1 hc#s2 hd#m ha.C hA!h#len '~.C h?!= '}.C h?"B#string &}0no h#m h\#n hX)!C h''ͬ&'&''d(0( [(\''8ͬ&'P(P'\`'fa?"|p#fmt '}#L }.C h%"k&6A" .C hA##,#init  L= '})#C h4getpid hA#Ӝ= '}0u Y0n h#len h})#zC h%#}ӠӤa&(X?##tv :}= '}.C hA$f@= '}0fun S0n h#len h})$:C h%$X}DHa&(XA$.C hA$,= '}.C hA$,L= '}.C h%%&ALh&(6h'kLX&LX6A%U= '}.C h%%uL}6(}6A%֔#T }= '}.C hA%<= }'}.C hA&.<`)&C h4X_today vhA&L`|.C h?&#i ^h}#sst ^h`#f _'/}= `'}@&EXPR_parser bh)& ;h.C h$،.C h &* ' c ' ; '/ Ofloat1'trim_buffh-^0ih0nhhCX_crypt;hD!hD/hDB>h ' '1(getwordh-^2noh2word^0ih0nh7(mX_printvalue hP`^" ^XE h^^:) h`(n" ^X!out ^i" hj#chp ^h= )_#fullname )#i h\#n h[?). hA)7.C h%)Cd&'e ۸&(H]4ۤ]' t X )*7+X_shmdt h(n" ^h" hi" hj#io &0i h0n h0key h3 h3 h0len h#chp ^`= +=W ^h$*h)*_h)*Ph%*+-@&+C(`+O`'6޼&O޼6['v޼&޼`6 +-*1+ZSHM_del 8h- 7^0i 9h7-X_shmat qhn" p^h" phi" phj#io r&0i sh0n sh#key shd= shc= she#len shf#chp t^`= t+=W t^i$,@h),T_h),hPh%,+-\&+C(x+O`%,--j&-&-&-&-(. X.]6.%,k&6%-G6$&O$6['v&`6%-k+-d&+C(+O`'6&O6['v&`61.)SHM_att Ih- H^2key Hh- Hh- Hh2len Hh0u J Y0i Kh0id Kh:/9} h(n" ^h" hi" hj#io &#i h`0n h0sz h3 h#chp ^`= +#mode ^c= ^d=W ^b0fp  $/h)/(_h.Ph:0r h($n" ^h" hi" hj#i hi0n h0sz h#io &#chp ^a= &~= ^`=W ^c0fp $0 h)0_h)01Ph'A8&(6h'k(&(6:1g h$n" ^h" hi" hj#io &#i hi0n h0sz h#chp ^`= &~= ^d=W ^c0fp $1Bh)1V_h.Ph:2x ^hn" ]^h" ]hi" ]hj#io _&#i `hi0n `h#sz `he3 `h#chp a^a= a+= a^d= a^j=W a^c0fp b $2Sh)2g_h.Ph:3I :hn" 9^h" 9hi" 9hj#io ;&#i <hi0n <h#chp =^`= =+=W =^c$3$h)38_h.Ph:4 hXn" ^h" hi" hj#io &#i hi0n h#chp ^`= +=W ^c$3h)4 _h.Ph:5w hXln" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$4h)5_h.Ph:68 hln" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$5h)6_h.Ph96Nnh-m^-mh-mh0ioh0noh0retp&$6|h)6Nh._h66n6%`61i6=j66I66S6]/66i/66|6,7X_exec[h-Z^-Zh-Zh0i\h0n\h3]'0args]&$7xh)7Nh)7_h)7Ph4X_exec_callgh8J6n7a7 i7,j67867B7LH7Xȿ/87e/8)7x/857/8A77:9hn"^`"hi"hj0nh#ihj0oldlenh0newlenh#out&#chp^a#cmd9ؿ=&#old&#new&$9:h)9NNh)9b_h)9vPh)9 ;h'Ah`(6h'kt&t6 9 7:X_fork hn" ^`" hi" hj#pid :~#nm :|0sst$:dh):xNh):_h):Ph4forkh : :;hXn"^h"hi"hj=:~#nm:|#v&3^#ih[0nh$;kh);Nh);_h.Ph7<X_clearhX|n"^`"hi"hj=&$<h)<&Nh)<:_h) <|\n= a=i=$j=0/==</==O/==c/>=w=,>X_errorh-^-h-h0msg&$>dh)>xNh)>_h. ;h>> \(n>!a>-i>9j>E/>>Q/>>d/>>x>7CdX_leth( n"^h"hi"hj#let&0ih#nhi#chp^X3^=&~$?h)?Nh)?_hA?.Ph?@X#val^Y.Ph?@qx)@4Ph'AX\&(6h'kX\&(6?@.Ph?@)@Ph'A ,&(6h'k & 6?A(.Ph%AGA&(H6h'k&6?A`)AdPh'Ax&(x6h'kx&x6%AATX&(6h'kTX&(6?B0valx^#name2x^i)BPh%B^A&(6h'k&(6'A <&(6h'k ,& ,6%BA&(06h'k&(P6%C#ALh&(h6h'kLX&LX6'A ( H&(6h'k ( 8& ( 867DJX_addh  n"^`"hi"hj#add&#iha#nhb0chp^3^=&~$Dh)D%Nh)D9_h.Ph7E0X_seth  n"^`"hi"hj#set&#iha#nhb0chp^3^=+$Dh)E Nh)E_h.Ph,EX_shellch-b^-bh-bh0outd&)ENh)E_h$Eh. ;hF"E0  nEG`ESZE_jEk/FEw/F E/FEE,FX_sqlnamesFh-E^-Eh-Eh0outG&$Fh)FNh._hFF"  nF<`FHiFTjF`/FFl/FFF,GX_chdir4h-3^-3h-3h0n5h0out6&$G[h)GoNh)G_h)GPh4chdir?hHF nGaGiG&j6G2G</GGH/GG[/HGo/HGG,HX_usleep"h-!^-!h-!h0n#h0out$&$Hh)HNh)H_h4usleep-hI$HnH2`H>iHJjHVH`/IHl/IH/IHH,IX_sleeph-^-h-h0nh0out&$Ih)INh)I_h4sleephJ,I$nI;`IGiISjI_Ii/J Iu/JI/J#II7JX_sqltraphHn"^`"hi"hj#cmd&0val^$Jh)JNh._h,KKX_htmlh-^-h-h0cmd&$K&h)K:Nh._hKJHPnJ`JiJjK/KK/KK&K:,LX_compileh-^--h0cmd&$Kh)LNh._hLrKPPnK`KiKjK/L]K/LiKL7MX_optionVhPn"U^`"Ui"Uhj0nWh#sigWh`#cmdX&0chpX^=X^h#valX^b$M!h)M5Nh)MI_h)M]Ph)Mq ;h%M   Bj%M H B`?M. ;h4alarmh,NpX_trans_printfileKh-J^-Jh3L&0fnameL^)NANh)NUPhEa h^hNMPnMhNiNN`/NN-/NNANU^h:Om hP@n"^a"hi"hj$O%h)O9_h'M&N&NNNa7VX_commanduh@-n!fptmh"t^i"tj"thk=v P#nwh\FPX_leth^hh?T.FP4X_seth^hhFPYX_addh^hhFPX_ifhm^hh>P'h^hhFPX_sqlhm^hh)P1hBPV^hhFQ'X_Filehm^hhFQSX_xFile=hm^hh>Qv ^h^hh>Q h^hh>Q h^hh>Q} h^hh>R8 h^hh>R%w h^hh>RH h^hh>Rk :h^hh>Rrhm^hhFRX_whilehm^hh>R h^hhBRV^hh>Sh^hhBS7V^hh>SZh^hhBSsV^hhFSX_clearh^hhFSX_fork h^hhFSX_shmat qh^hhFTX_shmdt h^hh'|&Z&%Tk6  &66a&6(66I66S6]п%T6 !&77`&7(67867B7L{7Xz%T<#T#&==a&=( =0}%U> #$&>>a&>( (>Eп~%UOE0$%&EEZ&E$%Ek~%UF"%&x&FFa&F( @F`п}%UF&x'&GGa&G( X6G2G<{%UJ'<( &K^Kea&Kl( pKп{%V*H( (&HH`&H( HVzH`|%VgI$()&II`&I( I_zIiп|'K)*L&L2&L9&L@( KzDNnhCX_errorhD^hCX_exec[h:Ya h-3n!fname ^c" h#level h P#file mi#fp  b= &= &#oldpath ^c#newpath :0t h0n h#sst ~= m$Wh%X:Y/ /&Y4YBb( 6YR'A// `( 6h'k// &( 06%Xj /0p (`& /& 6( X a?X pE h^^h?X )X ;h)XK]h' 11 X( )X ;h)YK]h' 234 X1Y`new_dir h2fname ^2newpath ^0root ^:ZYl{h36n!fpzmh"zh"zhj0i|h0j|h0n|h0sst|h3}=~&=~&$Zh%ZB 34h (`& /& 6(  i( .Nh:\1h6:n"^`"hi"hj!ret^k=l0ih#nhX#argsh~#out&='#val&~#chp^X#sym^X#oldReturn^~#fun Sb#vsj#u YY#x_USER Yc#hpag$[h)[Nh)[_h)[Ph)[ ;h%\v7 7T`7$7Tk6( )\8h'69@9|O`9D9|6['v9D9l&9D9lk67\X_signalh:;n!sighh= \}( $\h._h ]*+;]MX_error_cid^0cmd]M)]; ;hh ]^*]];D>]|( 8]| `jX_sqllineh@BDn!query^c#cmd&@_X_noselect_sqlh%_ @H@L BaA`A4Ap@_X_finishhB_`j'ADAp]ADAp]ApB<)`;h)`O ;hAB$hHgh:aJ'hBDCn"^`"hi"hj#query&#cid^h$`h)aNh)a_hBa)aJ^'BC$&V( X8jD h:brhCFn!fpmg"^i"hj"hk0ih#nha0argsh#out&='#chp^X0sym^#fun Sc#hpab#vsk$bEh)bYNh)bm_h)bPh( p.>h:cRRhFG<n!fpQmh"Q^i"Qhj#uS YX0nTh3Th=Ub#srcVh#varVs`#vVsi$cIh)c]l'h%ckF4F<&( 6AcFF.l'hG G.l'h:e 4'hG<Hn!fp&mh"&^i!sep&^j"&hk#u( YX#n)hQ=)hf=*a0src+^#val+e b#chp+^i=+&$dh)d>h)dl'h%dkG\Gd&( 6?d .l'hH<HP.l'h^9el'h2fpm-h3$eYh.l'heeHIne#he.ie:`/eeFHHeZ7gX_whilehIK(n!fpmh"^i"hj"hk0ih0jh#nhX0ssth0linesh3#out&#chp^i#cmd9ؿ=&#sep&$fh)fNh)f_h)fPhBggmh>g-4'hm^^h>gPRRhm^h)gd ;hAgJ4JH.l'h'eJtJ&e&e( e:kD'h7iX_founduhK(P n!cidt^!hpta!fptm"th#valviQ#iwhc0jwh#nwh#sstwhm#lineswhd=x=y&=y&$hh)hh)hl'h?i1 )h_h)il'h)ih' JLhL `%iJ MM B`O0P)igh)i{ ;hOP)i_hE1h^hh^ i'*7kX_sqlhP T4n!fpmg"^i"hj"hk0noh0ih#nhܐ0showh0ssth#cmd?P#query&п#vali#cid^b#hpac$jh)jNh)j_h)jh%k PQ  B`?k ()k5h)kIh( H)kbh)kv ;h)kh)kh'R@Rx&VR@Rx8`'SDS|&V( `8`7mX_xFile=hT4Vn!fp<mf"<^i"<hj"<hk#fp_OLD> c#fp_NEW> d=?&#i@hb#FF@hb$lh)lNh)l_h)lPh)l ;h)ll'hUU.l'h7nBX_FilehVWn!fpmd"^i"hj"hk#fp_OLD c#fp_NEW k= &#FF!hb$mh)mNh)m_h)mPh)n ;h)n'l'hWW.l'h7r]X_ifhWdn!fpmj"^d"h"hk0u Y0ih0jh#nhi0ssth#Nothk#i1ha#i2hZ#linecmdhh#f1r]#f2r]ؾ#out&#chpcmd^f#chp^a0name1^#name2^`#op^a#v1^`0v2^#f_sst~$oh)oNh)o_h)oPh)p ;h>p4l{hmhhApZYZ84X_user_fcmph?pt x.hApZZ.l'hAp[[t.h%pA\\8&( 6h'k\\(&\\(6Aq\]4X_user_icmph%qJ ]`] (`& /& 6(  aAqh``.l'h%qAaxa&( 6h'kaxa&axa6Aqaa4X_check_datehAqb0bD. ;hArbc4accesshAr:dd4X_check_floathdd4X_check_inthdouble rwg I__iobrgITracehIX_INSERT_ID8IDebug*hIX_eofhIX_fp IX_ERRMSG&IDIR^Ix_BUFFERS _JHTMLhJX_linesh TJX_lenhJContinueBreakh JContinueh JBreakh KX_stdout  JReturn^ JX_sqlcase h JX_sqlTRAP!h JX_sqlFUNC"h JX_sqlTRANS#hJX_sqlcode$h JIgnoreEmpty%hIX_rowcount)h tb Jx_OPEN5tR X t Jx_SHM@tv t ?JTRAPfuncCt JDO_fflushDhJMY_fflushEh t +Jx_CMDyt u&  JSignalFUNCu X uN W 4#HTML_tabUu> u{   #cidue X uh  #c_freeu#base^ #key_p.h  pdGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_VAL.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned charlong long intFILEJelong intoff_ttime_t@  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _+ ino_t @blkcnt_t blksize_t long double mode_t m@ uid_t u gid_t y dev_t @ nlink_t @timespec &tv_sec '#tv_nsec (#timestruc_t >{statst_dev#st_pad1{#st_inoW#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksizet#Pst_blocksd#Tst_fstype#Xst_pad4#h       'name%O#val&O#entry'heapblock&m_next'#m_used(#heapblock_t*cheapalloc,smallreq-c#bigreq.c#X_heap0,avlleft#right#balance#keyU# data U#wavl_t"wavl_tree%root&#cmp'/#/fUUavl_tree_t)uX_varXnextYu#valueZO#GX_var\GX_USER0_avl`#nameaO#varb{#fixedc# cookied#"cleane#$hpf#(nextg#,iX_USERiX_FILEtextO#offset#size#stat%# path#next#  *X_FILE*&X_FUN(avl#nameO#file&#offset#var,# next2#${X_FUN ,files&#functions#x_USER#freelist# vtree5#ftree5#ctree5# hp#(8X_BUFFERSE fdgTnrootOhu {chpO  Omf bof e4e   z f0f @ yff ofmf  )regular_filef!uOsst%mf fgTinrootOhuiu {"chpOQ Yf# X_heap_reducef gh $ 0` ;` F{ Rc _h hh x z iroot_levelf$rootO!uOchpOname ilevelfif y c% X_values>finnprog=Oh"n?f`No?fMax?fv@,"ServerA i"ConfigA i~"httpA i}"holdA }"chpAOY"S_NAMEAOX"S_PORTAOX"fpB `"X_ROOTC  "baseC  "pidC  hpD"uE` mf Yf# chdirmf of# getpidqf& fO' :l0l\(X_add_valuef' Wllf' ~ll)fO Yf(getcwdZf      '*'X_set_cookiesfnpn+buff'+namelistOX+chpOa+nameO`+valOQ+cookieOh+nfb,{f-f,{f-f' p\p,f-fpp-f 8.Tracesf X'.entoG.Debugtf.X_BASE{O.X_BASE_hold|f.X_PAGE}O.X_ERROR~O.X_HOMEO.x_BUFFERS|ppGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)EXPR_parser.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intYYSTYPEt_intt_floatlong doubleYYSTYPEyyalloc yyss yyvs short intyysigned_char  <signed chari Kpp^ Fyyparse lip{n yystate nic yyn oib yyresult pih yyerrstatus rii yytoken ti[ yyssa F| yyss ]e yyssp ]d yyvsa cc yyvs sj yyvsp sh yystacksize m yyval c yylen ig yysetstate q yynewstate =s yyexhaustedlab zt yyabortlab td yybackup q yydefault CrX yyerrlab r yyreduce Mrp yyacceptlab { yyerrlab1 ur yyerrorlab jr yyreturn th fyq(q yysize bqXq yyss1 ]h yyptr `qxq `qq rs EituccfccfVVsViyylexdiieffvalgchphisdigitpicharEEXPR_parseri{|pnexprXv_intEiv_floatKjiihiQfloatvalue_int value_float EXPR_BUFF EXPR_INITi EXPR_FLOATi  V!p yytranslate (M0!V yyr1 x(L!=V yyr2 PL!-eV yydefact |L!UV!& yydefgoto Lp!V yypact N8!V yypgoto Lx!V1 yytable .L!CV1 yycheck YL!3nV yystos LP!^"yychar Mi -"yylval P -"yynerrs Si |pGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_EXEC.c/SOFT/WebX/WebX/srcintunsigned char long long intlong int charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleC name#functionN#NfC X_EXEC  X_exec_call0f|p}n name/h args/i n1fa 3f MstrcutKf}}n fnameJh argsJi nameLM strLM~valLnMf=3f Sf]c chcharjf}n fnameih argsii namekM strkM~valk ch1kQ ch2kZnlf3f Sf StrLenfn fnameh argsi nameM lenM~valch1ch2nf3f SfTracesfT Exec'0 9XGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_check.c/SOFT/WebX/WebX/srcintunsigned char<long long intlong inttime_t@]tm$Etm_secFg#tm_minGg#tm_hourHg#tm_mdayIg# tm_monJg#tm_yearKg#tm_wdayLg#tm_ydayMg#tm_isdstNg# <charshort intshort unsigned intlong long unsigned intlong unsigned intdlong double heapblock&m_next' #m_used(l#heapblock_t*Zheapalloc,smallreq-Z#bigreq.Z#X_heap0#` patt#dimPATT#pattCACHEt X_get_intg buff val leng ig #^XYZ]zX_check_float*g nbuff)hi+g\ len+gdot+g[X_check_date?g nval>hdaylong@PbuffAdayBgXmonthBg` yearBgc_dayC~c_monthC~c_yearC~ spaceDg iEg nEgaatoiNgD [D][ 0]$X H]g] d]c"d] jX_check_intYgnbuffXhiZg] lenZgX_todayinhphnhtmjXTkDbufflHchplhd]'&gnpatthvalicache currg ig`amalloctIgdim_LOADpattg0g `!0g$dim_FREEpattg"freeg]X_CMPpattgnpatthvaliop` sstg#s&g$ 4!&g!&gEX_user_cmpgnv1hopiv2jPgIg$/!g!g%X_user_icmpgn&v1 gh&op i&v2 gjPg!Ig% #X_user_fcmp8gXn&v17 #h&op7j&v27 #` Pg!Igdouble'Tracesg (XGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)FMdate.c/SOFT/WebX/WebX/srclong inttime_t@k1tm$Etm_secF1#tm_minG1#tm_hourH1#tm_mdayI1# tm_monJ1#tm_yearK1#tm_wdayL1#tm_ydayM1#tm_isdstN1# intunsigned charcharshort intlong long intshort unsigned intlong long unsigned intlong unsigned intPlong doubleub1 ?ub2 vTdatime year #month #day #hour #minute !#second "#datetime_t $}SETdate -1Xn v ,}h  ,i  ,j  ,1k count .1] T /w tm 0X ,     `h pb x    ``  8 4 ? J U `i`rX 08     $`-P <l4     `HT h s ~  (`@TGTOsecond /1v .} . . .1i 01n 01{ 1G n 1WWd)X 1W` 1WWWP8]P TOminute N1v M} M M M1i O1n O1{ PGn 1WWdX 1W` 1WWTOhour m1v l} l l l1i n1n n1{ oGn 1WWdX 1W` 1WWTOday 1v }   1i 1n 1{ GZn 1WWdyX 1W` 1WWTTOmonth 1v }   1i 1n 1{ Gn 1WWd6X 1W` 1WW TOyear 1v }   1i 1n 1{ GX 1Wn 1WWd 0 g W` 1WW o Rg W` 1WW  g W` 1WW g W` 1WW oX_date_info m14nyear l ohmonth l oiday l ojhours l okminutes l olseconds l omX X_dt2str x14ndt wk  wY  wZ v yTh tm zX RX_str2dt 1(n  h  idt  Rj v Th tm @!tmp k"Ok *1 "Skip *1 $"Year *1 ("Month *1 ,"Day *1 0"Hours *1 4"Minutes *1 8"Seconds *1 < (GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_AVL.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublenavlleftn#rightn#balance#key# data #avl_t"avl_tree%root&#cmp'#t e  avl_tree_t) favl_insert@e(n t?f` a?i HGh^l}Q00]Q hih0dhl }  tt:Ql}]Qavl_swlrootabavl_swr'root&a(b)avl_nasty1root0 avl_removeen tfh aive` Wssteh ssteh7@XKi$8$8Q(l8P}8P]QAPXll}l}lTd}TdQdd]QUavl_removerootetfssteaavl_search"t!fa!x#etree3 tree)!UPnn`xiX" hh#oAVL_search@t?fkey?aAt$Ie%  e !P@ni Y,X&6%Up`X"P0H'AVL_removee@Tn(tfh(keyia$Ne%XH,XUd`hX" PH) AVL_inserteTn tfa ai$ e% blY,XU|`X" x @PH*TraceseoՄGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TOOLS.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublepX_take_stringgD^buffXvalYig\ng[X_arg_string=g buff< val< i>g n>g ch?  stop_char* ch)2pDnh]lkk AX_arg_string_sepegnbuffdhvald]sepdjifg_nfgi chgAP S ]PhmAlSQ ]hlpd  lkk, stop_sepYg chX sepX iZgGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)X_heap.c/SOFT/WebX/SQLintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleHheapblock&m_next'H#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#NX_heap0a UX_heap_new#hn hp$h  w  5_'4H(_H` C(_free0_IX_heap_alloc>hdncurrheap<asize=_i mb?` cp@h 5_  w I]@gQt]/p wL\(_rmalign_mbbegin_end_5_ )X_heap_free_dnhp` mbX 5_free0_free0_free0_ X_heap_reduce_nhp` mbQ x5_htfree0_Traces_'|hGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libmySQL.c/SOFT/WebX/SQLintnunsigned char]long long intsize_tRlong int]charshort intshort unsigned intlong long unsigned intlong unsigned intlong double_ "name#value#len a#X_val") heapblock&m_next'#m_used(#lheapblock_t*l heapalloc,smallreq-#bigreq.#X_heap0my_bool3my_socketAa 8enum_server_command8 COM_SLEEP COM_QUIT COM_INIT_DB COM_QUERY COM_FIELD_LIST COM_CREATE_DB COM_DROP_DB COM_REFRESH COM_SHUTDOWN COM_STATISTICS COM_PROCESS_INFO COM_CONNECT COM_PROCESS_KILL COM_DEBUG COM_PING COM_TIME COM_DELAYED_INSERT COM_CHANGE_USER COM_BINLOG_DUMP COM_TABLE_DUMP COM_CONNECT_OUT COM_REGISTER_SLAVE COM_STMT_PREPARE COM_STMT_EXECUTE COM_STMT_SEND_LONG_DATA COM_STMT_CLOSE COM_STMT_RESET COM_SET_OPTION COM_STMT_FETCH COM_DAEMON COM_ENDVioC st_vio st_netlvio#buffh#buff_endh#write_posh# read_posh#fd#remain_in_buf##buf_length# where_b#$max_packet#(max_packet_size#,pkt_nr#0compress_pkt_nr#4#8#<retry_count#@fcntla#Dreturn_status#Hreading_or_writingn#Lsave_char#Munused0 #Nunused #O= #Punused1 #Qquery_cache_queryh#TF#Xerrorn#\unused2 #]return_errno #^j#_u#'#8NETL Renum_field_types MYSQL_TYPE_DECIMAL MYSQL_TYPE_TINY MYSQL_TYPE_SHORT MYSQL_TYPE_LONG MYSQL_TYPE_FLOAT MYSQL_TYPE_DOUBLE MYSQL_TYPE_NULL MYSQL_TYPE_TIMESTAMP MYSQL_TYPE_LONGLONG MYSQL_TYPE_INT24 MYSQL_TYPE_DATE MYSQL_TYPE_TIME MYSQL_TYPE_DATETIME MYSQL_TYPE_YEAR MYSQL_TYPE_NEWDATE MYSQL_TYPE_VARCHAR MYSQL_TYPE_BIT MYSQL_TYPE_NEWDECIMAL MYSQL_TYPE_ENUM MYSQL_TYPE_SET MYSQL_TYPE_TINY_BLOB MYSQL_TYPE_MEDIUM_BLOB MYSQL_TYPE_LONG_BLOB MYSQL_TYPE_BLOB MYSQL_TYPE_VAR_STRING MYSQL_TYPE_STRING MYSQL_TYPE_GEOMETRYdouble st_list prev #next #data# hLIST h ^st_mysql_fieldT_name`#org_namea#tableb#org_tablec# dbd#cataloge#deff#g#max_lengthh# name_lengthi#$org_name_lengthj#(table_lengthk#,org_table_lengthl#0db_lengthm#4catalog_lengthn#8def_lengtho#<flagsp#@decimalsq#Dcharsetnrr#Htypes #L't#PMYSQL_FIELDu MYSQL_ROWw \my_ulonglong st_used_mem next #left#size# USED_MEM st_mem_root #free$ #used% #pre_alloc& #min_malloc(# block_size)#block_num*#first_block_usage/#error_handler1 #  MEM_ROOT2   st_mysql_rows next #data q## MYSQL_ROWS   embedded_query_result st_mysql_data8data +#embedded_info #alloc #rows #(#0'#4 1MYSQL_DATA I 0mysql_option MYSQL_OPT_CONNECT_TIMEOUT MYSQL_OPT_COMPRESS MYSQL_OPT_NAMED_PIPE MYSQL_INIT_COMMAND MYSQL_READ_DEFAULT_FILE MYSQL_READ_DEFAULT_GROUP MYSQL_SET_CHARSET_DIR MYSQL_SET_CHARSET_NAME MYSQL_OPT_LOCAL_INFILE MYSQL_OPT_PROTOCOL MYSQL_SHARED_MEMORY_BASE_NAME MYSQL_OPT_READ_TIMEOUT MYSQL_OPT_WRITE_TIMEOUT MYSQL_OPT_USE_RESULT MYSQL_OPT_USE_REMOTE_CONNECTION MYSQL_OPT_USE_EMBEDDED_CONNECTION MYSQL_OPT_GUESS_CONNECTION MYSQL_SET_CLIENT_IP MYSQL_SECURE_AUTH MYSQL_REPORT_DATA_TRUNCATION MYSQL_OPT_RECONNECT MYSQL_OPT_SSL_VERIFY_SERVER_CERT st_mysql_optionsconnect_timeout###port# protocol#Q#host#user#password# 1#$db#(init_commands#,my_cnf_file#0my_cnf_group#4charset_dir#8charset_name#<ssl_key#@ssl_cert#Dssl_ca#Hssl_capath#Lssl_cipher#Pshared_memory_base_name#Tmax_allowed_packet#Xuse_ssl #\= #]named_pipe #^rpl_probe #_rpl_parse #`no_master_reads #aseparate_thread #bmethods_to_use #dclient_ip#hsecure_auth #lreport_data_truncation #mlocal_infile_init#plocal_infile_read#tlocal_infile_end #xlocal_infile_error#|local_infile_userdata#'# st_dynamic_arraya a  rmysql_status MYSQL_STATUS_READY MYSQL_STATUS_GET_RESULT MYSQL_STATUS_USE_RESULTst_mysqlnet#connector_fdh#host#user#passwd#1#server_version#host_info#info#db#charset# # #~ # #extra_info #thread_id#packet_length#port#Q#server_capabilities#protocol_version###server_language#warning_count#options0#status#free_me #reconnect #scramble#rpl_pivot# #master(#next_slave(#last_used_slave*#last_used_con,#stmts.$#methods/#thd0#unbuffered_fetch_owner5#info_buffer7#'8# charset_info_st ^r st_mysql_methods@read_query_result S#advanced_command #read_rows #use_result # fetch_lengths #flush_use_result!#list_fields!#read_prepare_result!8#stmt_execute!N# read_binary_rows!N#$unbuffered_fetch!i#(free_embedded_thd!#,read_statistics !#0next_result S#4read_change_user_result !#8read_rows_from_cursor !N#<* MYSQL9r1st_mysql_resX<row_count= #>#data?1# @ +#lengthsA b#handleB7#methodsC#rowD q# current_rowE q#$F #(G#Hcurrent_fieldG#LeofH #PJ #Q'K#T MYSQL_RESLenum_mysql_stmt_stateI MYSQL_STMT_INIT_DONE MYSQL_STMT_PREPARE_DONE MYSQL_STMT_EXECUTE_DONE MYSQL_STMT_FETCH_DONEst_mysql_bind@ b#is_null#buffer#error# row_ptrh#store_param_func#fetch_result#skip_result#buffer_length# offset#$length_value#(param_number#,pack_length#0buffer_type #4error_value #8is_unsigned #9long_data_used #:is_null_value #;'#<hMYSQL_BIND st_mysql_stmtmem_root #list # mysql7#,params #0bind #4#8result #@ +#xread_row_func *#|~ # #stmt_id#flags#prefetch_rows##F#param_count##stateO#j#u#send_types_to_server #bind_param_done #bind_result_donen# #update_max_length #'# $a $ MYSQL_STMT S 7 C  7+     n 0 Y 17   7=   b q !7 !7! !8 7 !#!Na !>!ia7 \!T! 7!o!a7 !!-state(a#cid)!#mysql*#res+ #! X_CURSOR-!"rNEW_cursorancidh iad!"XRa"#$Ra"%#X_noselect_sqlanqueryhnumbaival#j&chp!"Ra"'"#x|(#/])#@(#/]_*#:FREE_cursora+ia,#X_finishan ia`!#wRa")#4p-#/,$X_databaseNandbnameMhuserMipasswdMj&chpO!#Ra".$8/.$<Hd/.$^t/.$|0atoina")#$l-#/1%X_select_sqlan2cmdah2cidi2queryj2hpk2numb%l2val#m3row qb3iai4lena4chp!%PRa"'%x%(-%#(5%`'%%`-%#`5%`)#(#/]a6%FIND_cursora7cid&ia1&sql_errorlahn2buffkh8Tracesa8X_INSERT_ID89X_rowcounta T&i! x_CUR0&Y X DBhost@ @ DBname@ D User@ H Passwd@ L DBsocket@ P DBportAa  cursorBa  hGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libpost.c/SOFT/WebX/POST/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned charlong long intlong int 'name%#val&#charentry' POST_parserfh n enth xfb mf clfl nof chpZqstrcmp fatoi+fX_trace,f`strchr fe__iobPOST_errmsg )Tracef GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libEpost.c/SOFT/WebX/POST/src__FILEtg__FILE_cnt#g#_ptr$n#_base&n#_flag't# _file(t# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # inttunsigned charlong long intFILEJflong int 'name%#val&#charentry' <CheckEnctypeMethod%g Ln strcmp g < <B  GetMethod.gLnmethod/` strcmp g < <E_POST_parser8gnent7hbuff9{fname9zname9XSEP9`sep9.xfp:?`fp_buff:?jfp_input:?ai;g]n;gmsize;gQSEP_SIZE;gTMPDIR<iX_trace>ggetenv?ggetlinePgstrlen  <getpidUgunlinkWg8strcpy   <]memcmp g E E LdpXmemcmp g E E  memcpy   E  memcpy   E .?+Kstrip_nameg namechpstrrchr  < g strcpy   <!f"__iob"POST_errmsg"TracegBGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libget.c/SOFT/WebX/POST/srcintunsigned charunsigned intlong long intlong int'name%#val&#charentry'qGET_pathdnentqanamei id` pathb Tgetenvd strcmp d w w}GET_parser2dnent1qhname1i i3db x3dccl4dno4d query5a path5` chp5X3strcmp d w w Igetenvd pqstrlen | w strchr  w d(¼malloc  | strncpy  w |POST_errmsg^ s(GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)util.c/SOFT/WebX/POST/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned charlong long intFILEJblong int BmakewordB(n lineBa stopHi xc` wordB mallocPstrncpyBBRHcharXH fmakeword)B(Ĝn fp(h stop(Hi cl(j ll*cb out*cc word+Bh buff+%| mallocPmemcpyPP=c6H6SCpx2cHHwhatGB digitIHDĜ^VXb]unescape_urlTŴn urlSBh xUc_ yUckD04jDňbmQescape_urleŴ`n urldBh valuedBi xfc` yfcaplustospace{`^ strzBX x|c] rindcn sB` cHi xchstrlenR +getlinecn sBh nci fpj ic`YindcsBcH xc+^=\FYOXescape_shell_cmdn cmdBh xcZ yc\ lcX strlenR+HȌlYsHȌO\GETenvB(n nameBh vBX getenvc!"K@(GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)dim_PATT.c/SOFT/WebX/PATT&long intunsigned charcharshort intintlong long intshort unsigned int&long long unsigned intlong unsigned intlong doubleq )PATT_NEXT *q#PATT_OR +q#ch0 ,u#ch1 -u# PATT_OP .#  0 dim_FREEpatt  3  free w (Xnh dim_LOADpattX̴nbufh3w`;bOR_patt`ialenStopdop_TESTeop_SIDEfmalloc̨̀`u#dim_ORpatt̴ n3hchu vp_SYMcmp2 dim_EXEpatt @n3Xbufii`lenStop;h#0@GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)dim_CMP.c/SOFT/WebX/PATTElong intunsigned charcharshort intintlong long intshort unsigned intElong long unsigned intlong unsigned intlong doublevp_SYMcmp@ns1`s2injAlpha#ASCII* Init+ i0\j0m0Xt t a$m0`GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintRlong intunsigned charlong long intRcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charSItypeIDItypeMfloatdoubleDWstruct%high%#low%#2s0ll1 DWunion2 __muldi3`0n uhi vjk uu vv whi __w`a%; 0GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccint_long intunsigned charlong long int_charshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charSItypeIUSItypeJDItypeMfloatdoubleword_typezDWstruct%high%#low%#42s0ll1 DWunion2 __ashldi3m0n ullm bl_ uuq bmrQ ws4jk0 carries|Q4&  GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintllong intunsigned charlong long intlcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charSItypeIDItypeMfloatdoubleword_typezDWstruct%high%#low%#%2s0ll1 DWunion2 __cmpdi2*^ a)XY b)Z[ au+ bu, %& 4GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintylong intunsigned charlong long intycharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charDItypeMfloatDFtypeZdouble__floatdidf 4nuhid  !'-@4GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charDItypeMSFtypeYfloatDFtypeZdouble__floatdisf<@nuhif6 !'$@GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeNGfloatdoubleword_typez3DWstruct%high%#low%#R2s0ll1 DWunion23 __divdi3Hn uhi vjk cb uuRhi vvRjk w\] ipaHXY h`]*Z5[@]J_U\]per[\[__udivmoddi4ndrpnnddrrRd0d1n0n1n2q0q1bbmww__xr__am1m0R__clz_tab*(:GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeNGfloatdoubleword_typez3DWstruct%high%#low%#R2s0ll1 DWunion23 __moddi3n uhi vjk ce uuRhi vvRjk wh }(dhbcXak `]"\-]8_BYMx\[]j[__udivmoddi4ndrpnnddrrRd0d1n0n1n2q0q1bbmwww__xr__am1m0R__clz_tab*x*R dGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeNGfloatdouble"DWstruct%high%#low%#A2s0ll1 DWunion2" G__udivdi3" dn n!hi d!jk G b lvaXYh`]\]]_hi.![ X/[:ZG__udivmoddi4ndrpGnnMddMrrAd0d1n0n1n2q0q1bbmwwM.__xr__am1m0A]]__clz_tab*vR+N$ dGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeNGfloatdouble"DWstruct%high%#low%#A2s0ll1 DWunion2" P__umoddi3 l$n uhi vjk wh P |$kuc$deXab`]\]_Y <08\C[H*[P__udivmoddi4ndrpPnnVddVrrAd0d1n0n1n2q0q1bbmwwV7__xr__am1m0Aff__clz_tab*[,!C$$GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/libgcc2.c/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3-sparc-build/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublesigned charUQItypeDfloatdouble__clz_tabW0 ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hWebX.cdata.hHLPX\`ddlpx #q#q$,DP\ \hmp!x~}}}   (00D%DoL%X\`dx-g+iEOEKIG7 (044<"HHPt\d|mg7ab) !$3,0<HpP\\dp|DO?PDPN ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_ACT.c+( ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_ENV.c(:,tH(`tt     8 <DLdltxme&n%oD$DpLx#xq=%(4<iL)T\ ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_MSG.c\.`h| a,4/4<DtPPXhpxr ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRACE.c,DEHPdpxx70@bPhi$@TX`x0_HXhpV $$H\`dh| $_,Llt ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRANS.c (,08HHP\ht DHTT\xx  4K8LO`"`rhHpZ   j, 050_85DDLbTTpxuu]4@@\hhp,YOV0\\d )k)"r]E   j <<Dlp 5_5b2buur ((4<<DPh|zuuy,048@`l~   $(@HLPT`Vdpx (4X\dkppx|/Y  $HLPTdX=XWd^h lmp|$Va Y]~ $$~,44< HTX`x|$_ ~  $,4@ Hm`l5p~~~$p0#@H TXh!l~|~o$((4DPT`dlu$$, @TT\puD `p$mu0 4@LLhlltqe  e((e8@ |u  p8~8@~PeXd~lett $(8<H\`h| $(,8@@HXlx|m'n  $(,048<DDXp'y,, 4H$HpP$ddl    #q#.f.2b(DHhh ptx| ~0{8@T}`h2pŒ˜¨¼o}  (0|48<H\d}lptÀiôü}i  <DT``hxĀĜĬĸi\A i@LiT\xŀŔ1ŔcŜŸż ,4<HPX\dxƀAƈƐƔƜƬƸzƸm,'<n@DHL\`dhlptxǀǀǔǬzi   (( 0D DtL ` `th$8DLXdlKxɈɘɬɴ|ɼ~$~,}8@^HLP\lxxʀ|ʈʤʰ|ʸ1;Y  ,H$\\hhptxˀ˄ˈˌːː˘ˬ˸˸}L~ ~,4D"T}h5h_p̸̰̼g  d8Lhp͔̀͌͌ͤͬͼ}K%oΌΨΰδμ];Y``όϘϜϠϨϰϴϸk~ m &(j0~@LK\dghhЄЌЌdФ| ||$g@HP`t'tmшќќ ѤѬѰ$p$,, 4DD L`` h| |t҄ Ҙ ҘtҠ ҴҴ Ҽ!s,@@ H\\ dxx ӀӔ'ӔmӜӠjӤӨjӬӰjӴӸj$a8'8m@DjHLjPTjX\jdlxԈԘ~ȹiS, LjX\\~d hllktxxՐՠըkլլk@|  L \x֔s֤|< PX]`.llt|sלל״׸׸F $8@@X؄,،bؘؘذذظؼ)mm08P{`{lxxـِٜg13a  (HPPXX`h ڀ!ڄڌڐڠڬڰڰd0mej  ,,u4Ppۀیې۔۔ۜۤ۰۰۸pu uhdNlnltn܈ܔܔܜ,h, un(4Thtݐݤ ,o,4@\opx!ޤ ޴޼n$E0DPl߀ߜߨ߬߼ ,8D\`dho"2E\$1Pf`hS|| ooHn $$,4&HPTdbhlpo:o$N ,@Lh| ,04Xdb(o)(4Thto(,,~4 8<<qD\\ dS$s,4(HHP`$l|s!sq$0Pdp(( 0P\`dV$s$)k 4%@Prddl| 4Hdpt  @lx&J  .,8"8r@`x\*8Lhtxg$, X hp"x|@,8<LXtg  ,4"<@DXd 0<@P\x ^(<oLT1lx$04DPTdp ^$(Po`h1}$@Hu\dt|`((0LXdl t|z,<Lh|t~~ |! s!s (,,4<@DLP PXX`hh p%x|T|X @Hp2x{<Hd V,8<DHLPTT`!`shttu|j08HXfdtt|Y$(( 0TX\hlltd^ m$Va $|44<@H2TY\l|g$,4 <DL\ihxx (~4Tp p, #44<@DPX}\`}lpp~x |{DPDJ~ t t t  t< <tX Xtt tt t $) }  ~( ,DX dblt}~  4HHPTXdx}~ t008<@LT|X\|hll~t x%o||~  ~ |,00~8 <@@~HTd~||~ ~$,,n@|@HL|X\\~d h~~~~~     $ (| 8 < <~ D  H ` |~   ~ 4     ( , D X d l     q     Y    , 8 < T h t |     q     | $ 8 < @ D L ` l t         Y    4 H T p        e((<`x d@Xddld<T``hb(4Pd  ((HbTddx  (0@Pf\ll  (0@P~\ll ~~    (<,<hDXXhfp$yw(r,,@qHD`4tt |'decq 44D!LFT\\dxx 7 4%4o<DTT\pXf.f%U+  4&<LLTddpxL< (0M@@P``p 0<P\lly (0y@LXhppxRGQC|| 44<HLL|Xj\\{||Y;$ @H dlZ:X<W=^6] 7 \ <8 D[ `9 hP D Q C         t  !!!!0!<!X!d!d!!!t!`!B!`!4!O"E"$N"DF"La"l3"tj"*"V">"U"?"u## f#(.#0t#L #T#l#l#t########{#$ $ $$($4$P$t$|{$`$0$M$G$L$H$%%%%%4%@%@%\%|%X%%%%%%&&&&,&L&pu&x&&&&&&&&&''' '4+'<~'T'T'\'p'|'''''(( ~($($(,(@(L(h(t(t(((g(((())$)0)0)L)h)B))~))))))**$*D*L*h!*p **k**x**q**z**\++6+,+4 +L+X+X+t+|+|+++++t++++,,],,,4[,H- - - - -$-,-<-X-X -`-&-n-------------- ---.... 3. a..(.( .0.<.H.L.\.`.d.h.p.t.|..........// /u/~/  /$s/0/4/4~/< /@ /T/T/|/|////c//c/////n00000080`0h0h0p 0t0tn0|0000n00000000n00u01u11,141@n1H1`1hU1|C11o11112E22u2 ~2$ 2(s2428 28t2@2\ 2h2pP2xe22u2 2i22o3333343<3Do3L3To3l3t33|3333r3334(4(404X4`4`4h 4l 4lr4t 44r4 444444445r5 55r5 585<u5<5Xu5\ 5\r5h 555555r5 5r5 5r5 666$ 6$686L6X6`6h6p6t6x6|666666666666666777 77 u7$#747<7@7@7H7To7X 7Xu7` 7d7h7pu7p 7x7:7Z77777777'8888 88(e80380a888H8X8X8`8p8888888888888e8/9e9 9 939$9("9(r909@u9D 9T9X9\9\9d9l$9t9| 9u9 99999999999:: : :(::4:<^:P:XV:`:h_:t-:tg:-:N::::::::::;;;$;@;X;`;p;;;;;;;;;;;;;;;;;;;<<<<<,<@>>$>D^>X>`>h>l>l>t>>>>>>>>>=??$N?,?4(?Pi???j???j?@@s@ @,@0@4@8@Hp@L@Pp@\@@@ @@@@@@@@AA$%A$oA,A4rAD A`AhrAp A|AAAAAAAAAAABBB$uB4BDiBPB`B`BtBBBBBBBBB BCCCCCCsC$ C8C@ CPsCXChCpC}CC CCCCCCCDDD,DDDTDXD\D`D`Dh#DpDtDxD.DfDDDDDDDD DDDDDEEEEE,nE0%E0E@nETE\E`E`Eh*EtEtEEEDEEUEE#EEEEEFF F}F F4yF<F@FDFHFLyFPFPyFXF\F\FlFlF|F|FFFFFFFFFFFFFF F FF F"FFFFFFG jG G,yG<GHG\yGdGhGlGpGtyGxGxyGGGGGGGGGGGGGGGGG GHHHH(H(H<mHP HdyHlHtHGHHHHHHHHHHHHHsIIZI I@ITIXIXI`I|IIIIIIIIIJJJJ4qJ@*JHgJ\Jd'JtJJJJJJJJJJJ_JJK KK(~K4K@KLKTKdKhKpKxK|KKKKKKK4K`KKKLLLLLLPL`vL LLLLLL L#LLLLMMMM$fM(/M,eM0/M4eM\4M`MdMhMlMpMtMxMxM$MvM MMMMNN NNN N N@NTtN\NhNpN|N NNHNcNNNNNNNfN.OOO OOOOO O$O(O(O0ODOPOPOhOOOOOOOOOOOOPPP P,P@ PDPPPdPhPhPpPPPPPPPpQ QQQQQ QPQPQXQhQlQ)QkQQQQQQQQQRR0R@ RDR\R\RdRhRhRpsRxMRRR#R5R_R5RR SSS$SD SHS`S`ShSlSlS|sSSS$SSSSSTTT T4lT@TTTXTdTxT|T|TTTTTTTTTUUU U$U$U<UXU`U`UhUUUUUUUUUUUUUUUXUVV(V "V$V(V,V0V4V8VHVLVTbVhVxV%VV@VVVVVVVVWWW(WDWHWLWPWTW\W`WdWlWpWxW|WoWWWWWWWWW WX XX XX X8X8XPXdXhXhXpXXXXXXXXXXXXXYYY$"YPYPYX$Y$YpYYYYYZ Z Z8Z< Z@ZHZLZLZhZpZZZZZGZ~ZZ~[[*[ [@[`[l[t[ [@[%[o[[[[\\\w\(\,\,~\4 \8\@\@\h\lQ\lC\|Q\|C\M\~\\\\\]]] ] 0]`s]p]]]]]]] ] ]s] ]^^^^$^@r^@ ^H^`^`^h^|^|^^^^r^^^^^^u^_ u_ _,_,_4_4_L_Tr_T _h___r_ _r_ ____`` ` ```(`0`<`DF`T`X`X`|`b`0`d``1`c`o```aa,5a,_a4aLalaxxaaaxa aaaaaaaaaaaahab yb0b-  (88@DD\`hhp     !  $<R,04@HNM! (0XpO  $Ppp$O   $$4@DHHPPX\`dhpx5  44PPXll!X2[$1,,8Z@L7X\lt$"u$44PPXt-d,,4HHddq't#q  ((0DP``||44<PPll'c,c$+,p<<Ddtt  $@X  /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysiso/time_iso.hmachtypes.hint_types.htypes.htime_impl.htime.hselect.htime.hFMdate.cX \h!7a}}&n (,08PXX`dhl|m}#h"}4'4m<DHLTddpxxl}} (8~PPp'pmxl~~( 0BHHhh(l 048k<<~DL~d lC'm,04l88~@H~` h' #)k (,08PXX`hV|~~TE  ,*,j4<@DLdllt|)k (,08PXX`l |$'m U  4<DLT\dpxu(  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_AVL.c(S,44<HX9X[`hhp0t6E$pY;N  $(,04<<PPX\Zdillt/xW8l$p^ h$08HPXX`ltrx|<6 qs`4>V 4688@8H`X`ltxx~~  {(4<<DL\ht&~~$~(,048s<@DHLP$T\\ppx|~h:h  9$,~00 8LTgX\`dhlptx4 $$ ,4<P TX\dhhpax|2a $@_DXA\\dalltt|!.Z<ar/  $8T~Xddlptt|a~ a. ~ r  4@HP~PXl{ ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TOOLS.c, , D4HPTdpjp*j, ,!<PT\d ll j DX<q,88@P'`` hlktx'Jj*,j| |t,! a 4 4tD3LL d9xHt t ../WebX/include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hX_heap.c6   4s@HT\h!lx|BR)k  kg h$$g,48<@DLPPXhp5||D t$,dLAXd6htt|q74@Xhlt||  * ../WebX/include/apps/mysql5/include/mysql/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hmysql.hmysql_com.hmysql_time.hmy_list.hmy_alloc.htypelib.hlibmySQL.c <_uEo(ll txT5((8\\ dxb|cckuh,48@dhlt|V  $,,488@PT\dhpxp$ 8d!s!s!-g*$0X`d~lKx"3cNFY1c1@$(4]d $0tL.\ `d| kY,,<``hDPJ,@ * j`$J, 44 HPJXJXJJBRBP $4Th^ ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibpost.ch-l (0<<LTT\`udlu#q  s C ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibEpost.c 8$<LP\`dlpt|!s $( (0P`ly 008<<@lpxx(04HHuPTX\`ddlt<X,8@ PXHXLHp$4<pHXXlO!((044<PX`p!] 08#HXl- ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibget.c, $ <<DP*PjX,p u#S (88 @TT\ddl€„Œ”œ¤¨°q´@ /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hutil.c.(P\dhlptx||ÈÐÐèè ðs  $8u@@LTX \htĜĜĴĸ(0o4%<o<%Dr`ň#ŌlŐ#ŨŴŸ ("0t4< DDL T"``xƈƔƔƤ @@LLTXdttLjǰǴǼ (HrdlltȄȄȌ"ȤoȬ) #(u- /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_PATT.c(,8@HX~\dhlptt|ɠɴɸ~~FN>  $(:(Z0:8%LPTX\`dtxFxNʀʈʈʐʘʠnʨʨʰʸʸ8@'TX\`hlptˀ˔˘˜ˠ˨%˼k)N $(,4<QPTX\dhlpx6̀̄̈̈j̴̨̘̠̐y̼+ ]$(04mHPPX\%hu͔͔͜͠Ͱ $04@HL)LkT)\ptxx΀c΄Ό*ΌjΔΘΘΰθ   (,,4u@ /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_CMP.c@2D'PmP'X`lϜϰ include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c`d$0r include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c048@DDLPTXX `dhtux|@ include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.cP include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c (4 include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c< @LuXd"hlpt"x|s!s   4@ include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.hHX\\dhhp~tx|r!s*j* 'hl4l`t5~dl&x7<G include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h  (~,0r488@D!DsL('m Ј0444`<P PtXdhllt9|~|DLTdt:x|  include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h}}r $$,0!0s8<@'4` 5(~(0<@D@7  $ $ ( ( P T X" d include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h l |~ r      ! s  ( !!!!!'!m! !(!l!p4!p`!x! !t!!!!!!9!~!!!!!",""{":""""""###### ####$$ $ include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c$ | HD -  L -  - H -  |   | ( -  -  | \< -  | $ - $D - $Tl -  |  - tD - D - H - D - 4 -  -  - `X -  - l - t - l - h\ -  0\ - P -  - 0` -  - $X - |x - x -  l x4 -  -  P` - ( -  - ( - ( - $ -  -  -  - X - l - ( -  -  -  -  - X$ - | - \ - ( -   -   -   -   -   -  -  - d - H - P - P - X - P - @ - - - 3t - 6 - : - ; - X_error>X_letCdX_addDJX_setEX_shellFX_sqlnamesGX_chdirHX_usleepIX_sleepJ,X_sqltrapKKX_htmlLX_compileLrX_optionNpX_trans_printfileNX_includeOmX_commandVX_printfileY`X_notfoundZYX_call\X_signal]^X_error_cid]X_get_cid`xX_sqlexecaYX_functionbX_while_valuescX_while_wordselX_while_loopeX_whilegX_foundiX_sqlkX_xFilemX_FilenBX_ifsX_stdoutR9X_default_names )X_check_name yX_values X_set_cookiesXXyyerrorgyyparseEXPR_parseryycharyylvalyynerrs?bX_exec_callstrcut]chcharStrLen =X_get_int#X_check_floatzX_check_date"X_check_intjX_todayX_CMPexecX_CMPpattX_user_cmpEX_user_icmpX_user_fcmp8 X_date_info uX_dt2str X_str2dt; oAVL_searchAVL_removeAVL_insertFԆsX_take_stringX_arg_string2X_arg_string_sepPX_heap_newUX_heap_allocX_heap_free)X_heap_reducekܜ' "rX_noselect_sql#:X_finish#X_database$X_select_sql%sql_error&@X_rowcount. POST_parserPOST_errmsgECheckEnctypeMethodGGetMethodE_POST_parser* GET_pathGET_parserbmakeword]fmakewordpx2cunescape_urlescape_urlQplustospacerindgetlineYindescape_shell_cmdGETenvOdim_FREEpattdim_LOADpattdim_ORpatt#dim_EXEpatt vp_SYMcmp[$__muldi3 D__ashldi3 5__cmpdi2#s __floatdidf%|__floatdisf'b__divdi3,`b__moddi31%|Q__udivdi35Q__umoddi3:&__clz_tabH=(4\<g($_49d p |p @X ( hԆ,ܜ h ` Dd(@[` 0\ 8#sp%|4 '@,`1%l5 dT4x4Plx(4 h $@(<lP00L<8 0 l l4TXL"l"!!x)*<$P$`x**<$P$`($(8081P'H(p(8181P( (,$0   <  $`$t!!$t$!!$t$!"l$$""l$$""%%""%%#$(p('',%&$H$P//X.8.$%()%X%)X)()T%X%)d)((&8'((+++,4,T,d..,,,,---..8.//X/081P1x2 2055`3P4303@2H33`3505D6D667<88:4:t89,:t;89:$:::;8>X>x?@$PPRRV$WHWdWV<VWdWVVWW4VVWW$Z$Z,bb$` `lZ|Z]L]tZZZZ]L]tZZZZZZZZ__^x^ZZ\,\^ ^4\L\l^ ^4\\^4^\\]L\]^4^\]^ __]]__^^__^^^^^^__`a$_(_,aa$_0_L_(_,_0_<_`_|`a``bb$``4````$``a$aHahaaapq,spt0rrr,rPvw$w@xy<ty<y{|4|4| }~Xt~XXt|L<XL<Xt <T`hXdd\`h`dd\`ht`ddp0tt@``p(@,4H0< $<xdt<Lt (<X<L<L,dt|$8D L`dX\HLDpthlX0XXlx|HT<LT`XxLp T,0D@0D<DX0dx X P p X h X  4 0 pp (,8`(4@\Ll000L D(tLpl|<p|L |( (| HP|pxTd0p $<p $ $ H d ` T d `  ( 0 ` \$ @\`Pdt$`hdXT|dX 8px$(080<H,@(HX08l\<|8l| (d$ 4$4X_add_valueERRMSGX_headerunsigned intunsigned intunsigned intunsigned intPrintTMunsigned intgetpidX_notfoundX_io_popenX_heap_reducenextX_cookieX_debugX_io_fgetsX_io_pcloseX_io_fputsfoundX_io_vfputsignoreX_select_sqlX_transvaluevaluebuffoffsetERRMSGdate_MONTHcompileX_sqlexecX_callX_io_fopentransvalueX_returnstatusX_unlinkX_free_allX_functionX_io_fseeksizeX_arg_string_sepX_arg_stringX_free_cidsql_errorX_heap_freeX_io_fcloseX_translinedate_YEARnameunsigned intX_user_cmpX_includeX_replaceX_traceX_while_loopX_while_wordsdate_DAYX_exitX_while_valuesX_printfileX_tracefnameX_arg_stringX_check_nameescape_urlunsigned intX_default_namesERRMSGX_debugX_put_valueyynewbytesunsigned intyyerrorX_traceX_arg_stringunsigned intX_get_valueX_CMPexecdim_EXEpattunsigned intERRMSGX_tracesprintfsscanfstrcpystrncmpdatebuffformatdatestrmodeunsigned intright_subtreeX_traceleft_subtreeunsigned intunsigned intX_traceunsigned intERRMSGmallocread_timeoutinsert_idfieldsX_traceextensionunix_socketcompresslast_errnoclient_flagunsigned intlast_errorsqlstateaffected_rowsdata_cursorlengthfield_countfield_allocunbuffered_fetch_cancelledmallocwrite_timeoutserver_statusunsigned intunsigned intunsigned intPATT_LISTunsigned intpatterncurr_pattunsigned intunsigned intunsigned intunsigned intunsigned intunsigned intunsigned intunsigned intunsigned intunsigned intunsigned int.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab , < "[4[43o44-B$  7B$ AB<<H KQ$|$|W$$]$$u200<Fll| ent nn{ nn nn oo oo< ooXo] ̀KW$=-[kZ< j#* ʔx    ` % /07070100007768000081ed0000000000000000000000014b9fcb400005d908000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/WebX.pgSQLELFM(4Ӑ4 (#"440000DXX/usr/lib/ld.so.1   !"#$%'(*+,/01234569:<>?@BDEFGJKMPQUVWY[\]^`bcghjklmopvwxyz|   "#'()*+-.012345678=@BDEFHKLMOPRSUVXY[]^_`bcefgjklopqtvxy{|}~ &)-.78;=ACHILNORSTXZ_adefinqrstu{}~   !$%&,/9:;<>?ACGIJNQTWZ\adhimnrsuwza@Q4    | $( 38; F/< YLh `1 oP{wt ,  V 5 Hh LPlH '  d Ӭ?\ ( c@ X a@!_D V8 0+<d 6t;  G\ QX [m g\< ovP |وD Ϙ x@ Ԝ2T S| L`  @L .|@ <, xoH "֔,X$ 4Ұ;pC< WҌ^ kV\ r x_` tt W Ռz 1 İ Xx` (Z y   ; !M(t (9Xh 4L @ P@Zz@T ^pg# w4~  .T( 0` N\   Ҙtհ  $kT &0$ #=TC684 UX< ` eO( tՀ{Ԅ{x( LL ӸxH H  \  ь 4X 0 %2 84, ?Rt JHb(8f7$ tyP@  ͼ ЈH ΰP  d d !T D( 7 $$( -p <0 CָKD U1@ dM,< { s dH Ljd  4 ( 8 W \L0 ,  |(  3 _p!8 Au  L[T ^ hXo1 yOd, ƌ ¼ $`  ҜX դtx ` 9h  t x \| )bP 20 FXl qp` OȜP `b sԨyp OH |StX  %T$ S M4  T P  1TL *i0l l8 8Nd Aݜ  PO0 YX< a1  o8 ( H 'x Yy8P _ |4 8 Zl 0   ֬ XL l {0  wd *L 6Bd D, Nt U \R@t g o0 {2( < B| i$ m, O< ʬh  $ s4 e@| 3 l @ PH X   *Ҁ 1 7 M  \8 l wX &  mh0 Ԑ ,l , m\  8 kt@ t  D è @ < S %h -(  =0 R@ gMh4 t0 l  t   k, $8 np Ӕ \ t (   r )< 3\$ :20` M@ ^T m:(\ w }D   ڸh   u<d ( \Dl " d TH H $8 Z !ND *Դ1$ ;Al O  e$, q+DL w 8t 6 DL  m \ NT H X X  Ҥ ){\ 6ռ@`  M.0 ] c lwP p` | 6h / 4h 4L $ Ci _H \@ H  0 L #` Ő x, *L\ <4G\\ U3 \ hֈpW  >hX lH b   ԜL .(   /( L   Pn &`0 /d ut 7  C1 W b +W< l՘ 4uҼ|Lp\ ՀL p t ` 1D 8L QTh PL $ dP< X * 7`  ODL A0 LÐ X _po {jt ,8P@ Z4 $ ňl L h֠  XsX 4( @Q1  Ld Ӡ!H n -p4bH<L O XAl dhlS($ w L   h wX s p H k 8   [\  HH  `0` $_\D .SL( 9<L @ߜ( ( PT e$ ql\ { L 0<0,  _ӈ  ; LP  4d , dP u4 ^d f L(\ 7d8 C2t O´( cJD __iobpg_strncasecmpPQdbX_valuesPQisthreadsafestrrchrX_io_fopenenlargePQExpBufferpqPutspqsecure_closePOST_errmsg_finipqWriteReadyAVL_searchStrLenPQgetlineX_HOMEmainyyparseX_noselect_sqlmallocX_user_icmpPQbackendPIDX_databasePQfreeNotifylowercasepg_freeaddrinfosigemptysetpqPutnchar_enddim_EXEpattPQntuplesPQprepareHTML_stringPQresetX_transvaluePQgetvaluePQfnPQparamtypeX_io_pclosepg_freeaddrinfo_allstrlcpypg_encoding_verifymbX_FileinitPQExpBuffer__ctypemktimepqSaveParameterStatusX_shmat__divdi3vsnprintfPQtracestrcatfopen64PQsetErrorVerbosityaccessX_printvalueX_exitX_setX_heap_newpqPacketSendpg_gai_strerror_Q_subescape_shell_cmdpqsecure_destroyX_chdirrecvplustospaceh_errnogetpidpg_fe_sendauthputenvX_forkX_errorX_CMPpattX_startX_check_intPQftablecolpqGetlineAsync2vsprintfrind_environpqGetlineAsync3X_BASEpqAddTupleX_callcreatePQExpBufferpqCatenateResultErrorpg_char_to_encname_structX_compileX_io_fputsgetcwdX_rowcountX_fflush_Q_qtosX_translinesrandGetMethodappendPQExpBufferStrX_shmdtpg_range_sockaddrAVL_insertatoipg_set_noblock_Q_mulatolGETenvmemmovePQregisterThreadLockX_heap_freepg_encname_tblX_sqlexecPQconndefaultsstrdupX_addPQgetCancelPQconnectPollPQbinaryTuplesPQescapeStringPQflushpg_getnameinfo_allchcharpg_tolowermemsetpqsecure_open_clientX_check_float.divpg_set_blockpqGetncharPQgetCopyDataPQresStatusPQgetlineAsync__deregister_frame_infopqCheckOutBufferSpacepqGetCopyData2pqGetCopyData3PQclientEncodingX_check_dateX_returnPQconnectStart_etextstrtoulPQfreemempqsecure_writepg_encoding_max_lengthatexitGET_parserPQnotifiesgetpwuidX_sqltrapPQmblenPQresetStartX_while_loopX_io_fcloseAVL_remove_Q_qtoiPQsocketsendpqPutMsgEndPQuserPQprotocolVersionPQmakeEmptyPGresultstatPQdsplenX_get_basepg_fe_getauthnamePQoptionsyycharPQinitSSLpg_char_to_encodingX_sleepstrchrX_shellpqSaveErrorResultX_optionX_trans_printfile_edata_Q_qtolldate_DAYPQparameterStatusX_todaypqsignaldate_MONTHX_arg_string_sepX_ERRMSGPQsetNoticeReceiverPQcancelPQdescribePortalX_heap_reduceX_io_popenpqGetcpg_encoding_to_charstat64pqGethostbynamePQoidValueX_set_cookiesX_actionpg_valid_server_encodingX_includeX_INSERT_IDsystemTMP_DIRpqGetsappendBinaryPQExpBufferX_clear_valueX_dt2strpg_wchar_tableX_avlcmpPrintTMpqsecure_readpqCheckInBufferSpaceconnectTraceyyerrorX_fgetsPQuntracePQerrorMessageX_trace__clz_tabgethostbynamestrspnPQsetdbLoginshmgetdim_FREEpatt_PROCEDURE_LINKAGE_TABLE_unescape_urlPQgetisnullpg_mule_mblenx_BUFFERS_Q_divPQportpg_toupperX_whileX_BASE_holdPQgetsslPQtransactionStatussql_errorX_str2dtPQputCopyDataX_get_cidX_cryptGetDDTX_select_sqlX_exec_callPQsetClientEncodingPQendcopyPQconninfoFreeX_sqlPQcmdTuplesstrcmp.umul__register_frame_infoX_while_valuespqFunctionCall2setsockoptPQsendPreparepqFunctionCall3X_usleepX_free_allX_io_fseekdim_ORpattfreadX_free_cidX_commandX_replacepg_md5_hashinet_ntoaisdigitX_sqlnamesgetsocknameX_eofX_envPQclearPQserverVersionPQsetNoticeProcessorPQresultErrorMessagepg_valid_client_encodingpqGetErrorNotice3X_add_valueX_printfilepqParseInput2pqParseInput3CheckEnctypeMethodpg_enc2name_tbl__muldi3strstrpqWaitTimedPQnfieldsX_ERRORX_unlinkGET_pathsigactionPQhostpg_getaddrinfo_allpqSetResultErrorPQconsumeInputX_CMPexecftellPQpasspg_encname_tbl_szPQsetnonblockingstrcpypollfmakewordpqGetline2pqGetline3PQcmdStatuspg_getaddrinfoX_while_wordsPQescapeByteaConnX_arg_stringfcntlX_headermemcmpPQputlinefgetcE_POST_parserpqBuildStartupPacket2PQputnbytespqBuildStartupPacket3_lib_versionX_notfoundpg_sockaddr_cidr_maskDebugPQfsizeX_get_valueX_date_infoPQsendQueryPreparedvfprintfX_debugPQrequestCancelstrlenPQsendQueryParamsdim_LOADpattlocaltimeX_heap_alloctermPQExpBufferX_letpqGetIntx2cX_default_namesPQoidStatusX_get_intprintfPQExpBuffer__dso_handlepqEndcopy2PQfformatpqEndcopy3PQescapeBytea.udivPQttyPQsendDescribePrepared_GLOBAL_OFFSET_TABLE_PQfmodmemcpypg_encoding_mblengetsockoptpqResultAllocstrcutPQsendQuerygeteuidpg_getnameinfopg_utf_mblenpqSaveMessageFieldpqPutMsgStartPQftabledestroyPQExpBufferPQstatus_Jv_RegisterClasses__flsbufresetPQExpBufferpg_mic_mblenX_found_Q_addX_putcharPQisBusystrncatpqReadReadypqsecure_initializepqReadDatavp_SYMcmp_Q_lltoqsscanfpg_encoding_dsplenPQftypeX_io_fgetspgresStatuspqGetHomeDirectoryappendPQExpBufferCharstrncpypqSetenvPollPQfnumbercallocX_clearX_finishX_stdoutPQescapeStringConnX_check_namePQnparamsX_functionPQgetResultX_htmlpg_g_threadlockX_io_vfputsX_put_valueX_PAGEX_fppg_strcasecmpX_take_stringPQresetPollPQexecParamsX_cookiereallocpqWait_DYNAMICstrtoldate_YEARPQfinishCookiePQexecPreparedstrncmpPQgetlengthfwriteyynerrsPQresultErrorFieldpqPutIntX_user_fcmp_Q_stoqpqStrerrorPQsendDescribePortalPQfreeCancelX_xFile_init__moddi3PQresultStatusgetenvPQfnamepg_md5_encryptpqResultStrdupX_ifPQencryptPasswordpqFlushyylvalappendPQExpBufferuppercasepqGetpwuidPQexecPQunescapeByteapqPrepareAsyncResultX_error_cidinet_atonpqInternalNoticeX_execalarmrandomX_user_cmp.remPQisnonblockingPQdescribePreparedPQputCopyEndpqPutcpqClearAsyncResultX_signalX_search_commandX_quitgettimeofdayPQenv2encodingPQconnectdbEXPR_parserpqHandleSendFailurepg_utf8_islegallibnsl.so.1SUNW_0.7libsocket.so.1SISCD_2.3libc.so.1SUNW_1.1/usr/sfw/libs =( zt =' FѸ"Ѽ/pTa ,8DP \ht`ҀҌ9Ҙ^Ҥ_Ұ6Ҽ\>J(G4@RLX[dp|ӈӔ.ӠӬӸq  j:$c0<0HTg`xlx2ԄmԐԜ)ԨԴKK ,8DP\htՀlՌ@՘դհaռbMu fI(4|@LXDdp7|ֈ֔4ָ֠֬o? $0<4Hs @D# @7ݐ#t@3@, @ p"@@(@)㿐#/`  @  `@@`" `@$@``c``@`  +㿐㿐/ͮȂc ` @ ``c `@㿐㿐9aT#`c @#aT@Ր 4b` (9@D S0$ $$ ($ $ $ $ $ @$ 9 a8` @ཐ  N`/@@൐ /,* @౐ݐ@ 0/@@࢐ /,+ @ @ ݒ?99+9 "D@C%aHS0$`$$`$`$`($` $`$`@$` 9! a8@#@#@F  aHi)ި  + -/ހ@"+`@L`-`@I ?9aT 퀤 #aTݐ@5c#@5aaH  @3@@4 aH9aT`7  +@m9aH`d0 \@ " 0@.0@+`0T@(`H0@(  @@@`@b @  : @ )'#aT#@%@aH@F) JJ@FC /@p-@ѐaH!J#ݐ @Hc耢 2% @Gc/@E`瀢 P@/0@P @ 9a,xc H@߽ [#9$aL8)aL @߶#ޒ`@ߵ 6 +9aX)+@߭  =(O8 #"+@ߦ% @ߌ@KtG` -@߅@ߗ@ߘ@{ +@߇  =ܐ@ߍ-@u 9ޢ"#aP@b J9@X+tGD#aPނ`%ޔ$aL@[@F "8ޖؔ $aL@N@9 "8ޘ` $aL@A@, "8'ޞȔ$aL@4@ u8%ޠp$aL ޒ!@$@1?c#9aH`2@Cu@)?ޠ@09!P@ @ aH` #@a@Ր@! 0@8#㿐!9!H'T'X'H'L'P`%;=aX`?? =;H#aX@bP!H-!9!("1;9a8 7D&!(@" ?0aX@̐!haX@7D'a8@޸!X 35ސ@ޙbP?;9!H@bP0a㿈 @=#=a\a`` a\#`$a` #=a`"+`$ . #+ @ , a`"   ޘ#@ޤb$a`$  #=al'X'H'L'P'T`@;9aD 2 #=!=!h Ym ah`W @~=a\`F9=!`#a\ `'!` !`" , #(`#* !`.@  " ޒb#@c'!`$ ah@^H;9aD 9099!Lޒb(@-@  @ 2,*@    'aD$al9='aD@" $!h@!9ޖ79"8P@3ސ@bH$ah@ah #9aL'H'L'P'T'Xϰ?9=!t`B;9aH`59Ű `7= p@=a\`;=p9=!`#a\ `'!` !`"+`$ (`#+  , !`@  ޔ" b#@ݐ'!`$ H@ap@ݚapH`3ހ`j99@ݑp0ޒbh@ݣaH @݋  198= #ap'aH1ޒ"x@ݏaLaH@v @ݘ ޒ9!P@|ސ@{b=59 ap&HaLb@oaH`@V  @x5ޖ19!P@]ޒ@\= !9"p$!H k'!t9=;9a89&p" @l f  5ޒ`(@^ap@#ap`(@Vap@ap`(`?@V ;ޒb@I0}bP  @IaptH㿐DK!$` )96( 9+!$`!$    @@W @"` 2`@>!,  @=! ?R 㿐*   @: . *  㿐*   @: . *  㿐6b   6b$` @ܧ㿐#9aH`#@  `$, @`&+ .:   @@4,aH`   aH#a`'9H`)@ܧ!P T@@|`@ܝ!P K%X@ܗ 2H`,  @   !+  @$ ,@ @`& +,;`  ,@H9 ҒX@n ːH`"  ;    5 H"耤 ;a,ဤ @` `` ` ` @ @" .@ @ ``@``   @ <@  @  @ " `@ .@ @ @  @ `.@ @ \H '`0Βސ!8[)7/ -/;H "       !+  @$ H * , 8`` &  H`, ǐ@Ӓ!P Q@ۧ`@Ȓ!P G+aX@ 2H`+  @  !+  @$ ,@ @ `& * ,8`  ,@H฀ ҒaX@ۙ H`"  h   c H`"뀤 a[値 `  Ѐ `  @ @2*Ж Ѐ`2 @/@,' ~π ? ~π`\"  @"]HEH ' H "u ao +~Ϛ +~!xښ 㿐 @6a ?9aH`! 9!D ̐ 0򀦠h0㿐@ѐ@ P 2 09aH`!  00@& @=& (@ڶ @> & @Ȓ& 6 $6 6 "㿐  @ڤ` @@ ` @&@㿐 1 T `%  " ,``,`2#`,  ,``,`2#`, @4 ?" $ ,㿐9aH`G9a ) T C   " ,``,`2#`,  ,``,`2#`,`&?%9``,@;8   @;m@= (@^`2` &"9@4D ?" $ ,㿐9aH`.9a @; 59T` ``24`"24` `(@=@ @=?$`$`@9!D4`$`272 )T`"@`+ "(9hW  ( 22` `"` @;J #9aD2 "x@ٶP?㿐9! @: 'R `2?R $`2   ` ( @`22@ن @<ݐ&@٘9D`  t " @<Ȓ &"㿐9! @:w "9  aH`b i 6`< ?+``` "D"㿐D` @5, `   06 `<"  㿐=ax`= !|/```';6`h` 5=|`h ``.`(``& #ax !|(``;>a/a.㿐6b`=x C!=!| *@a>1D `98`]@+0hD``9`` !9@?`N#@``2 `9!8`2``*K"`!8```!9!8`2@݂ !|+```# 6`h =|`h   ` `*` (``" !| #x*@21D>a(a+  a+ ``:9!8`a@㿐 -6 `@k`6@z`@4~.0|`.6"`2"N/D`98`@ؑ "]!9)6" /6$` ؀`@(` /D=|)>6  h+=!ax`  +```#6h`    ` `*` (``" %ax + @"-!`98`a@= N,wb!8 )6'㿈 @>>K! `   ""+!"+  @ +`& + `(`""`" p9aH`" @׮ ?,  0p9aHЀ`"@ח b  ?@ך @ף00p9aHЀ`"@y b  ?@| @ׅ00Dap@a G? @ת   +7 -D;   @@Rc*`O @׏ * :`@DJ@-M ` - ` 6"" @@*cڪ` ?ނb@'9H`c(@ 0@ c8@ !#@@7  )#H@0  ;cP@)  "c`@!  #p@  )#x@  @   -@  c;c@  H + @ɒ : <-@@֮ c`@֩ c -? :-@c-? @ְx@֬9? :-@w!?޴"'@ݐ.@5 ?ަb&@/?޺⤔@"#\7?5/a <,  @t H`1  @Ր@8aِH'ဦ`ؐ0[/?ϐH#?, %@@4?, ?@?!?,  L` V* @Q:`,@`L@  @? *  @?<!?- H`M` R (`     L  (`> ``7   K "+H`'%?Yh%?S t #?T+?, L  * @;`,@`L@  @?4@L@L  (`c@ݔ   @լ : ,@Ց c@Ռ c ;? :,;?b@@Փb@Տ9? :,[?ު"Ȓ'@4@p5?@-@F @Y@U B7? @՝@ ``/??2 '?/D5@   @@C??#M@ @Հ (`:`@DJ@,L , ` 6""P"M @F  _`А@?  j ؐ@8   @1  @*  + +; :@ %?ހ @ ?' @*@  '`@-@ O@:@ @ @)?ޠ"@?*@@!6$" J  ?8$" ?3$"c -?*@@ H`'@Ԛ , ?, yH)@Ԉ /?  %`@Ԉ@ԑ#-@? ,  VH7@e !?"1"`@e@nِ`@ԏ  b!?ޖ"N  ' ??   !?N :` +@N`'?@/?ހ4?#?b aN `:,,@ N #@@ ?ޞ@+??- @?aؔ%@d,0V"0d @(  ])N    p ? (@ Nf+`< `:  (@ @&?Y??ߠaM@ -@@ @H9 PɒM@`  (`` ˢ    L (`: ` ``  0-+@F @]!@Ɣ  ?% -`?`:@ %??ހb@ ' ,  ' *  L :@ @ @)?ސ"?ߦa +"J `'c7?O@ӣ@ӂ  +9?N "' `:   `;?ߔa`  J@`: @` ?ނ(@ ``N' @?ިb+ d/?ޡ=`@. :`]#9a @4 "FH @@ s ")?@@{ ޒ0ܐ`' 1!@B 7? HK "+H"L'hL    - 4-?L  +`=` `  -?->@@ΒL`  (`@ La@  "5#>a   !@@ `@҇ 􀤠@9?߶! 1   @Ҿ  [%0@ҷ  M;a8@i >a@@Ҫ  .5H@ң  )!P@Ҝ  /X@ҕ  5`@Ҏ  !>L!@f@ң ,!@Ң?ޠ?`p@r 9!@k t+a@d da@]  $?'9 '` @` &'b` @^1?ޘ#" a@~@4  $5;?99b!'` @` &'9` @5+?ޤb@b@ސ^@Đ =-!@ѽ 96N`8?޴#0%#bT?ޮX;a# @2 H  *H`++b&5?ހ +)"HP?ް#)Da! ?ޢ@ѧ >J`,>->  *%$` #?ުcm;?ߤ`p @ю`0!b '?ެ@ѿ?ߚ`x  @\ܐᄘ"@+  @ -'@/  ᄰ .  $"ϔ#@!? E@;@*@q/?@1  9"-?ޤ @)  ", V?! '? @7?߰@ c 2)?@ f 7?1"$'L %@C ? ;?ߠ@?a`@@m@ e 7?ސ@ g 7?'L/@"?@ R!(`"R/?'x?ߚ` @7?5?ޤ@]bP ?c6b`N`  [ +`K=!|6? h%9' L6.@` + 6`:  $`N  (` +``  8``(&`)& ,0 +``  ?*pB`"N@R@N2ʰ `"c%D.@ޖܖ ̒ b`5D#=ax`2  +```# 6h    ` `*` (``$ $ax2 @ `"P>D`8`"@T ```8`"``"<8@ &#@``2`8`"`+@`e"` +6'98 &)+6b #/6$ @0``: 8`"@ D!*!* `"ł@ܐ!?cb(@  l?9aH`?ဦd ?  9DB3?`# @@1@ό@@1N ! sB"   @o $#9 $p j 0){"8. t a u. . . . . . `3?a @0d @0a @3" (@ό@ϱ & ?cbx@x  ?9aH`sဦ )? '9D`v+3?`# @τ@1)@ @1!@g@1@_@@1@W@1 @O@1N  6 sB `  @ "\19 `$5?B   +`` $-bP @63a(  0}А".  t a u.`.`.`.`.`.`b`;3?@#?. @ ?- $ )"Ȕ %9 @/ '  @" 2 2 "'Òp! @/ @/͐! @2T (@ξ@` $` АP $ P"  `  `@W   `$#!bP# !@/f  @/ @2# (@΍@β` $` ?cc(@y  ?9aH`Rဦw ?@  9DU?`@# @΅@0*@@@0"@`@0@@0N $ s>ᘲ     @ $ !!(  0)#8. t a u,,,,,,`]?@@@@< !֒p?cch@ ?)9!H`]ဦ ?  9D``3? @@/@@͍ @/@ͅ@/N8 s9a @. d!H  "? %@c 6#c@] B5>   ``@N M`(a(]#x. t a u,,,,,,"`Ȕ3?!@|!?6 !'p " 0)!@j!(?36b !(@ 2) "  @R?6b 2ؐ@Ԑ?cc@0  ?9aH`Rဦ ?@  79DU)?@ @=@.@ΐ@ @.ڐ@Ɛ@.ҒN - sc@̰ 7@̪ D>ᘤ   ` @̚ C`1)!(#. t a u,,,,,,`)?!@Ȓ!?16"`!'p m 0!@̵!(?6"!(@U@̨?"1%6 2@Gߐ?cc@̆  ?9aH`p… ?  9Dp)? # @̒@.7@@# @./L R b@@ @.#L `w c@4@ @@.L ` ? s,  t a u,,,,,, 8@ /3>a  ` @ F?`$'7( ,  f u- - - - `O)?1?%@ +?@’ 2*@˼ 2*  -p  0 @ ۔?c`@@Ŕ f?9aH`B…^ ?@ ̒9!DE%3?`@# @ѐ@-v@b`@-nL` $ s>a ` ` @B $`( = 0 N P,` t a u,,,,,,`칔3?@ˢ$@ߒp?c`@T f?9aH`B…^ ?@ [9!DE%3?`@# @`@-@`@,L` $ s>a ` ` @ $`( ̖ 0 ݐ ,` t a u,,,,,,`H3?@ѐ$@ߒp?c`@  z?9aH`Y…r ?  9D\?`# @@,@@ʀ @,@x@,@@p@,|N`+ s>ᘨ  `2`@ `@ג )@@ʗ @%$@,p D 0U . t a u.`.`.`.`.`.``?(?ca@^  z?9aH`Y…r ?  e9D\?`# @j@,@@ @,@@+@@@+N`+ s>ᘨ  `2`@ `@ )@@ @%$@,p ᅱ 0А!. t a u.`.`.`.`.`.``;?(?ca@ @ؠ >?#9aH`#…6 ?  ߒ9D`aH !#1D!  DD3D a"a&a 뀐!Pۀ`aH@y axq1D?cha @Ɏ /?9aHȀ`!?#ؖ ` 39aDဦ `@+=@!E  :??b@a @S ?/9H`z… ?  Z9D`}'?〒@+ @+Ⱀ@@+ a+L ^a3?c-9 @) "|H  lH`]'?)?#@Ґ"@ΐ?, L@# c  @+@`L@ @@7 @@@L@ ?1? +@  H5< ꤐ!a顒3?Ꙕ* "`'?〔Ⱂ ! "@ ꇔ)?H`" ?#%{x  2 bq b @Ȑ 6?9aH`(`"# % 9!D`@*A@ȵ@5 "  5ޔ?bbؐ@O a?9aH`O…Y ( X9DI`@*#c3?@bp @.@ (?@" #?@N@ `; @ @ @ ,@ J @ ; @  ?bp@ , @0@ ?bp@   0ː""`A`?cc0 @ }?#9aH`]…u ?  9D`c@)aH W#19! ) T `E   " ,``,`2#`,֒  ,``,`2#`,`3 19``,@(d! ! @(@+ (@NJ`2` P#@@!n ?" $ ,bB19`踔?cch @Y ,?9aH‣`#x? `  [19!Dဣ"` @) @  ??cc @! '?9aH‣`#? ` #19!Dဣ"` ِ0?L0?cc@  &?!@#耢 U#9aH`"… ?  9!D`#@ː !?* @( 쀖 0c葖܀1#@Ʋ g? *@( @Ɛ9! @'{ aH   @Ƹ? %@aϐc@ƌ #9 @ƅ #9(@~ #90@w #9 8@p #9`@@i #9H@b #9#`P@[ 2y#9%X@T q?0`硔#` @F $? *@( @Z9! @' kaH   @L? @@%@a3`8@ +? *@' @1 " 9 @& "JaH   @!?@K֔2#Y b̒T `@@ 5? *@' @ " 9 @& vaH   @? @1 "眒 `2# b璒 3`H@ų ? *@' @ǐ9 @&| "HaH   @Ź?%"0@Ő >@O, @'Z!?19,! @&W paH `! @R! @&K [aH `"1?3?@01? ! "6 2# b, `(@N ?.@9,! @& vaH `?@ ? @@' `s! P@/ 29*a @& "aH   @=1?%`"1?1? "! !"! " 3bגڐ `X@ "!aH*9! @%Ȓ aH   @? #aN`" 汒 "?橐 ` ?" #b栒 ?c` @Ľ 8?9aH` &?@  & 9Dဣ `3?@@&k@W @&cꪒ `?3?@?c` @y ;?9aH` Ȗ)?@  ) {9Dဣ `5?@@&&@ @&   ?5??c @3` -??@ % =9D!!9!H〣! @a?1!    0Y!9!H۰ ?ca8 @ 6?9aH`$〦. ?  9D21!!x@ِ 3D&a 5@ђ  D"a  垐!Hڀ!!?ca @õ ,?9aH〣`!? ` 19!D〣! @%f@  d??caؔ @} 3?9aH〣`!"?  ! 19!D〣!5?3a@p   @æ0 %?5??cb @> 3?9aH〣`"("?  ! @19!D〣!5?3a@1   @j0 ?^5??cbX @ M?9aH`〦E ?  9D21!"@ 36&b / 䯐"h〦!%!b@ʐ  56&  b@¿ 6" d  @µȀ ? 6"d ?cbД @¦ 6?9aH`$〦. ?  9D21!"@ˆ 36&b5@€Ȁ  6"b M"ڀ!Ô!?cc @d 4?9aH`"〦, ? @ k9D21!"@F 2&@5@?Ȁ  &@ @ #܀!ピ!?ccH @$ ް?9aH`y〦ְ ? @ +'9D@̐@ @#ؐ@@Đ@#ВL @ * @;`.N`L` * @ޑ:, L  @ ">'#@ "7'!#@ Jc@ c@y "o)6#@r "v16@k C@d ]!6# db @v#X@S )%6$Q @I#؀  ?16&"F !ה0xx@9 53D&a 7 @/  #D$a , #@$ =!#@ c@ #@ 6" %"   #@ D '6$d  &"  @ e5@ )6%" @G?d@@ܐ   C`,  -@s@" а L`̒ @%|@bPð @ ")65H@ "16`@ 'D$@" EC`X  @@@ > #6$$`d @@4 0`0@  #c@ L!&@ 2C``ᗒC@r z 6#"o @g`X #@a $D`  @W )'| c@O 16 &"L '?b 0E@>؀ 2'? $D< #@4  &@2 @* O @" )G  @ 5? @ 17  @  3/ `@ 2' ?c? R@@`@"@0?c` @$ 0?9aH䀣` $ 9!D5? ` @Ɛ@!Ґ@  …G?c@9N@`<2?N` @ ?   T*@ K``> ` M DJ$+ +9 *$9$  -6@"ܐ`" 2 @!a(,`  a@ Ѐ "'R `)8#+x(`b@1 !@ 9aH`O/g 9!DC: `"] V`  O  F  =  4 ؐ# + ϐĔ " Ɛ|    L  Ȕ  @u  @   -@@ %9H 2d5…?װ ሐ@  t%9HY;…ǰ '?㸢`9aD+?!"`3+?c@ @@ @  G@k  =@ x  3@ n  )@  { F r @ d h  @  ^  U % L  C ;ch@g '9H )…1 -?ߪ` n#9aD1"`ߝ@ @+ c@?  9H`…  !?#`F9Db`v`  O   ܰ  `@ wϰ )?#` #9aD 19+a<19!H5߸@.?2 / ޱ a8@Ҕ I9aH2Q〦 ?מ` ْ9!D"3%3ax@ D a !@!  ;D'a x #a@  19!H]〦h ? `쥒59D/Ԕ@Q@ΐP q I "А@m  9H%%〦7 !?#`t9aD`"3'ޣ3b@J )6%"+@BbȀ @ #6$b 'ؐ@9 #9aH +〦 ?ϰc` @-9D"?5o?a@.  @d0"@   9H%〦԰ ?Ǻ#`9aD +?'@+?c)!@  @80#c@۔ 2S19!HL〦 ?# ` /9D`@ 2&%@Ȁ  &  |  Pvao#xh4#aUcZaSMHLc` 뇒79D"Hb`ݶH`Dx2D!  @. %D!DD$$!#! ݛ0᠒ؒـa (.Ո(ݼlްL ۔pL(ژٌٰd<ؠxPנX0 ֠|X4դ?a؝)9!H`'H? />᐀` ??H @L  +9``+-?Ha`"&3`@۔! 2a` @`  2a`< 0@ 2a @`L 2a`!H ]&``:3a @ '`!@`(?H 0`@`(&`&@0 &`@Ґ` !@``&a%`@ `@@`+!H`2` d9H`2@@dᐘ!H%᐀-6?89 a @J 9 !@@%  @)@c @7@ / 2*L ? /,,bВ8!He%8? 1#!H`I``@  ``@$ !H@ @`&`*`,@8` `!H,`H/ 2)Da`"!H)D%!#aᐪ?%8%&`  ``!H`"߀`!Ҕ؀````  H!Hܿ!Hܺp?!۶!9!8 6@Ô!8 c!#6b  +6b$] [r?+9#8ܓa?89 a @ 2B 9H`+; (}``̐a@' @j@nb'  g"0 -(d!9!8 b@@q!8 "6 6$`  !?`!a@0@0#bp6``?c(#9aH`'H? #'D -DaH" 3`       $ aH +`.@;` & ` aH0,`e3Da2 `2 H( aH∐@  Mb@  "$aH" "aH   aH ̀`a`3D0'"@   aH$%aH`" ِ2aH HaHDDaۙ"p ?cHc8 @ ?+9aH`䀦 1?;D5?#a$'a 趒?9#D`"!?#@a@b ( 2*#9a@Z   "  19@J! !  @~`" `,2? @5 ( c@J @ )?㬘 @ "* P!?#- 0 " 9@ aH5 :aH`z@ @@`@ ݔ@Ԓ "ִ@| , Д*  " 9@_ aH" c֔ aH "+ #9@a a @@~(@2?㬢@. 79@'  , !?"`#'a%D;D/D$'a%( ڏ#@ ڊ#7`!?@CӠ+9aH "1u#chr`|aP@C? `*. @ K  @L9!H倣` 9aD!倦     0 ?9ٷ6`d`1C`"PDa?D`@ X $" 0"Da?D`@ X " @ 9aH  X P  t11 p8%D`76< +` )!D`` $+`16 < *?"@  *%P#`x 7@26`d D!?D`b" #`p @ "  #9 a @ x9  m&ฐa @ r9 `L ` a @ }9 J` @ 6@?1`Ж@}"P%6d kD?D "a `#C@@j`X9!H2H1`!C1 X @@\9H+%  #F`pD @ !@G<$NzD"Pk 'aH` aH  P4 XՐ/w *"~  P%`XƐH` "} "PD?c!?)D%! a8@GL` * @:,@`L@  @? @@ %6b aP@  \?!X@  T!!`@  M @4 F ?@6`< ?+``` "#D$a5  @i6d'1bP!@D?%! ? @!C@ X9aH %Pؕ X  ?!p׌?ca @ F?#9aH`)倦> 1?@ 宒9D -3haH !5DL @:.`   I!Հ6 <"   #b(=ސb`׳0с?cPb@@V  ?19!H`nf? ` Z9D`i%?@@  ( 2*)9!@+9 Za$$$$ @ ( "9  +)-b@I"`'@" .@&@ @@&!H`&b@$"`ݐ   0&ײ"P@$ "`#%? (@@ @@$$ !@㿈9aH`<9a 'D#D$$a@  ",R $2( `"$ '' `@$ $& 7 a 23D@`$3Da$`$ $ %!! 0L"9 ?c9aH`?9a )D'D%!$@6  . R $2+ `"'?   & $ %!@{ `@ #Da $%!$Ԕ 0 "9ʔ #D 㿐9aH`#D%D$$a &  a`"$D $$֐##D ?bc(@  z?'9H`2?倦7? `9D`V7?@ 2〠 @@@ $,3c`@{ ?7h@t 250<W8 ր#8p}0,H 2$#3D!D$!&a & ; a"$!1D!2 $!$a"`ה7?0cQ3D?c9aH`'D'H'L'P+?`.? '9L $<%D#D`$$a"@  +?`D H@ f?/9H2199!D?@L@ " 4 +#?`T`%7DȪX `U@ @: ,  *  @ `O9HP@  Ζ Uܢ` p9>P '!L@H7D 2z +?;D`'a D H@U  ?DD)>"#an%!#>a LCP@ϑ: ,  +` @ `9H$ #@՘ @  | 4 ?@v ;-@@+?`@p@ce?#x[99q#0+?= 0\-?/  M9>P '!.L@HH7D +? ?39DD)>&a<"#a%!? @6d/%?/-P0@.'DD | a #C9 @@"`X79H 3+9aD`) Pԙ`X  b#>`P`X+9 ?c``@1  ?+9aH`怦?# `69D`aH`)!8@$OЀ  Г* @:`, L  )E1D%"&! `@  @ X@7??\p    @D V@^!6 d`2})a"P@Da?`v&! g 7?p? \@ @L-D @e,  o  o Fj o hr@L` ?cT 2 -D @ @"D#>a%"` @$,  .  . '4MА`Ӫ0@!p+@!C@ XaH 2 +  ~`P X)6  <$ ?c`@,  ?9aH`c怦[?@ `29Do@@А b#%>  ` ` @ "@`$'>!?ᘤ@ ` `  `)! @ A3@ #$7?@+ҭaP#D!6`"$$`$"$q $"$$`- j( ӓ '>#D!6`"$$`$"$U $"$$``ҁ%>`a(v?ca@  G?9aH`0怦(? `9D(#@I%@C $'1D!6 "$ & $"$ $"$@B&   ,!΀b`Ңג#1D?b'Laؔ @=  a@4  -?*  +9aH 怦c@`  ,@ %?@-L/9D  <@ܒaH̶ b@ '@ |" @ #@b( Вb(0@ #@b8 b8@ " @@@@@`@#?'c`H@֔cXH@ѐ@@ &`  "  2  ?"%aH nb@ "  +D%a  @ 2 .L LWZ@4 " @H@4@@@@,@8@   x@ #@b 3b@ " aH`#9@aH "!9! @  xaH aH` b xLtr b(@Ӑ " @@Ӑ`@ߐ@@ː @א@@@  J `?L  %?@ 7D aH`2U   $ aH +`;,@ &` aH ,?)9`@? -@  #D`?ÔL "aH@  ␐@ &2$a!H)怣"maaH`"d`]aH "`;aT`b@w  !H'D$$a !H "aHА"c@b  1"waH rLqaH'`Ф "E <,@@ @ @@aH`8 c  3P`2  D"1t#0a 2 L̖   )"@ "  -D5D%m&@@ #@c@ 'c@@ " @@ @9! @ Φ   "cH@ %P@ )#X@ 3@ǐ   " #bЍ c`ϊb@e #@_c @Yc " 9<`@ @L #@Fc c@@ " @T@: ͦ #@1 #@+c c@% " @9!?#x@ @   < @ @  @  #@c ?c@ " @%?x@@   )<@ @ @@@@@@`@@> @T @P aH`"3 ޒ- 㼈'9,`2219%9H k@Hp@Mp ~?1<  w?H`i!  Ә 2 H`$,%ϥ19!(`^,@@* / r / x . e o** * * * * * * * %9H5@ 耢 ><  8H0!  Z  H`)&!(1 (g0#c`@@TH"#UP#ːK#!#F!㼨@*`!x@%`@` g@3`!@/ h@P` !@$ p@E @J   ' + - * L` (`;`@`x/*@ڠ 4 L` !9!H`27'@m  1< ) @/!HP```@ . 0`@`!``Đ P0@̦@@`(@ @`(&`@0ήɐ`"`!#Υ`@;9aH`@` @@ :   99+`!L@|! @{ "/)D+D '/-a@-!(@S -!( d@f ؔ!(a@hM!(  !(aH@А 8 !!L 2 @S#D@9b9b  %! /@ɐ "%1! `  MaSa!9!($!4@`?#9/!4$a00 aH ;-J`   , @ ` ` J@ ", F@ , @ `#9`@ a %9!( $,a #@ ` !( 9#!(!(, q%0U!9aԐ!@Ő` ;@ X#%@ T')!@ 99+`!L@! @ 1)D/@ 1)D!(@ M!(+D B!(b̙aH>`͐09a8aa0͉!(q-J̇p0 P@j :- 8 0***au)Daȁ?c"( .?@'9/-+@ S@<`Ґ JH@ bD <@@ 6!Ѹ" N#?/-+9)@ !?@  Ѡ J`*@aD"`@ 0!~@ƒ@K@֐8Dxn@j@7@’ڠ?(`9?'"X bH Ȧ  !@25% ;#@ N`#/`@@  A@ @@ ,@`@Ր?@aJ"X"X"X`$'"Xa    1!#J@ -x @`/h  $@,  ? Q?-bl   `/`3bH &bH%В# "W ??UK``1J  @ b` >b`>  d "X`0?#$bXDX2l?? @ ?А  X! -#P&  %=MU ؀`1> cL /HJ0  2?`@@$0DT8 #DbP!D$"0"T#Db0J`  "0#"0J` Db0L !D%!%"X`Da'"XF  @ c"X?'"Xb` >b`> f` -D0 %0@D "0"0M 0;b0$b0!D`$"0b0@3J@ "0b0K@ .yD$b0#a0@ӔDX:`!%DX`"a?????^%DX 2z??@ QC #DbX 2??@ Gc DX2??@P=@?DbX`2??@Pi6?,?DbX`"M ??(%DX 2s??@Q??D"X`2M??  @ 3DbX 9D??"8 c T JN%`#"0 `$"0b0@J@ "0b0$b0-8@O#DbX b`;;{! ޘ` ? #@????@?p????@~ ??@w #@''@q?T????@b ??@[@#@'???@O ??@HҠ? ??#@??Ȑ@?? ????#@@1? #@????Ȑ@#} #@@k@M "M"0` $"0b0@J@ 2"0b0$b0#Ȓa@??@;b`ʂ!0b0Mxb0@M b0b0 $b0!D $"0b0@J@ 2"0b0-$b0H3 7D??@>> **.<-,--<-d--.*T-㿀DD #T#"P@ .@ D,"XDD"@b<@`&@??@&㿐9aH`6c` c @͒ `,` 20 ڐ!h6€ %9H `!#aP@ !?@ @ @H؀3  @ 2 *0ɢɞ0#9aH`:@saX >?@  @@ aH- - @f (?N@   "@(`;N@ ` @ +`< @ 2 .@  N@ `@   Y!ؒS0с!9!H `"-a`@# +?@ 6@ 3@!H8ͳ  @@("`@  00 @ 6*@ ?Ђ`` ( *@ `2*@ J`-2 ?*@ `@ & *@  㿐@ߐ   N Ѐ`.`` (   2 N-2 ? &   ?@ d?N `-`?N  -\X  ?В ` ( * `2* N-N?* ``& *  h ?Р ` (* `"3J* ``& *  x ?Ж (,@ `"&J,@ ``& ,@ @ѐ ? ?@ʐ, #6c@  ?2@ ` `-"* ?`-",@ ?㿐@R @6  Ђ `` ( ```N-2?@&  `@@   lbh@8@* @ @<㿐'D  \@  >  #E, ` 8#Eb\<2` ?$+`\$b\@? b\*@A b\*`$b\*@@5 \$@ !%E\+`@4 $ \* @ @\(``@X@`@T$b\x\'x\㿐#b@b  , | ?, @  ,? & ,?㿐9aH`[b@ Q@ ?@ T"@z V@t Cb@m <b@f "5"@_ c@X  @Q 4@K: &0`{  v?8o@?P"@.2 ` h8X` Đ S @ @׀#@ @:`  @  c(@  @?@0`% c0@ " #8@  @82  @@ِ @Ԓ` 1#H㿐9aH`;b@  @ 耦m k?@ "@ "@ c@ c@ E@?ƥ#h< :?#@~ c @w  (@p  耦# !? ` 0@b  #8@[ 耦  ?@@P 1#i㿀9aH`?'B'b@; 4@4 -@- &"@& 0@ )1#@ "3c@ 2"7De c? \ #;M K?@  9L? =?# @ݐ  c(@֐  -* (?c0@Ȑ  #8@  ) ?c@@  X ?Œ@%E;E/E-E+E)E'E$|%"x%bt%p%l'bh$`@*`X#E8`?`1 9(`!c@Ĕ    c@  #  $bd jЖ   +/?#@`;(. ?$`' . ` $|bd@@*` `". $bd $bd`@}    `@u  $  $bd qА 8  /?+#@r`;(. ?$`' . ` %"x @ @h@Ɛ. . .  .  .  glN6`@.     @&  #  $bd qО   (+#@$`(. ?$`' . `  k%bt @ (@   0@    8@    @@ؔ  $  $bd bВ `   **?c@֔ (.  ?$`'. `  %p  @u 9 H@    `P@  $  $bd +Ж   +ظc/?ؐ@ (.  ?$`'. ` %l` @6  @. X@&``@T   h@L    p@D    x@<  (! $bd Ђ ``   *К+c@:6`= 'bh @ @   @    @    @  ! $bd nЂ ``   *њ+є?W$`@. F$bd @Ԕ   ਐ@̔    @Ĕ    ฐ@  2@ $bd Ђ ``   *Қ+Ҡ €`Y  `y `A`ay  $bdЖ  /à a+Ӡ mà i`E|DDDDDDDDDDDDDDDDDDDDDDE|E|DE|DE|DDDDDE|DE|E|E|DDDDDDDDDDE|㿐Ebh6Ebl6@Ebp63Ebt61E"x7Eb|7@㿈'D@D/ / / / / gl74 ` ,8'''''''@&@ 쀣@q&㿈 &  @ C@`2   @ ?+`:8+ `?''耢 "8 `*; *`    J&^$#""$` `"N `"I`T`":. d ``2  ` `+`< `#T ''耢 "%`(`;``.`?C @  J$/$"# +(`/ ?+ + . & % .` * . "#. (`2. *  , . # ` `"$@&@"㿈"@@ @ & @ _'耤 $ڐ ``' '耢 "`* ?; .` Ð ?J`2&"# *``?+ `2 ```2\&&?`"V&N`` c @`2&@ &` .`&N``  '耢 #@`, ;  .`?o? l  J`"%&`":&# ` `"&##J `"%`1`"* K?I??+ ** "# ?* @ ^+ ```2+  , * "# *(`!?2* *  . * #@ @"& # $&"#+(`㿈`   € " @耢' '    耣 'h9aH` '@ /  ` @ % `€ "@ @`' `'Ԓ  @`'`'̒ȁh!9!H`造`' 6? € `",?( ` !H @`' 'Ԓi6 ? ' '̒ȁh!9!H`` `'@ &`&@.`9 ` h !H` `'``@ `€ @ ?0 @@`'`'Ԓ 6&`@ '`'̒〢 J` # +`8` +` J ` +` "*@ *@ J ` " *@  J ` *@    +` 㿐N` J/`>` /` N/`>`^ >:`{`'" C`[`"   /`.` .>`+@N N`>` @`?`?+@ O`\2>`. Ѵ }`{`~``2˴ ɵ>2Ǵ ŵ>2ô  ]㿐CN`"@NN ` .8`(`8`@`N`/`  `+@N  (`8`/`8`@  N`N ``+@N`v tN` /`>` /` N/`>`^ >0/`>`^ >0`{`'>M`[`"2  /`.` .>`+@N  N`>` @`?`?+@* (ڴ }`{`~``2Դ ҵ>O`\2>`. /` | N`dr2 >2  ]㿐@  !@ &  ! &@,9H連`R ɐ!0 Đa0@ 㿐%9H`J`X!Ha7`@T @!  2T @ \!@@$$@!T @ @@ H`B4 T @ '   "@ /4 @ђ =@ 4@Ȓ `&6 $`0 aHiH "`h_R`"a!Va*aN:Δ*aؕ;`FH!C!0 㿐9aH` 2! 20@\$ 2   @Q$   2@K0?㿐9aH`  " @`20`  " $ @*$   2$ ?@͒b(9` aH `  !ܐ0 ( @/@ђ @  * @ɒ :  *  "H  #\@͐E#@e  @?㿐1EbP@7"" "&"@ &"㿐!9!H造`"XE@"@ @ 0E@@߰ !H逢bx@ݐ?s0)9!H`DEb @E !`` E @Da`` $@!H 28?!H!"Ѐ.?  /,p ?,#*"5E.`@  $@+`@a0Ւ#"E!H`"̰?-?0bɦ?Ц %@,`$-E+@!`n%@*"*`aa@ a 'S    `?$`  E` $a@a a@a@Š $` $`@*`  z?!H`R)9,'@/ &1E"-@`M'E@J@ Q!H V`$@""ᤐ "@T %@,&,`ᤸ`&I @7!$!@.! $!@ !   @@o $@@`@`t%@%s,!H`"?`)#0g?`@Ɛ ?\"x0!H`"?T`?㿐E@Bb3cx@@㿈@d#@#c逢 `c@Z@耢 U!@R @u'9HG'쀢  : ! ` 4+ c +)@ @3  &@ =  8*H`"$ 쀢,` 2 &!@,H$ `ِ` 0դ&$ ߀#`` #bP?㿐@ @`Ȁ@ 㿐@ @aꀢ a @` 㻘-9H`#@a (H %0) /!*/@B@Hݺ @a(@! @@'!@' 2u/`H yaH@  J "   +@`K "  -@@O@ /`&@aH \aP@~ "b9J  `"   *@`K "  H+@@ϒ /  @=@ǒ \  @5/9H O0`!@ʔ O`!@!@" `!@ H/`H' `& !8a`aP@ 2J 9!H  @R !@ O2 @j @G   #H ``)!a!@a`7ᘒ0 0!@)@! !@ !!@- ` @  !@a Hڲ- !}<awO0`"L@}@`@R@ $ @e)@X"!@ O2 @ۖ@h@  @Ζ @   @<s/ap@@4#b #P#?@A@y  @ ;@?$   @r  @ 8+㿐@"0 `  @@Ԑ  , @2@ +@# $@@ #`$@  @"` 㿐@"@@bP 5@ÐX 6 L@`', c &@S,@&`L@@ @/@ @``&@ = * &`L`2 &,"&- h#bP'?@"0 %L`  (`= &L` @& @ ,& & &㿐N`  .`8`L@`@2 @ @.?ς`8.`?0`cO>`  @,* & L")? &`$ @,* &L2 )?Ϟ@ +@J@@s'%0L)?Ϥ@ +@6@@_'%0@ڒP J ?߀`@ɚ?J +` ߛ;`@ @?ɘ@?Б(`: 㿐N`  *N "/`>`%.  O ߀`@ɺN/`?` ߲ @ɂж.N .㿐N`  #% `` ` А@  `.@`N  .@` @@ `.@J`  0J ` (`8``+2` * `J ` 㿐@Z?? .`8`L??2L?㿐 N`? `? 2.@". @* : ` .@.N`? `? 逦@. 4  J`  *`8`+`8`@  K` ?㿐@N` 1 + ` *8`;`@ ?  @ (``;`N ` 0"    . ?   \. N ` 㿐@Ӑꀢ c㿐  @ 㿀@ '@`*`?`!@  $ " "" `\5* `@ n`[  `^`y   `-D v@  $ "" " * ` ۰ @6٢` ]2 ?  `* `\ɀ`!`\ŀ`[`\`]`\2*  `^`\2*  `-`\2*  `\2* * ` A@}  M$ "" " *  * ` @m  =$"" " @c  3$ $ $$@X  ($ `   @K  $"" " * @>  $"" " *  * ` {   &$ @( 㿐/H P? `L(` @ H B  0>=?H`9   04 H 0? `,  ֒ 0'H @t   H@n    H0H @b  H @\   ? `  Hd(㿐 D @~ `%9?@ 4? ",  `&@`$   @?@    @ @? 㿐J`h` #`h16@2#ؘ  Ich#؞  *  Ih@ @ @ &@  㿐@   @ @А㿐@H  @*  @*  @   & @㿐@/ @?!貒  & @r  @ J "& @&  `@ ? "&@& @ 4 "& @&  \@ ) "& @~&  @  "& @s& !@  "& @h&  (@  "& @]&  d@ "& $@R& $ @ "& @G&  @ "& (@<& (@ 㿐@/ `J@ 2 $  `@ @  &  $`" J@ 2`"@   @ & & $ @& $ " (J /2  ( "@m& & (3! @  (a@   (`D@   (`X@   x (J p"  r   ( & @@*<!  ! @& ( . T 㿀@/@)Ր @9@)㿐@/Ԯ\@   ސ*  ~ `L  ` @@&`N@    @@q& N    @@a&  N    @@Q&  `O  `  @@A& ``O@  ` @@1& `L@   $ @@!& $*   @e @㾈@/ ' d  @   # !@2G!@)l 㺀@/    !p #\@*$༐! @2&!@)J0Ԑ! @2!    @)2@/ 'LN T P&!&!&! ` &!Ԑ p : "  *"   @,  'X'T ` J@ @ !8p  @ " J  'T !'P  J  'T  'T! pJ  @  @VpP@)^L L`2!&! `T @2! `t @2|!@(L`" d@)RT d&!T&!&!x @U& @ 2 d  d   @)@ d?& d & @ 㿐  +? @ "6   `@  ` $ @ ` `  & @`   @і & @  @ǖ  & @@ݢx@/d 6@`*`@ hh88hhh@v & 2@  @` *`@ $H(<0  ? `    @  $p @ $d  2W$@0!ْ   S ?d@/d*  2 d@0!@'ʒ/d @Y 2d@0!@'@Ed$d @I  6 `` `` $@8d & @'$d $ 2  'd?c@ 耢?2# !@0Oj`   c d &@?$d $$dh@耢 B # !@0"=x  a0 @&a0 @ 2 !@'.%  @R <# !@/@'@  @  @H$Ā  O〢RE`Px  ܒ @  0 'O〢 R Eܐ? \`P ڔ RO〢 E%!(@@G$Ā ̰ Ē @'$x $x@'B@Qd?$d $@Ē"  'ܐ @N   O〢 Ex @ N  @  $ @  ؀   @E  ؀  ؐ @: x $Ē@1#$ @&f$@"$@Ȑ _ ؀ 2G@ $@ A$D@ @ S @ G "  " p@&J쀢`@J? @& @m3 @&$x "$ $@$!0 %$$@@I "    $@   $@ $@$@ $@  ` @&  $@ 㿐@/l@" F  " : "  *" @ "`,( & @& D& H. T. U &!&!.!&!?& d!&!  & 0@& 8&!&!@Ɛ&!@%w!@%u!! !̀  !耢 ! @ 㿐 @ d &@&%@4 d " @  " @  " @ " @  " @  " @}  " @w  " @q " $@k $ " (@e ( " P@_ P "!@Y!@& ! \ " !@O ! " !@E ! "!@<! "!@6!̀ @0@$!@$!@*㿐 d &. U @ 2  d X @@7@{ d . U@%@ d?& d & @& D@X!@%!&! \ &!@ ! & \@ ! &!@&!&!&!&!&!ԁ㿐 .㿐   Q㿐  㿐  {㿐   d @   @ϔ !& !&  㿐 @㾀@/  @ 6 I+` @   #  7`'4".''' @ #  `̐ @V*? @ # @Ӑ#  @'? #@- !@֔ @ @# "㿐@/Ԑ  ` @*?   o㿐@/h #  d 6!!  !a @*?@!&! !!!I 2@!&!㿐.`:  @ 2?@ 2 ?@ߐ 2?@  ? 㺐@/D`   @ٰ @ $@e L`8 @[ @V l$@` @0 ` @#~ @N` @#s  @5 z@  @ "L@J? 2L@ *?L  #  @  L  @ ѐL #"͐ [F@  @$  @J  ]  @ = " ,@`  @ 2     @$   `Ȑ @"@Ȑ @Đ 㻐@/ !l@ݠ  !@"ݐ a, @!l@Y 2L! #  @ *` ,M  L = @ " , L  @ "L L   =L 瀢 =L =m, L @ "L L  L '  @ €`\2* L  * L  * L D \ ' L  *"**    @@ "@`@ @ #` @:@ $` L 2s @/x "0D` @"(0  a  @"0!@"@S@< 9)!'%(  2*`? "?@ " ?@ $  "@@u $@!@$ @ 2`@,ѐ$`@ Ҡ 㿐 @ 2   2 㿐     @ 2 @ "   "   "  $  "  "   "   "   "  @ "   @" D 2  H㿐 `2! "   @  "  2   "  @" !x "  @" !|㿐@/` ! 4 "? d "  @"!  "? @"!?@/  @ 2)?`"&?@  `p @”@Y 2 ? "!x ? `ؐ @ @   㿐 @& ,㿐   , @v& , `  0" 0" 4 `  8" 8" <㿐`T  `X@`T€㿐@/#`H @x  + `") J*"# \ ::  J:2 J@J@2J@" J@  J J`2J 㵸@/耦@ " @   N /` @@ ` h`2!$ |@ @/$/@q$*  j`  $@@ƒX?Zp<  #` @ @I ? #` @ݐ <  @ 2. ` 2 @q@0+!?@@ " ` ?L ", F " ` A " ` < " ` 7  ` "۠@ `@h'ĒȔ$@(Ā `  Đ`@@*? 㿐@/# @"@ 0"@ 㿐@ x 2&( & & & & & & & . & H& `& d. h& l& p & t 0& L 4& P 8& T <& X!` & \!@o0& L& P& T& X& \㿐 =`.N h " t p` ` ?@`"@  t$ p? $ t t@" p$ t l1$ pc@,` *  l " l!""$ l$ t@( 2 l .  "$ l $ p' $ p'$ t p t$ p"$ t㿐@  @ɒ㿐  `" & `J@ "& `& `㿀 `@ ``"@#@ ސ@㿐  l@& l l 2 "& @& & & & d@㿐! "&!&!&!㿐!  ` 2 !  &! 㿐!"!䀦 "!  !@X@Ő@ɐ㻐@/T'L'P'T'X 4$@L/ ܒ  (&`L &`P  M&`T @B&`Xa8 @< S@   &``a< @`P`L€q㿐  ` *` @&.  @ߓ.  2$   $  * "@ $㿐@͐    , @ے d$& d㿀@/x , aL @ݖ! @`@ 2  @$&!@0@`2`@@@Ґ  ` $`@@ $`@!$@&!!\@p  @%a4 &!;"@!l@a !|@Y!В`?.!'*!@M  a @䀢  &!|"'* @*`@*`@*` *  *  &!|㿐@/L@*  .`  Q!@k!&  @ 6 @  @ u  P & L@N@֐& P@   & D@ 㿀@/d@*  `a#\\ #``#d@Ȑ!@"! 㿐@/Ԯ@*  p` !@ !h 2 !x!@!_ !@!V  P @ Ŕ L@  G@  B  @  8 @.` @  .`@.`0  @  #@   S @  @ Ր   P`& L@ @6& P@   & D@` 㿀@/@*  ` #\#`\ #d@+!@! 㿐@/` !@J @  !H D &!&! !X@f 㿐@/!x\  `!@T!  `6 P @  @ @   @ s  ,  @ i  , 0  @ ^ @ 7  B @  !@ @  @ <  ,  @ 1  ,    @ %  @   5 %h`#?  @  "@@ǐ!0z@z @ q@ ? @ e  Ԣ`  @ Zd @ݔ T@  O D @ g I P@ D!@* <@  7 E @ O 1@ ,  @ &@  ! S @ 9 @ }   P`& L@V `"& P@ې& P@   & D@ 㿐@  @㿐 " N U  @   @ {: 2 㿐!x @0@ [㿐 "  D `?㿐@/✠ $b @ e    @ q ?    @ h @ @  C$ DXB D ܀  +!x  $!x? '$ D! "   1 ! "   #   D@! 㿐@\*   " " @ 㿈@I*  \#\`#`A " @o 㿐@.*  O " @Y 㿈@*  \#\ " @@ 㿐@/| 0 !%#a ' "# b   !x ( @9 6 @ @ ! 2 @!x & D @  㿐  % "     `)@ǐ `@: ? @ 㿐*    S@. " Ő 㿐*    P@ "  㿐 S@ 㿐 P@㿐@/! *  "@ !x !@!6  D @^ ,.`: @ &@# !@  S @H @   P`& L@e & P@Ɛ  & D 㿐  / \  $ \$ `& 㿐@/    D !@;!I?$D !!Ԑ" ?6!x@ !Ԑ@ " !xN U ,*?  d @ ؐ@ &?@"  ? @Д Đ@֔ &?@  㿐@/ C D :!!x 3` f @ 1@u &L?@ 6 LE? c @ &>?@ې &9? L +  S@ &/?@̐ ! (?!@! ? @r ! @v &?@ & ? & D@`!@ ? 㿐@/p"@ ? D !@r! ?!x @ @ې㿐` *@ 2!x ? @ @㿐  ?!x @ @D㿐@@㿐ߔ $?㿐 2!x  @ @\㿈@/┮\ &+ @Ԑ! d   D ! !@! !x  #\@ @ #\@ "  㿐@/ᤀ #. @!D㿐@/\  ` ! 2 d "  J  "  2J   "  "   "  H㿐@/   &  aT  L  㿐@/   ad  L &  aT L  Ӗ 㿐@/~㌮   &  at  L  㿐 "    .` "* 㿐 N`M?N@ I E@  >?@0:L@   `"2.@L  "2 .@`  *`:  " @ `.@` L 値.@ @   @̐?㿐@ "    .` "*  㿐- "    .` "*  㿐 "    .` "*  㿐 "    .` "*  㿐 "    .` "*  㿐 "    .` "*     㿐@/}㰀    a @=  !! '@ 8 !̒@/.㿈@/}  '쐆 a @  2 N ' / 94  '@͔ 쀢`"  J@` ` 㿐@/}d fa`  @~  L`'  `'N   N  N E 0Na @~ϔ   a @~ǔ  `'a @~  `&a @~   a@ @~  `%N #  @  `J@ 2 @@ aP`L ` !㿐 .` @.   㿐   .` @.@? 㿐  .` @.@: `?  "  㿐 "    .` 㿐 "? @ N U@ @  @ 2?. U ?J U 㿐@㿐@~㿐㿐@/| \'L* : )!` N`D 2`'`\2,@2,@,@`,@`/@ )N  ,@`   ' $@@А!$@2   ,@`,@2N,@$@㿈   .@ # J!!#\㿈@/|!4 J #\|㿐@/|࠮/     * @ ^`  ' \`2`@ ?`&@}c  !p@a3 // :  \3a @ ^ . @@} ` ` ' \. .2 .....`?2 @.㿐 J! 㿐@/{ЮА  J㿐 "F @|@| = 0 \2',@ \"!,@?А  `?А  `?А * >P *  ?А ,@ * @}  &@@| 㿐@/{aĮhaȀ@?a .``,&a!N@|  㿈@/{/ @  ?`,`O!@|u 㿐@/{aĮaȮ@  aL @ `@ &L@ &a?@G$@aĢ`@ђ `,&a!@|H  㿐@/z@| @\ "`, ? a @|. 㿐@/zȮxĐ" @?@|\@ , &a   @|  㿐@/z@" ", ? a @{ 㿈@/z⌀``)aȐ 44? / / Ȑ  4$? / *` *` *` &&0 Y ?,!@{ 㿈@/zt``a7 ' @ " ,?0 , ? a @{ 㿐@/zaЀ+ ,  4, 4 aa@|; 2&aa 4 a@|* "&a&a "@ja?㿐@/ya+ ,  4, 4 aa@| 2&aa 4 a@{ "&a&a "@5a?㿐@/y .   ԑ.` x (?  . ?: "&*@&,  &"   @z  㿐ܒ^ 2 ?ܒ@{ܰ &܁㿈@/y ,  !!Ԓb @z" !؀` !!̐" '* ` * `* `*!# &!Ԁ :` @*` ? 㾐@/y( d  "@!?!!Ȁ@ 6$!Ȁ`" !@{V !!!Đ" $!Ȓ"@ $!$!$!!!Ȑ#"@ @4! " !!!Ȑ" c$s?!!Ȑ!@ @" #  a Q! @6!@[S? !Ȕ   $!!#"@ @Ӱ 0B? @Ӑ  +!!Ȑ!@ @" #   $ ! @!@? !Ȑ $!"@! $ @@@z d?$ d?㾐@/xp!̮ d  !"@!Q?G?`Dc% " @k 6 @ "` +`  2@ϐ! &!Ԓ@!!@ƒ&! ?&@$``N U 2  Ð @# `Ȑ !@ze&!԰㿐 , "!@yF!Ԁ` 㿐@?㿐@/x|@  ? "$@u?㿐  @  㿐  @ 㾐@/wࠖ ,? d  "(@P!!?# d@ 6@ " d # !@ !@/㿈`2'耦2'!  7쀦`7 7쀦 7쀦?@y/ &*`" *  *  @yǒ 㿐@㿐@"㿐@/w4"@x @ J@@ɐ (@/w؀  @ " !@* `4`4`4 & 2! b,!*@ ,0X8! "( @xb !"0@ 2 "4! @xT "8!@xK   &!!&!` 2 g "! *0&! &!"<  &!B 2 I ". | {w  uz   gb@ @x- `` @w 2*bD Rp&!!|?!d@`c8"H"L M Y&! 2I  "9 1 0, b  f J bP "\@w  J bP "Ph !&!  bp @ː! &! 㿈@/vp  D Ӑ!&!Ā OA@Đ N2 D@  ``E@  bx  0!Ȑ?* : `*`@ xP8DP`PPPPPPPPPPPP! !   (֒  w&!! (!@wY !@:j& D@  gb& D`& D ]Ob  0! 2O& D &!! ' F! ! ! ! 28& D@8 !   "!   @ !!" 0!&! & D & D"O@ !H!& D&!!-&!㿀X  s` Ԕ m`` #- "@*`v  _$`        "  *" @v֐  6A&!!! ;  5  /  )!*:'`"@`@ @" `" `" `" `" `" Ơ &! `??H@/u.`!: %`H! 2`-  &!      : .`"  *".`@v[ .`     ` " `!:  @@v [Ք d @.`: `h&`?(&@  K?' &'`  픒` )&``'` /`*@``, ` Ȩ   &!@uÐ "@ !/ &! !& D&! ?@u?㿀@/t @ Nt  o.` "  $`퉐 c$`` @ J? '*䀢 2b@uj  , SX @u5 ,  MJL  #  @  L   D M1, "`L펐&!!@ ``@  H    & H`P€_@   `V@ ?㿐@/sخbX @tÐ " "d@t  "l@t & H"t@t   "|@t  & H㿈 ޔ 2"?!V ?@t!@tѐ`  $@t!$ $ $  ` "& \" & ` 㿐@/sh#b%! !Ȁ $!! ! `* :  $!Ā@ &!Ā *!!"  !@t   $ D!İ?'$! @t  &@@ !?!!@t @*!$!    ? 6!?㿐 d $ .@&?" !Ȁ@ ! `&!*:  .@`  2 ? ?4!.@`D 5?a&#aĐ aaȀ ` a  #a*@(8 `aĀ #aK?\K."?0`4aĀ`  aĄ#a 㿐@/r\ D?  "@ !J N N U 2B N U  Ȑ 29  & D@ !ː " !  2!( `!@J  *"!B 0!! *?"7 0N U  ΐ 㿈@/r   F \k >"T4 7 ɔ 1 Ô + @@  !`   `  `0`@H `@` }  ; b`3b`       !&!Ā 쀤 ?* : `r*`@ hHx|S  O GO       4  O022 @ !?!Đ1"!9   "  -  !!!`&!<O@ Ð!!Đ "!!Ġ f&! "㿐!$@r&@  &  !$ : !x"  *"!x @r!$!x D& @r   @r @  @r @ ` d@r @㿈@/q\ !&!Ā y e s耢$O!0O`T`D `d `V`E`N`A!!Ē"  '  MO@L0HOA@ N2 D@ߒ 逢 ``4ES@Ӓ ݀ @ɐ׀ b ꠐ 0!?ϑ* : `C*`@ $|<,l!; !   (1  &!! (!@q & D@[  & D@ & D! 2& D &!& D L ! 2& D  &!w& D@-; ! v ! p/ !  L 2w& D@ r  L! 2 L֒ &! L MJ& D@0 ! "  2 !@l P8! "   !*"@:!鎐!!@3  5 & D@+  - & D& X! "O@!o!& D &!!!Đ @ &!"O@!Y!& D  &!㿐@/o@b!.`: @A & D@d@qs d?& d & @x L  !    C``  2!`$,"@*``  $`       "  *"@p 4   c$`Hؠ! \  V { P u J o Dܒ i > c 29!* : '`!* : ' *:W'`"@` "" `" `ؐ" `" `" `ܐ" $`H &!  !@?`?㿈盒  ?`  9`!,绔  .$`      :  "  *" @p  6&!   , ` 쀤"@ &! ?㿈@/naa "-w  j$a      : "  *"@oא  a V?G" 8  耢`h&  &&'   ` *@ & 耢`%@ 6 2!? *@   Ц1  $a籐"@aa結 a` $aāx@/m㸮 @濒@.`  $`} O߀   Oߠ@z S bȐ @F!  l C b̐ @8a M @SY P  !  P bJ p E q!` @nbА @@0 ! 7!@! D bؐ @ H b @  q b @ה W b @̔! 2-  F L R "- "@Ґ`c @ c @@Œ -  i $``洐&!!@7@0 `L$```P€成@ 悐@?㿈@/l㈮ 'P@n @m * @n/ @n* @ P   ? @ :' ,`%*`:`` %@ -` ` 쀤@6%`  `"`?M ```쀣 P@ " $ P@   M ̢`,&%@~,@ . @" <-.@< @  ,@" <4  6 , ,@@&,@. @"@ <$   . @"@ <4 ,c -  @Ȕ #@ @ P@ @ $ P@ @ @@ *. @ʒ `#@Ð@ɒ .@@ " @@ `@@ ^@ @m]@m[@mY㿀!˒ 2?@’  !C@  @ ?㿈 0 27?! 20?@m!   @m "?@lא@l!@m   $@l $ @l!$ $  ` "& \" & `@l 㿈p N V6 I N V$H A#,"@*`䇔  4$      :  "  *" @l  @6&!  ``@*`:`'"  &! ݐ?㿈 O? I"& H T E & H   & H 㿈@/k1#!$!Ā 5 n .!!"  %O d $ D0?`'@l[ &@@]!#?!!@l{ @*@!$!!$!    2? ?㿐@/j8 d   D N V  "@#!.@ה    2.@a .@? @" @.@ `.` `  .`J  .@ * 㿈 D 28?!)$!Ā 0  ٔ ) !!" O d? X@ " $!Đ!@k@  X $ X!@k@ !$ X$!㿐@/j8 D  "@!Y ` c r &P  &K  L   S c &A  &<   N U 23  & D@P!N U ] 2& d " !  2!㛐 `!@J  *"!ې 0!! *?バ 㿈@/i㔮   F \ K x E  r ?  l 9 f 3 @  @ \ )@"`` `O `0 `@`   ?   Y 毐ϰ HO!0!"`   Y 1  !&!Ā 쀤` Ȕ 値`耢ۀO`T`D `d `V`E`N`A!!Ē"  ' K €`O0}?* : `c*`@  h|  s ` h ) `9   y`1 "    i`!  !`$&!ἒ# W`!O@<!␐!`@  "!!   @&!‐㿐 @@j&@ @&@ 㿈@/h✠ @ !x'.@ `.` `.` `.`  J `" .@ @*` *` *` *`` @i` @i    "( J #`# .@ @*` *` *` *` *` *` *` *``  @i@@im  @  "&J !`#  .@ @*` *` *` *` *` *` *``  @i`@@iF  @ (`%@iD "@ "`@@iE@@i+@ `@@@i<@i" @ ``2.@ 㿐@iU @㿐@iK! && & !& & *㿐 @@i9㿐 "& @i0&& &  " (㿐 #" @`  @ ` @*`@8,  6#@i 2& &  㿐'L'P'T'X͐  @"@ L @i  @6   &   2 㿐'L'P'T'X  @"@ L @i~  @6   &   2 㿐@hm@㿐    *@  & *@㿐x   @h & *@  㿐 d@i  㿐 @   d@i  @  㿐"   @\ 0  N 2@r 㿐  ` @hC`@hA`0@㿈@/fH \  #\@ #\@ !   c  @h*?  ` c  @h@*?pА `  &   "  *"0  @h  @g k"`2@ 'Ԑ ''`'`'` '`'`'`'`'؀ Ԑ 'Ԁ   ?@h "? @h n &`&`ܒ&` &`&`&2&` n@g|&` @g?㿐@/f \ 24?  `"*? `#?#$c( @h ?4? $ @g ? ? 㿐  @ ``?x@h N@` J 2?2?` `? " ?*@ '>> 6  $"@ " "@"@ `"@    ? 4## .    2 $   ( "@   ("@   "@ `Җ"@ 㿐Ĕ     㿐 ``   㿐     㿐 `` p $:"@## 3   ( "@  2 $   ( "@   ("@   "@ `͖"@   㿐  " $?"@## 8  ( "@  ("@  2 $   ( "@   ("@   "@ `Ȗ"@       㿐 `` 㿐Ĕ     㿐 ``  L  G>? ?(` 2"@0 ? + ?(`  "@2"@ ? (`?+ +`  ?"@"@` "@          @  *@  &  08(@ (@    㿐@/c؀   ? ?#H?c, Ŕ c >  9 !_3?a "O@ ?  @  ?2$ ?Ւ  #@?#!?!А ??! _ ?  ? ?#@  )   ( ?   * ?(?" ?  *` ?( @?(@ ?@㿐ѐt $V"@ P  ("@  > f $   ("@  - p  ("@  ("@   d$   ("@  ("@   "@ `"@    f  p  d       f p    d   $"@ " "@"@ `"@ 㿐ِ  _>    㿐`_ > `    㿐     㿐     㿐   2  ?> ~?    㿐  m    0  4!? _>  4?    4?_]8 ? _]?0     4?_]8 ? _]?0    0  4? _  _]     4 ? _]? 㿐A@ 6? " `$    _ ]`  㿐@ ?`$    `   㿐@ 2 `  ` 8?? > | ? 㿐@ ?`$    `  㿐ڐ@ ?`$    `  㿐Ӑ@ ?`$    `  㿐̐@ ?`$    `  㿐@ @ *  ??`" ``"? G  `2C ?8= ?87   `(  p/(  (  ?8  A(  0 㿐㿐@/` &# c.  *   @㿐@/`ἀ &# c.  *   @㿐@/`` &# . @ *`@ ` €㿐@/`#. @*`@`㿐@~  &??㿐@q  !??㿐@/`\N #  @ "   ` ** N *P@/_Ю#c  * 0?N "- @` ? #c0 @a   @ $@: * LJ @`֒  6 ?@$@ 㿐 ? 2 㿐@/_✀ &#4#.  㿐 @a : @ 㿐@a   @a    㿐@/_#  @ `@'` ` `  ? @ ?@` ?     @  `@`  ` & ` 2  㿐@/_9#  @ `@'` ` `  ? @ ?@`q ?     @  `@`a  `  & `  ϴ 㿐@/^? ?  # `    `@`;  `㿐@/^x?   # `    `@`  `㿐@`@$㿐@` '?㿐@/^⸮@` '#'@ "?   * (2 2 " 2*J " ?@@/^䀦  @_  ''''' '''''Ā  {?Ȁ   '`"p? @_͔   87N 8  @Œ䀢 5`[?'$`2`# "I?  ?0B怢 ??=? :?`` @_ ` ' '䀦`@_w7@_\  ?@_W  "@"`"`"` &@ &`&`̰ &`  &`&`&`&`&@_??㿐    @_2@_0㿐@/]$ ` '@*` p|dL@X#8#<#@ #D #H#L#P#T㿈@/]\ \   "6?  /?  ? @_'X @_a@4? "   ?#\ @_M@ ?㿐@/]<c` @_9$?㿈@/]17K?2H?@^ H 2  #cd @^r 9?@^A@`$*   `'! @x*  2!x@^s"?!@^o /@_C!x @^  p@^  х@^Q㿐@/\㨖3@* 4@LLLchclN  cp ct @^$?h  ?0 x @^$? ` @^'ĒȔ$Ā   @^㿐@] $ " @]@*  @] P'Ԑ@^Ѐ 'А 'Ѐ  'А@^ ?㿐  @?$?@( 8`@]&@ ( @]֔  .. *. 4 , . 2 . 2 . 2 . . 2`. 2`. . 㿐@```          $ ( , 0 4 8 -@ 5کx(0@-:1V( 0@ ) ۆ(0 (@0os(0  -@=_(0@- *( 0@ )* (0 (@?Q(0  -@ `&؆(0@-"=( 0@ )?ք(0 (@ "W5(0  -@"(0@- ?f( 0@ =)P(0 =m! < (0  @=b(0@ 0,@( 0@ (@  Q(0 - :m(0  -@ 5Ą](0@)S( 0@ (@6(y(0 -9Ȇ(0  -@xs(0@)0ֆ( 0@ (@=5C(0 - V(0  -@ *x(0@)?;( 0@ (@ن(0 -#J(0 @ ?B(0@ !}⁄( 0@ gX"(0?yN (0 @)/D(0@㩄( 0@=҆`(0/p(0 @  &߆Ƅ(0@ :I( 0@5;̆(0"(0 @6u49(0@9( 0@蟆(01+e(0 1@ = HD(00@ʿ㗄( 0@5@*㧄(05 ?$9(0 1@VֆÄ(00@#3( 0@5@?}(05!aф(0 1@ O(00@?9( 0@5@(P(05 ᡄ(0 1@=߆₄(00@ /N5( 0@5@ ⻄(05:ᴆ㑄(0 @``&@&`` &`&` 8'H#';j#'&. '  v' ?  @@% `  * #  * #  * #  # ƒ`@@`@ZE  *```. 2. 2. 2.  㿐@/X( # 2  @.@    @ .@ .@ 㿀 ے  㿐@/Xx@Y@@Y " @Yƒ@Z#| . . . .@Yݐ. > 㿀@/XЮ#  N 0'  N x X    N   ` @Yǒ?Г, :`  , :  *??  N N . 쀤97 $ɤN #  @ ( N $:   " ?%  `0 #* ?# *`* @  * * *` `2&@ 㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ @Y7@Y3㿐/W  & #C   € $D` €  $$` $:  `   ?cW?c@` `c2@  @  @K#@@@ `?@  ؖ 2 @Y  @ $@D@`@  $@$@@` $@:  € $D` €  $$` $: `8`y?8 2 6 ,4  *@ @ € #@ C@ `@ €  #@ #@ @ ` #@ : *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 `? @ @"G D   㿈/V(  &"N   $D`  $$` $;   =耤@ ??耥``?c@\`?c@` `c4@  @  @P#@ @@ `?@d Ӥ= @X  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; w``p?  64,  2,@  @ #@C@ `@  #@#@@ ` #@;  * . :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ `? @ @ c "B肦 d ,0@ @4 4=㿐/U$c@?㿐㿠u㿠u. WebX v.7.9 (c) Dimitri KRAVTCHUK (dim) 1995-2010X_PAGE==> WebX: started...Unknown http method-V-X_PAGE ==> X_values(); ==> X_action(); ==> EXIT; Content-Type: text/html X_HOME%s/x.envrTMP_DIR/tmp/WebX%s/x.config/etc/WebX/opt/WebX/apps/WebX.TMP_DIR=%sX_exit( %d );%s/X.%dX_exit: exit...X_ERRMSG: %sREQUEST_METHODERRMSG: locked= %d :: msgfmt= %s

 %s 


Usage: WebX script [-Var Value [-Var2 Value2 [..]]] ERROR: %s %5d.%06d [%6d] %s/X_DEBUG%s/X_DEBUG.%da


%s/X_TRACE%s/X_LOG%s/X_LOG3%s/X_LOG.%dw%s/X_LOG3.%d

 hp: %d  mb: %d m_used: %d =====
áéíóúýÓÁÍÉÚÝàèìòùÀÈÌÒÙäëïöüÄËÏÖÜâêîôûÂÊÎÔÛãñõÃÑÕçǺas;&questi;optioncompilehtmlsqltrapsleepusleepchdirsqlnamesquitshellsetaddincludeerrorunlinkclearcookieforkfilexfilereplacewhileifeliffunctioncallexecreturnsqlsqlexecfopenpopenfclosepclosefgetsfputsvfputsfseekshmatshmdtendcontinuebreakX_fgets:OUT fp->size= %d fp->offset= %d
X_fgets:IN fp->size= %d fp->offset= %d
X_fgets: return( %d )  buff={%s}
cut_cmd: IN= {%s}<@----@>cut_cmd: OUT= {%s}cut_cmd: No more memory...<@quit>X_quit: buff= %s; compile= %d ignore: %d 
%s 

==> MALLOC ERROR! no more memory?? ==> EXIT; 
X_clear_value: name_patt: [%s] X_put_value: name: [%s] value: [%s] fixed: %d cookie: %d  ** %s := %s 
## Fixed Value: %s  ** %s add:= %s 
X_get_value: not found {%s} 
date_YEAR: %sdate_MONTH: %s%.2sdate_DAY: %s%02xX_transvalue: [%s]\t\n\rsh:call:txt2url:url2txt:trim:lower:upper:crypt:dt2str:str2dt:### dt2str ==> %s 
Bad format for dt2str: %s 
Too long name(s) for dt2str: %s 
%ld
	==> call: CALL: [%s] ==> call: OUTPUT: [%s] 
trim_buff: IN= {%s}trim_buff: OUT= {%s}year:Bad format for str2dt: %s 
Too long name(s) for str2dt: %s 
month:day:len:cut:str:word:%dint:printf:ftell:expr:-1env:todayX_ROWSX_DTX_UDTX_DDTX_RANDOMX_SQLCODEX_VERSIONX_INSERT_IDX_NVALX_NFUN%d [%d]X_ERRMSGDIRX_transvalue: no value for: [%s]%ld.%06dEXPR error: %s 
%f<@shmdt>X_shmdt: {%s} compile: %d  ignore: %d 
%s // %s 
0<@shmat>X_shmat: {%s} compile: %d  ignore: %d 
## Reached MAX SHM list value## Cannot get SHM...## Cannot attach SHM...## Cannot assign SHM Variable...<@fseek>X_io_fseek: {%s} compile: %d  ignore: %d 
<@vfputs>X_io_vfputs: {%s} compile: %d  ignore: %d 
stdoutstderr<@fputs>X_io_fputs: {%s} compile: %d  ignore: %d 
<@fgets>X_io_fgets: {%s} compile: %d  ignore: %d 
stdin<@pclose>X_io_pclose: {%s} compile: %d  ignore: %d 
<@fclose>X_io_fclose: {%s} compile: %d  ignore: %d 
<@popen>X_io_popen: {%s} compile: %d  ignore: %d 
<@fopen>X_io_fopen: {%s} compile: %d  ignore: %d 
<@return>X_return: {%s} compile: %d ignore: %d 
X_return: {%s}<@exec>X_exec: {%s} compile: %d ignore: %d 
<@replace>X_replace: {%s} compile: %d ignore: %d 
Bad syntax in REPLACE: %s ...X_replace: NAME: [%s] NEWVAL: [%s]X_replace: NAME: [%s] VAL: [%s] replace: [%s] by: [%s]X_replace: NAME: [%s] not exist or NULL value<@fork>X_fork: {%s} compile: %d  ignore: %d 
<@cookie>X_cookie: {%s} compile: %d  ignore: %d 
%s=HTTP_COOKIE<@clear>X_clear: {%s} compile: %d  ignore: %d 
<@unlink>X_unlink: {%s} compile: %d  ignore: %d 
<@error>X_error: {%s} compile: %d  ignore: %d 
<@>=>+=X_let: {%s} compile: %d  ignore: %d 
>*=>;=>$=>/=>%=>-=>++>--X_let: ### ERROR : did not find a command!!!<@add>X_add: {%s} compile: %d  ignore: %d 
<@set>X_set: {%s} compile: %d  ignore: %d 
<@shell>%s // %s
X_shell: {%s}
Cannot run SHELL: %s 
<@sqlnames>X_sqlnames: buff= %s; compile= %d ignore: %d 
lowercaseuppercase<@chdir>X_chdir: buff= %s; compile= %d ignore: %d 
<@usleep>X_usleep: buff= %s; compile= %d ignore: %d 
<@sleep>X_sleep: buff= %s; compile= %d ignore: %d 
<@sqltrap>X_sqltrap: buff= %s; compile= %d ignore: %d 
OFF_TRANSACTIONSON_TRANSACTIONSOFFON<@html>X_html: buff= %s; compile= %d ignore: %d 
<@compile>X_compile: buff= %s; compile= %d ignore: %d 
<@option>X_option: buff= %s; compile= %d ignore: %d 
fflushoffflushsql_namessql_transactionssql_traponsignalalarmlatin_htmlignore_empty_linesoff_transactionstranslatesigtermon_transactionsdebug## Wrong or unsupported signal name: %s !!sigintsighupUnknown option: %ssigalrmsigpipesigusr1sigusr2sigchld<@include>X_include: {%s} compile: %d  ignore: %d 
rFile SIZE: %d
X_ROOT/X_printfile: %s compile: %d level: %d
X_printfile: DIR-new= %s
Cannot access file: %s 

Cannot access file: %s


X_printfile: DIR-curr= %s ./%sLAST 100 CHARS ===> %s ===> Cannot open file: %s

Cannot open file: %s


Reused, File SIZE: %d <@end><@continue>X_notfound: [continue] ==> %d <@break>X_notfound: [break] ==> Continue= %d X_notfound: compile: %d ignore: %d ## Continue: %d Break: %d <@call>X_call: {%s} compile: %d ignore: %d CALL: Unknown function name: %s ,X_call: add argument name: %s value: {%s} X_call: analyse arg_string: %sX_call: no more values...<@call> %s( %d ) ==> SIGTRAP call: CALL: [%s] <@call> %s ==> SQLTRAP call: CALL: [%s] none### SYSTEM ERROR: more than 10 DB Session in proccess!X_BASEX_USERX_PASSWD### Cannot open database: %s ERR: %d SQLERR: %sc%d### Database name was not specified...%24sdisconnectbegincommitrollback### DATABASE Query ERROR: QUERY: %s ; ### ERRMSG: %s ### DATABASE Query ERROR: QUERY: %.200s ; ### ERRMSG: %.200s <@sqlexec>X_sqlexec: {%s} compile: %d ignore: %d X_sqlexec: query: %s <@function>X_function: {%s} compile: %d ignore: %d ,)%sX_function: add argname: %s X_while_values: name: %s compile: %d X_while_words: name: %s sep: {%s} compile: %d X_while_loop: compile: %d <@while>X_while: {%s} compile: %d ignore: %d wordsvaluesUnknown option: %s in WHILE...Fetch: %d values ** SQL fetch row: %d columns Name: %s Value: %sX_found: cid: %s compile: %d X_sqlnames### DATABASE QUERY ERROR: %s ### DATABASE QUERY ERROR: %.200s <@sql>X_sql: {%s} compile: %d ignore: %d selectshowexecuteX_sql: query: %s <@xfile>X_xfile: {%s} compile: %d ignore: %d X_xfile: file name is too long: {%s} aX_xfile: Cannot open file: {%s} X_xfile: outpass MAX open for file: {%s} <@file>X_file: {%s} compile: %d ignore: %d X_file: Cannot open file: {%s} <@if><@elif>X_if: {%s} compile: %d ignore: %d cmp!cmpicmp!icmpfcmp!fcmpfmt%lfX_if: try as line command: {%s} filled!filledEOFFilled... Filled? {%s} NULLafter VAL{%s} = %s X_if: [continue] ==> %d X_if: [break] ==> Continue= %d <@else>X_if: {%s} <@else> !fmtintfloatdateUnknown option in FMT: %s !EOFexist!existisDir!isDirisFile!isFile%s/x.pageregular_file: %s ==> ? regular_file: %s ==> OK. X_PAGEdef: X_PAGE: %sX_ERRORdef: X_ERROR: %sdef: X_PAGEInvalid %s value: %s ///./...%s/%sHTTP_HOSTSERVER_NAME%s/x.configrshell:00%s%s%s%sX_ROOT ===> {%s} X_ROOTX_HOME%dX_PIDX_PROGholdX_BASE==> Server: %s Root: %s Base: %s Hold: %d ### Not found X_PAGE value...WebXX_values: entry shellSERVER_PORT00%s:%sCannot open X_HOME config file: %sNo X_ROOT configuration for SERVER: %s X_ServerCOOKIESSet-Cookie: %s=%s; path=/; expires=31-Dec-2037 23:55:00 GMT Set-Cookie: %s=%s Set-Cookie: %s=NULL; path=/; expires=Wednesday, 21-Aug-1996 01:21:36 GMT Del-Cookie: %s X_SessionCOOKIESSet-Cookie: %s=%s; path=/;                       ! &%lld%Lf%llo%llxstrcutchcharstrlenX_exec_call: name= %s args= %s EXEC: Unknown function name: %s cutstr: fname= %s args= %s cutstr: name= [%s] str= [%s] chchar: fname= %s args= %s strlen: fname= %s args= %s strlen: STRname= [%s] LENname= [%s] %d%04d-%02d-%02d### No memory...||&&X_user_cmp( %s, %s, %s )likevlike!like!vlike>=≥>=<=≤<=!===>><<=Unknown CMP operator: %s X_user_icmp( %d, %s, %d )Unknown ICMP operator: %s X_user_fcmp( %f, %s, %f )Unknown FCMP operator: %s SSss%dMImi%02dHHhhDDddJJjjMMmm%04dYYYYyyyyAAAAaaaaYYYyyyAAAaaaYYyyAAaaAVL_search key: [%s] AVL_remove key: [%s] AVL_insert key: [%s] X_heap_new: hp: %d mb: %d m_used: %d X_heap: NO MEMORY...X_heap_alloc: hp: %d size: %d X_heap_info hp: %d mb: %d m_used: %d WARNING: heap_alloc( size= %d ) rmalign ==> mb: %d m_used: %d rmalign: mb: %d m_used: %d X_heap_free: %d X_heap_reduce: %d -X_database: "%s"NULLendX_noselect_sql: QUERY: %s### ERROR...X_select_sql: cursor: %s cmd: %d ### No more empty cursors!!! X_select_sql: ### Invalid Cursor ID: %d ### No memory VVAL: %s PREPARE QUERY: %s### CURSOR: %s [ID: %d] is already used...### NO MEMORY!!!%.70s REQUEST_METHODPOSTThis script should be referenced with a METHOD of POST. CONTENT_TYPEapplication/x-www-form-urlencodedCONTENT_LENGTHfmakeword: [%s] makeword: name= [%s], val= [%s] POST: CONTENT_LENGTH= %dThis script can only be used to decode form results. CONTENT_TYPEapplication/x-www-form-urlencodedREQUEST_METHODPOSTGETTMP_DIR/tmpw+%s/post.buff.%dTAKE: %s name="filename="NAME: %s VALUE... VALUE: [%s] NULLSEP: %s SIZE: %d %s/post.inputE_POST_parser: END: %d values FILE-src: [%s] FILE: [%s] %s/%s..%d.%dwBroken Input...PATH_INFOREQUEST_METHODGETQUERY_STRINGThis script should be referenced with a METHOD GET.
WARNING: Value value size is over %d!!! [cut]...
%%%02x&;`'"|*?~<>^()[]{}$\ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqrstuvwxyz{|}~ݬSSL-ModedisablePGSSLMODEsslmodeBackend-Debug-OptionsPGOPTIONSoptionsBackend-Debug-TTYPGTTYttyDatabase-Port5432PGPORTportDatabase-Host-IP-AddressPGHOSTADDRhostaddrDatabase-HostPGHOSThostDatabase-NamePGDATABASEdbnameConnect-timeoutPGCONNECT_TIMEOUTconnect_timeout*Database-PasswordPGPASSWORDpasswordDatabase-UserPGUSERuserDatabase-ServicePGSERVICEserviceDDatabase-AuthtypePGAUTHTYPEauthtypegeqoPGGEQOclient_encodingPGCLIENTENCODINGtimezonePGTZdatestylePGDATESTYLEallowpreferrequireinvalid sslmode value: "%s" sslmode value "%s" invalid when SSL support is not compiled in could not set socket to TCP no delay mode: %s could not connect to server: %s Is the server running locally and accepting connections on Unix domain socket "%s"? could not connect to server: %s Is the server running on host "%s" and accepting TCP/IP connections on port %s? ???%d%s/.s.PGSQL.%d/tmpcould not translate host name "%s" to address: %s could not translate Unix-domain socket path "%s" to address: %s invalid connection state, probably indicative of memory corruption could not create socket: %s could not set socket to non-blocking mode: %s could not set socket to close-on-exec mode: %s could not get socket error status: %s could not get client address from socket: %s out of memory could not send startup packet: %s expected authentication request from server, but received %c unexpected message from server during startup invalid connection state %c, probably indicative of memory corruption PQcancel() -- socket() failed: PQcancel() -- connect() failed: PQcancel() -- send() failed: PQcancel() -- no cancel object suppliedPQrequestCancel() -- connection is not open %s/pg_service.confPGSYSCONFDIR/apps/pgsql/etcrERROR: service file "%s" not found ERROR: line %d too long in service file "%s" ERROR: syntax error in service file "%s", line %d missing "=" after "%s" in connection info string unterminated quoted string in connection info string invalid connection option "%s" connection pointer is NULL set client_encoding to '%s'%slocalhostPGPASSFILE%s/%s.pgpassWARNING: password file "%s" is not a plain file WARNING: password file "%s" has world or group read access; permission should be u=rw (0600) PGRES_FATAL_ERRORPGRES_NONFATAL_ERRORPGRES_BAD_RESPONSEPGRES_COPY_INPGRES_COPY_OUTPGRES_TUPLES_OKPGRES_COMMAND_OKPGRES_EMPTY_QUERYNOTICE%s pqSaveParameterStatus: '%s' = '%s' client_encodingstandard_conforming_stringsonserver_version%d.%d.%dcommand string is a null pointer statement name is a null pointer function requires at least protocol version 3.0 no connection to the server another command is already in progress length must be given for binary parameter unexpected asyncStatus: %d COPY terminated by new PQexecCOPY IN state must be terminated first COPY OUT state must be terminated first no COPY in progress \. connection in wrong state invalid ExecStatusType codecolumn number %d is out of range 0..%drow number %d is out of range 0..%dparameter number %d is out of range 0..%dINSERT 0123456789DELETE UPDATE FETCH MOVE COPY could not interpret result from server: %sincomplete multibyte character out of memory \%03oFrom backend> %c To backend> %c From backend> "%s" To backend> "%s" From backend (%lu)> %.*s To backend> %.*s integer of size %lu not supported by pqGetIntFrom backend (#%lu)> %d integer of size %lu not supported by pqPutIntTo backend (%lu#)> %d cannot allocate memory for output buffer cannot allocate memory for input buffer To backend> Msg %c To backend> Msg complete, length %u connection not open could not receive data from server: %s server closed the connection unexpectedly This probably means the server terminated abnormally before or while processing the request. could not send data to server: %s timeout expired socket not open select() failed: %s PGCLIENTENCODINGinvalid setenv state %c, probably indicative of memory corruption defaultSET %s = DEFAULTSET %s = '%.60s'begin; select version(); endPostgreSQL server_versionbegin; select pg_catalog.pg_client_encoding(); endselect pg_client_encoding()client_encodingPGCLIENTENCODINGSQL_ASCIIinvalid state %c, probably indicative of memory corruption message type 0x%02x arrived from server while idleunexpected character %c following empty query response ("I" message)server sent data ("D" message) without prior row description ("T" message)server sent binary data ("B" message) without prior row description ("T" message)unexpected response from server; first received character was "%c" out of memory for query result : BEGINCOMMITROLLBACKSTART TRANSACTION*ABORT STATE*\. out of memory no COPY in progress %slost synchronization with server, resetting connection protocol error: id=0x%x message type 0x%02x arrived from server while idleserver sent data ("D" message) without prior row description ("T" message) unexpected response from server; first received character was "%c" message contents do not agree with length in message type "%c" lost synchronization with server: got message type "%c", length %d unexpected field count in "D" message out of memory for query result %s: %s: at character %sDETAIL: %s HINT: %s QUERY: %s CONTEXT: %s LOCATION: %s, %s:%sLINE %d: ...out of memory PQgetline: not doing text COPY OUT \.no COPY in progress %sprotocol error: id=0x%x userdatabaseoptionsdefault???%s[local]N`bKUpp0J   < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY`   * . j o 0*0/00 #windows950windows949windows936windows932windows874windows866windows1258windows1257windows1256windows1255windows1254windows1253windows1252windows1251windows1250win950win949win936win932win874win866win1258win1257win1256win1255win1254win1253win1252win1251win1250winvsciiutf8unicodeuhctcvn5712tcvnsqlasciisjisshiftjismuleinternalmskanjilatin9latin8latin7latin6latin5latin4latin3latin2latin10latin1koi8rkoi8johabiso88599iso88598iso88597iso88596iso88595iso88594iso88593iso88592iso885916iso885915iso885914iso885913iso885910iso88591gbkgb18030euctweuckreucjpeuccnbig5altabcGB18030UHCGBKBIG5SJISWIN1257WIN1255WIN1254WIN1253WIN1250ISO_8859_8ISO_8859_7ISO_8859_6ISO_8859_5WIN1252WIN1251KOI8WIN874WIN866WIN1258WIN1256LATIN10LATIN9LATIN8LATIN7LATIN6LATIN5LATIN4LATIN3LATIN2LATIN1MULE_INTERNALUTF8JOHABEUC_TWEUC_KREUC_CNEUC_JPSQL_ASCIIencoding name too long Unknown hostHost name lookup failureInvalid argumentAddress family not supportedNot enough memoryClass type not foundSocket type not supportedUnknown server error%s%dSCM_CRED authentication method not supported out of memory Kerberos 4 authentication not supported Kerberos 5 authentication not supported fe_sendauth: no password supplied fe_sendauth: error sending password authentication authentication method %u not supported 0123456789abcdefmd5XtxD p (x0P(@`8pHPX@P pX(PhHHHݔ(P8x0HPp(PX(lݘPhx0`@xX0X(p 0hPX8(pxHˆ (@P`pÀ8Ð@ØPàXðø`hpx8Ppˈˠ(Ẍ̰(\hݜ0$ tp00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0s wX wt1d $ o.oG(o4GG oow{{{ {0{8{H{P{`{h{x{{{{{{{{{{{||| |(|8|@|P|X|h|p|||||||||||}}}} }(}0}8}@}H}P}X}`}h}p}x}}}}}}}}}}}}}}}}~~~~~ ~(~0~8~@~H~P~X~h~p~~~~~~~~~~~(0@HPX`hpx      (08@HP X!`"h#p$x)%&'(((P3X4`5xp`P@(  (`-XPH80(((XH@0DhXH8 7$7l7tE888E9::F9,9H9F:<hAxJtABC`HCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpCDD HpD DTHxDDIDDI`E E(IELEJxph#`XPH@&8$(  ȸ Ȩ ȘȈxhX PH@80(     """ǰǨǘǐ%Ljǀxph`XPH@ 80!( "$%#ƸƨƘ ƈx!hXH8"($%#Nʸʰʨʘʐʈ ʀ x p h `XPH@80( ɸɰ ɨ!ɠ"ɘ#ɐ$Ɉ%ɀ&zR|P oH - zR|P s - p$1dG(GGGM( wX wt w 0 X0dlt !"t&/0:w IYM tN\ TNP 0dltoN O T X!+X4@hEpJlQtX\\`ams} $<( X@0 dhh\  @dg\  $6;A KhX V^(`dxkr$y |` ((H x @2 2  (   P (T2X=PGX Lh Q80[ bmۈ r~\\ۨ0C  t`xhl|pdVT R O  &+1;FOVak'hs(hzl    xD     x d 8  'D : A H O Vp ] d k r( yx 0  P (  @ `  8  p   H        P   ! ( / 6X = D K@ R Y ` gP n up |  X  (     P   h  H D 0  H@   " X 1 @ O alsH(  D 8 ݔư lp Hl 00    , 2ǔ  ?| P W ^ e l (   s zP   8 x 0  H  P   p /   (   P   X    Ҡh Ѥh ݌ 4(l <$@ Kݘ ^ h  uP {h x      0 ,`  L P ^@ ex X     /0 X   (    up {      0 h , T 0 (, WP ^ e X        8  /    (  p   , T  '!0p  8$$ ux {  H ˆ     ,( Ml  \+ X qdp ^ e@  P  `  p  À 8 /Ð @ Ø P à X ð ø H,  ` .T 1  58 3p u` {h p 20 6l   < :  59 M9, e8 }7$H EL` D  JtH I\ Hx H\ x E($ D$ $D 2D 4 @Ax N> YCH rE$ Gt F F` E E 7$ =$D 7 D$ DT8 (C`\ 7<8 F<@ U: d9H8 s88 7l ?Tl Hp Ah D <D  I/< \Lh c1 rP~wt ,  V 5 Hh LPlH '  d Ӭ?\ ( c@ X a@!_D V8 "0.<d 9t>  J\ TX ^m j\< rvP وD Ϙ x@ Ԝ2T S| L`  @L .|@ <, xoH %֔/X$ 7Ұ>pF< ZҌa nV\ u {_` tt W Ռz 1 İ Xx` (Z y   ; $M(t +9Xh 7L C S@]z@T apj# z4  .T( 0` N\   Ҙtհ  $kT )0$ &@TF684 XX< c hO( wՀ~Ԅ{x( LL ӸxH H  \  ь 4X 0 2 /4, 6Rt AHY(8]7$ kpP@ } ͼ ЈH ΰP  d d !T D( 7 $( $p 30 :ָBD L1@ [M,< r ys dH Ljd  4 ( 8 W \L0 , |(  * bp!/ 0u  8[T J TX[1 eOd, yƌ ¼ $`  ҜX դtx ` 9h t x \| bP 0 2Xl tp` ;ȜP Lb _Ԩep lOH |StX  %T$ S M4  TP 1TL i0l o8$Nd -ݜ <O0 EX< M1  [8 p(xH~'x \y8P _ |4 8 Zl 0  ֬XL l{0  wd L "Bd 0,:tA HR@t S [0g2( p< 9|i$ p,O< ʬh  $s4 e@| 3 l CPH X    Ҁ /  >8 NYX g& ymh0 Ԑ,l ,m\  8 kt@ t Dè @<S h ( 0 4@ IMh4 bt0 tl  t   k, $8np Ӕ\ t (  r  <\$ 20` /@ @T O:(\ Y_D f xڸh u<d ( \Dl " d TH H $8 Z ND  Դ$ #l 1  G$, S+DL iw v8t 6 DL  m \ NT H XX  Ҥ  {\ ռ"`  /.0 ? E NwP R` b| n6h x/ 4h 4L $ %i _H \@ H  0 L `wŐ  x, L\ 4 )\\ 73 > Jֈ RW  z a>hX nlH b   ԜL .(   /( L  !P! n !`0 !dut !%  !11 !E !P W< !Z՘4!cҼ!jLp\ !}ՀL !p !t !` !1D 8 L !T!Th !PL !!$ !dP< !"X " "%` #ODL "/0 ":Ð "F "Mp"] "ijt "u,"|8"P@ "Z4 "$ "ňl "L h"֠"  "X""sX "4( "@H1 "Ld #Ӡ#H Z #p#"bH#*L #= #FAl #Rh#ZS($ #e #zL  # h #wX #s #p ##H #k #8 #  #[\  #HH #`$0` $_\D $SL( $'<L $.ߜ( ( $>T $S$ $_l\ $i $zL $$0$<0, $Kӈ$  > $LP $ $4d $, d$P u4 $^d %f % L%\ %%d8 %12t %=´( %QJD ../bin/WebX.pgSQLcrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1chp.0__JCR_LIST__WebX.cX_checkpageprinted.0lib_ACT.clib_ENV.cbuff_env.0lib_MSG.clocked.0lib_TRACE.cfp.2fp.4Init.3Init.5F.0tp.1lib_TRANS.ckey_pX_sqlFUNCSignalFUNCDO_fflushc_freeContinueBreakTRAPfuncx_OPENX_sqllineX_lenX_get_cidHTML_tablevel.6Init.4scan_treex_SHMX_sqlTRAPX_USER_newHTMLReturnX_sqlcaseIgnoreEmptyX_get_basestr.2X_sqlcodecount_treeX_linesx_CMDinit.0init.3init.7ContinueMY_fflushX_sqlTRANSHTML_char.1tp.5cut_cmdlib_VAL.cbase.1pid.2X_ROOT.0EXPR_parser.cyydefgotoyydefactvalue_floatyycheckyytableyystosyytranslateyypgotoEXPR_INITEXPR_FLOATEXPR_BUFFyyr1yyr2value_intyypactlib_EXEC.cExeclib_check.ccurr.1cache.0daylong.2FMdate.cSETdateHoursOkMinutesYearMonthSecondsDaySkiplib_AVL.cavl_searchavl_removeavl_insertlib_TOOLS.cX_heap.clibpgSQL.cfreePGconnx_CURlibpost.clibEpost.clibget.cutil.cdim_PATT.cdim_CMP.cASCII.1Init.2Alpha.0fe-connect.cinternal_cancelconnectOptions1connectOptions2conninfo_getvalquery.90.LLC2.LLC5.LLC6.LLC8gcc2_compiled.defaultNoticeReceiverconnectDBCompletedefault_threadlock.LLC90.LLC80.LLC70.LLC60.LLC50.LLC91.LLC81.LLC71.LLC61.LLC51.LLC31.LLC21.LLC11.LLC92.LLC82.LLC72.LLC62.LLC52.LLC93.LLC83.LLC73.LLC63.LLC53.LLC94.LLC84.LLC74.LLC64.LLC54.LLC34.LLC24.LLC95.LLC85.LLC75.LLC65.LLC55.LLC15.LLC96.LLC86.LLC76.LLC66.LLC56.LLC46.LLC97.LLC87.LLC77.LLC67.LLC57.LLC37.LLC27.LLC88.LLC78.LLC68.LLC58.LLC18.LLC89.LLC79.LLC69.LLC59.LLC49.LLC39.LLC29makeEmptyPGconnconnectFailureMessagedefaultNoticeProcessorconninfo_parseconnectDBStartconnectNoDelaypwdfMatchesStringPQconninfoOptionsEnvironmentOptionsclosePGconnPasswordFromFileparseServiceInfofe-exec.cstatic_client_encodingPQexecStartPQescapeStringInternalPQsendQueryGutsparseInputcheck_tuple_field_number.LLC9PQexecFinishPQsendQueryStart.LLC40.LLC30.LLC20.LLC10.LLC41.LLC42.LLC32.LLC22.LLC12.LLC43.LLC33.LLC23.LLC13.LLC44.LLC14.LLC35.LLC25.LLC36.LLC26.LLC16.LLC17.LLC38.LLC28.LLC19check_param_numbercheck_field_numberPQescapeByteaInternalbuf.130PQsendDescribestatic_std_stringsfe-misc.cpqSocketPoll.LLC0.LLC1.LLC3.LLC4.LLC7pqSocketCheckpqPutMsgBytespqSendSomefe-protocol2.cgetNotifygetRowDescriptionspqGetErrorNotice2getAnotherTuplecheckXactStatusfe-protocol3.cgetReadyForQuerygetParamDescriptionshandleSyncLossbuild_startup_packetgetParameterStatusreportErrorPositiongetCopyStartpqexpbuffer.cfe-secure.cip.cgetnameinfo_unixgetaddrinfo_unixrange_sockaddr_AF_INETwchar.cpg_johab2wchar_with_lenpg_euctw2wchar_with_lenpg_euccn2wchar_with_lenpg_euckr2wchar_with_lenpg_eucjp2wchar_with_lenpg_ascii2wchar_with_lenpg_gb18030_mblenpg_latin1_dsplenpg_utf8_verifierpg_big5_verifierpg_sjis_verifierpg_mule_verifiercombining.50pg_uhc_dsplenpg_gbk_dsplenpg_big5_mblenpg_sjis_mblenpg_utf_dsplenmbbisearchpg_latin12wchar_with_lenpg_gb18030_dsplenpg_johab_verifierpg_euctw_verifierpg_euckr_verifierpg_eucjp_verifierpg_ascii_verifierpg_utf2wchar_with_lenpg_euc2wchar_with_lenpg_big5_dsplenpg_sjis_dsplenpg_mule_dsplenpg_johab_mblenpg_euctw_mblenpg_euccn_mblenpg_euckr_mblenpg_eucjp_mblenpg_ascii_mblenucs_wcwidthpg_latin1_verifierpg_mule2wchar_with_lenpg_latin1_mblenpg_johab_dsplenpg_euctw_dsplenpg_euccn_dsplenpg_euckr_dsplenpg_eucjp_dsplenpg_ascii_dsplenpg_uhc_verifierpg_gbk_verifierpg_gb18030_verifierutf2ucspg_uhc_mblenpg_gbk_mblenencnames.cclean_encoding_name.LLC117.LLC118noblock.cpgstrcasecmp.cthread.cstrlcpy.cgetaddrinfo.cfe-auth.cpg_password_sendauthpg_local_sendauthpqsignal.cmd5.ccreatePaddedCopyWithLengthcalculateDigestFromBufferbytesToHexdoTheRoundshex.8inet_aton.clibgcc2.c__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START___iobpg_strncasecmpPQdbX_valuesPQisthreadsafestrrchrX_io_fopenenlargePQExpBufferpqPutspqsecure_closePOST_errmsg_finipqWriteReadyAVL_searchStrLenPQgetlineX_HOMEmainyyparseX_noselect_sqlmallocX_user_icmpPQbackendPIDX_databasePQfreeNotifylowercasepg_freeaddrinfosigemptysetpqPutnchar_enddim_EXEpattPQntuplesPQprepareHTML_stringPQresetX_transvaluePQgetvaluePQfnPQparamtypeX_io_pclosepg_freeaddrinfo_allstrlcpypg_encoding_verifymbX_FileinitPQExpBuffer__ctypemktimepqSaveParameterStatusX_shmat__divdi3vsnprintfPQtracestrcatfopen64PQsetErrorVerbosityaccessX_printvalueX_exitX_setX_heap_newpqPacketSendpg_gai_strerror_Q_subescape_shell_cmdpqsecure_destroyX_chdirrecvplustospaceh_errnogetpidpg_fe_sendauthputenvX_forkX_errorX_CMPpattX_startX_check_intPQftablecolpqGetlineAsync2vsprintfrind_environpqGetlineAsync3X_BASEpqAddTupleX_callcreatePQExpBufferpqCatenateResultErrorpg_char_to_encname_structX_compileX_io_fputsgetcwdX_rowcountX_fflush_Q_qtosX_translinesrandGetMethodappendPQExpBufferStrX_shmdtpg_range_sockaddrAVL_insertatoipg_set_noblock_Q_mulatolGETenvmemmovePQregisterThreadLockpg_encname_tblX_sqlexecPQconndefaultsstrdupX_addPQgetCancelPQconnectPollPQbinaryTuplesPQescapeStringPQflushpg_getnameinfo_allchcharpg_tolowermemsetpqsecure_open_clientX_check_float.divpg_set_blockpqGetncharPQgetCopyDataPQresStatusPQgetlineAsync__deregister_frame_infopqCheckOutBufferSpacepqGetCopyData2pqGetCopyData3PQclientEncodingX_check_dateX_returnPQconnectStart_etextstrtoulPQfreemempqsecure_writepg_encoding_max_lengthatexitGET_parserPQnotifiesgetpwuidX_sqltrapPQmblenPQresetStartX_while_loopX_io_fcloseAVL_remove_Q_qtoiPQsocketsendpqPutMsgEndPQuserPQprotocolVersionPQmakeEmptyPGresultstatPQdsplenpg_fe_getauthnamePQoptionsyycharPQinitSSLpg_char_to_encodingX_sleepstrchrX_shellpqSaveErrorResultX_optionX_trans_printfile_edata_Q_qtolldate_DAYPQparameterStatusX_todaypqsignaldate_MONTHX_arg_string_sepX_ERRMSGPQsetNoticeReceiverPQcancelPQdescribePortalX_heap_reduceX_io_popenpqGetcpg_encoding_to_charstat64pqGethostbynamePQoidValueX_set_cookiesX_actionpg_valid_server_encodingX_includeX_INSERT_IDsystemTMP_DIRpqGetsappendBinaryPQExpBufferX_clear_valueX_dt2strpg_wchar_tableX_avlcmpPrintTMpqsecure_readpqCheckInBufferSpaceconnectTraceyyerrorX_fgetsPQuntracePQerrorMessageX_trace__clz_tabgethostbynamestrspnPQsetdbLoginshmgetdim_FREEpatt_PROCEDURE_LINKAGE_TABLE_unescape_urlPQgetisnullpg_mule_mblenx_BUFFERS_Q_divPQportpg_toupperX_whileX_BASE_holdPQgetsslPQtransactionStatussql_errorX_str2dtPQputCopyDataX_cryptGetDDTX_select_sqlX_exec_callPQsetClientEncodingPQendcopyPQconninfoFreeX_sqlPQcmdTuplesstrcmp.umul__register_frame_infoX_while_valuespqFunctionCall2setsockoptPQsendPreparepqFunctionCall3X_usleepX_free_allX_io_fseekdim_ORpattfreadX_free_cidX_commandX_replacepg_md5_hashinet_ntoaisdigitX_sqlnamesgetsocknameX_eofX_envPQclearPQserverVersionPQsetNoticeProcessorPQresultErrorMessagepg_valid_client_encodingpqGetErrorNotice3X_add_valueX_printfilepqParseInput2pqParseInput3CheckEnctypeMethodpg_enc2name_tbl__muldi3strstrpqWaitTimedPQnfieldsX_ERRORX_unlinkGET_pathsigactionPQhostpg_getaddrinfo_allpqSetResultErrorPQconsumeInputX_CMPexecftellPQpasspg_encname_tbl_szPQsetnonblockingstrcpypollfmakewordpqGetline2pqGetline3PQcmdStatuspg_getaddrinfoX_while_wordsPQescapeByteaConnX_arg_stringfcntlX_headermemcmpPQputlinefgetcE_POST_parserpqBuildStartupPacket2PQputnbytespqBuildStartupPacket3_lib_versionX_notfoundpg_sockaddr_cidr_maskDebugPQfsizeX_get_valueX_date_infoPQsendQueryPreparedvfprintfX_debugPQrequestCancelstrlenPQsendQueryParamsdim_LOADpattlocaltimeX_heap_alloctermPQExpBufferX_letpqGetIntx2cX_default_namesPQoidStatusX_get_intprintfPQExpBuffer__dso_handlepqEndcopy2PQfformatpqEndcopy3PQescapeBytea.udivPQttyPQsendDescribePrepared_GLOBAL_OFFSET_TABLE_PQfmodmemcpypg_encoding_mblengetsockoptpqResultAllocstrcutPQsendQuerygeteuidpg_getnameinfopg_utf_mblenpqSaveMessageFieldX_heap_freepqPutMsgStartPQftabledestroyPQExpBufferPQstatus_Jv_RegisterClasses__flsbufresetPQExpBufferpg_mic_mblenX_found_Q_addX_putcharPQisBusystrncatpqReadReadypqsecure_initializepqReadDatavp_SYMcmp_Q_lltoqsscanfpg_encoding_dsplenPQftypeX_io_fgetspgresStatuspqGetHomeDirectoryappendPQExpBufferCharstrncpypqSetenvPollPQfnumbercallocX_clearX_finishX_stdoutPQescapeStringConnX_check_namePQnparamsX_functionPQgetResultX_htmlpg_g_threadlockX_io_vfputsX_put_valueX_PAGEX_fppg_strcasecmpX_take_stringPQresetPollPQexecParamsX_cookiereallocpqWait_DYNAMICstrtoldate_YEARPQfinishCookiePQexecPreparedstrncmpPQgetlengthfwriteyynerrsPQresultErrorFieldpqPutIntX_user_fcmp_Q_stoqpqStrerrorPQsendDescribePortalPQfreeCancelX_xFile_init__moddi3PQresultStatusgetenvPQfnamepg_md5_encryptpqResultStrdupX_ifPQencryptPasswordpqFlushyylvalappendPQExpBufferuppercasepqGetpwuidPQexecPQunescapeByteapqPrepareAsyncResultX_error_cidinet_atonpqInternalNoticeX_execalarmrandomX_user_cmp.remPQisnonblockingPQdescribePreparedPQputCopyEndpqPutcpqClearAsyncResultX_signalX_search_commandX_quitgettimeofdayPQenv2encodingPQconnectdbEXPR_parserpqHandleSendFailurepg_utf8_islegal@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic 123647-02 Feb 2008as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: Sun Compiler Common 10 Patch 09/04/2007 GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.489% : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; I 4: ; I.1@ 41 .? : ; ' I@ : ; I .? : ; I .? : ; I< 41.1< .: ; ' I@ 4: ; I .? : ; I< .? : ; I< !.? : ; I< "!I/#.1$1% U& U'1( ).? : ; I *.? : ; I +4: ; I? < ,4: ; I?  % $ > $ >  I.? : ; I@ .? : ; I< 4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; I@ 4: ; I 4: ; I 1 41  U U.? : ; I<  I!I/.: ; I .? : ; ' I@ : ; I .? : ; I< .? : ; ' < I!I/ 4: ; I? < %  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > .? : ; ' I@ : ; I  4: ; I4: ; I .? : ; I<  .? : ; I< 4: ; I? < I!I/%  : ; I : ;  : ; I8  : ; I 8 $ >  I $ > I !I/ : ;I ' II : ;  : ; .? : ; ' I : ; I4: ; I.1@ 1 41 .? : ; ' I@ : ; I 4: ; I .111   .? : ; I< !.? : ; I< ".? : ; ' I #.? : ; I< $ U%.? : ; I< &4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ;  : ; I8 ' II : ;  : ; : ;I8 .? : ; ' I : ; I4: ; I .1@ 1 41  : ; I.? : ; I< .1< .: ;' I@ !: ;I ": ;I #4: ;I $.? : ; I< %1&1'1( U).? : ;I< *!I/+.: ; ' I ,.? : ;' I -: ;I..? : ;I< /.1< 04: ;I1.: ;' I 2: ;I34: ;I4.? : ;I< 5 6417.? : ;' I@ 8.? : ;I 9.? : ;' I :.? : ;' I@ ;.? : ;I <.? : ;I@ =4: ;I >.? : ;' I< ? U@.? : ;I< A B.1C.? : ;' I D.? : ;' I E.? : ;' I< F.? : ;' I< G.? : ;I@ H.? : ;I I4: ; I? < J4: ; I K4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > I !I/  : ;I  : ; ' II : ; .? : ; ' I@ : ; I 4: ; I 4: ; I U.? : ; I< 11 U41 1 .? : ; I< !I/ .: ; ' I !: ; I"4: ; I #.? : ; I< $: ; I%.? : ; ' I@ &.? : ; ' I< ' (.? : ; I< ).? : ; ' I< *.? : ;I@ +4: ;I ,.? : ;I< -.? : ;I< .4: ; I? < % $ > $ >  : ;  : ; I: ; I: ;I.? : ; I .1@ .? : ;' I@ 4: ;I : ; .1  4: ;I 4: ;I.? : ;I< 141  UI!I/  I.: ; I 4: ; I.? : ; I< .? : ; ' I@ : ; I 4: ; I !I/!&I"4: ;I?  % $ > $ >  I : ;  : ; I8 I : ; I .? : ; ' I@ : ; I 4: ; I .? : ; I< 4: ; I.? : ; I< I!I/ 4: ; I? < % $ > $ > : ; I : ;  : ; I8  I  : ; .? : ; ' I : ; I 4: ; I .1@ 1 41 .? : ; ' I@ : ; I 4: ; I .? : ; I< 11  U1I!I/ .? : ; ' I@ .? : ; ' I< I.? : ; I< U!.? : ; I< ".? : ; I< #.? : ; ' I< $ %.? : ;' I@ &: ;I '4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.: ;' I@ : ;I 4: ;I 1 1 U41 1.: ; ' I : ; I4: ; I4: ; I.? : ; ' I< I .? : ; ' I< I!I/ &I .? : ;I@ : ;I .? : ;' I@ 4: ;I !4: ;I"4: ; I % $ > $ >   : ;  : ; I8  I: ; I ' I I .: ; ' I@ : ; I U4: ; I 11 4141 11 .: ; ' : ; I4: ; I4: ; I  U.: ; ' I .: ;' I : ;I4: ;I  !.1@ " #.? : ;' I $.? : ; I< %&.1< '.? : ;' I@ (: ;I ).? : ; ' I@ *4: ; I? < % $ > $ >  I.? : ; ' I@ : ; I 4: ; I .? : ; ' I : ; I 4: ; I  1 .: ; ' I .1@ 1 41 11  U.: ; ' I % $ > $ >  I  : ;  : ; I8 : ; I .? : ; I@ 4: ; I .? : ; ' I< I .? : ; I<  .? : ; I<  .? : ; I< .? : ; ' I@ : ; I  U.? : ; ' I< 11 U41 .: ; I : ; I4: ; I.? : ; I< 4: ; I? < % $ > $ >  I : ;  : ; I8 : ; I : ; <  : ; I !I/ .? : ; I@ : ; I 4: ; I 4: ; I.? : ; I< .? : ; I@ .? : ; ' I@ .? : ; I< 11 U41 .? : ; I< !I/.: ; ' I : ; I.? : ;' I@ : ;I 4: ; I? < !4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; ' I@ : ; I 4: ; I 4: ; I.? : ; ' I< I.? : ; I<  U.? : ; ' I< &II!I/ 4: ; I? < 4: ; I?  % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; .? : ; I@ .? : ; ' I< I &I4: ; I .? : ; ' I@ : ; I 4: ; I.? : ; I< .? : ; ' I<  U11 41  UI!I/!I/ &.: ; ' I : ; I! "4: ; I? < % $ >  : ;  : ; I8  I: ; I.? : ; ' I@ : ; I 4: ; I .? : ; I<  .? : ; ' I< I&I4: ; I.? : ; ' I<    4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > .? : ; ' I@ : ; I 4: ; I 4: ; I .? : ; ' I< I.? : ; ' I<  &II!I/&.? : ; ' I : ; I.1@ 1 41 .? : ; ' @ 1 11.? : ; ' I@ .? : ; I< !% $ > $ >   : ;  : ; I8  I: ; I .? : ;I : ;I .? : ;I<  .1@ 1 .1< .? : ; I@ : ; I 4: ; I 4: ; I 4: ; I U.? : ; ' I< I1.? : ;I@ : ;I : ;I  .? : ; I@ : ; I % $ > $ > .? : ; I@ : ; I 4: ; I 4: ; I I I !I/ % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U.: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; II!I/ &I4: ;I?  SNGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)WebX.c/SOFT/WebX/WebX/src__FILEpc__FILE_cnt#c#_ptr$j#_base&j#_flag'p# _file(p# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intpunsigned charlong long intFILEJblong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _5 ino_t Jblkcnt_t blksize_t long double mode_t mJ gid_t y dev_t J nlink_t Jtimespec&tv_sec'#tv_nsec(#timestruc_t> 1 statst_dev#st_pad1#st_inoa#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksize~#Pst_blocksn#Tst_fstype#Xst_pad4!#h     'name%Y#val&Y#entry'heapblock&m_next'#m_used(#heapblock_t*_heapalloc,smallreq-_#bigreq._#X_heap0(avlleft#right#balance#key_# data _#savl_t"savl_tree%root&#cmp'+#+c__avl_tree_t)qX_varinextjq#valuekY#CX_varmC X_USER0pavlq#namerY#varsw#fixedt# cookieu#"cleanv#$hpw #(nextx#,eX_USERzX_FILEtextY#offset#size#stat1# path#next#  &X_FILE&"X_FUN(avl#nameY#file"#offset#var(# next.#$wX_FUN ,files"#functions#x_USER#freelist# vtree1#ftree1#ctree1# hp #(4X_BUFFERSA scprintedtc ,NO0nT eX_avlcmpcO0OD^v1_Xv2_Y X_startcbuff err X_envc  c eODOn z   fX_checkpagecOPlnpageYhbuff f} 9accessc LUc OP!Uc w"+ maincPlSnargcchargv iic]shellcd#  X_trace#c X_debug$c GetMethod&c 3X_valuesec PX_set_cookiesgc# [ $ sX_actionkc X_exitnc$ ePtPx z % z & *( CheckEnctypeMethod)c GET_parser3c  +cGET_path4c& Ppage>ccbuff? f|%x iUc QpQ Gc'QpQ'QQ( SS E_POST_parser+c! +c% POST_parser/c! +cY)X_startc*sc Ab +__iob 1+POST_errmsgY,TracecH,X_INSERT_ID"T "',ent (,DebugcD,Cookiec@,X_eofc<,X_fp 8,X_BASEY4,X_BASE_holdc0,X_PAGEY,,X_ERRORY(,X_HOMEYL,TMP_DIRYP ",X_ERRMSGbP,DIRY8,x_BUFFERS [OSSGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ACT.c/SOFT/WebX/WebX/srcintunsigned char)long long intlong int)charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleNX_actioneSS^X_printfileeX_PAGE}WSGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_ENV.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned char6long long intFILEJelong int6charshort intshort unsigned intlong long unsigned intlong unsigned intlong double !X_env'fSV\n host( dir( name( chp( env( buff_env)!X buff*2h len+fc fp,Cb ISS ]e ]eputenv=fV4VTputenv=f2C }getHOMEf fname}accessfAX_exitTfV\WncodeSfh buffUA iVfX_traceXfX_finishifgetpidjf/unlinkkfexitfRbe__iobRTracesfX_HOMETMP_DIR; X<WGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_MSG.c/SOFT/WebX/WebX/src__va_listieva_list5g__FILE__FILE_cnt##_ptr$#_base&#_flag'# _file(# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intunsigned char Clong long intFILEJlong int Ccharshort intshort unsigned intlong long unsigned intlong unsigned intlong double ERRMSGWX<n fmt7l apxlockedX lenX_trace  X_header* X_printfile> X_exit4 WXX_exit4 TracesX_fpx;X_ERROR~7cX_ERRMSGRX_stdout; Nd^dXtimeval 1tv_sec 2#tv_usec 3#statst_dev#st_pad1#st_ino{#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atimJ#8st_mtimJ#@st_ctimJ#Hst_blksize#Pst_blocks#Tst_fstype#Xst_pad4#h      Lheapblock&m_next'L#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#RX_heap0e avlleft #right #balance #keyy# data y#avl_t"Mavl_tree%root&M#cmp'h# hyySavl_tree_t)X_varXnextY#valueZs#X_var\IX_USER0_avl`#nameas#varb#fixedc# cookied#"cleane#$hpfI#(nextgO#,X_USERiX_FILEtexts#offset#size#stat# path#next#  cX_FILEc_X_FUN(avl#names#file_#offset#vare# nextk#$X_FUN ,files_#functions #x_USER #freelist # vtreen#ftreen#ctreen# hpI#(qUX_BUFFERS~ cPfp cFtp]tv] )X<Xn ;X E\ N` Xh ~X_debugTXZnfmtSshapUzfpV chInitWlbuffX ~   c D )YPY |YPY X dZ Z access&ZZ!e/  c"P X_traceZ^dnfmtsiapzfp cpInittbuff ~# PB @ )[\[ |a$ X\<]% _access& |\] !e/]H]!e/&Traces&Debugt&X_fpx c&X_HOMEs&TMP_DIRs&x_BUFFERS uE^dGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TRANS.c/SOFT/WebX/WebX/src__FILEuh__FILE_cnt#h#_ptr$o#_base&o#_flag'u# _file(u# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intuunsigned charlong long intFILEJglong intoff_tuid_t Htime_t @  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _: ino_t Oblkcnt_t blksize_t long double suseconds_t 9 mode_t mO gid_t y dev_t O nlink_t O'timespec&tv_sec'#tv_nsec(#timestruc_t>ntimeval1tv_sec2#tv_usec3# ~ statst_dev#st_pad1#st_inof#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim'#8st_mtim'#@st_ctim'#Hst_blksize#Pst_blockss#Tst_fstype#Xst_pad4n#h     ' "^#^#len h#X_val"iheapblock&m_next'i#m_used(#4heapblock_t*4heapalloc,smallreq-#bigreq.#oX_heap0(avlleft(#right(#balance#keyd# data d#avl_t"javl_tree%root&j#cmp'#.hddpavl_tree_t);X_varij#k^#X_varmaX_USER0pavlq.#r^#vars#fixedt# cookieu#"cleanv#$hpwa#(xg#,X_USERzX_FILEtext^###stat~# path##  {X_FILE{mX_FUN(avl.#^#filem##vars# y#$ X_FUN X_CMDavl.#code#X_CMD S,filesm#functions S#x_USER Y#freelist Y# vtree#ftree#ctree# hpa#(mX_BUFFERS 3fp0 #1 #  X_OPEN3 p $>< #shm=^#  X_SHM> vcmdt^#codeuh#cmd_tv  WQhtmlN^#textO^# HTML_codeQ - X_search_commandh^initcmd hpanh i^d_n h $ Y c^|^ b /lowercasehstr^ J __\n #h nuppercasehstr^ J_\_n bh X_fflushhfp  __n X X_fgetsh^hfpmnhh M _`n ` i j h  cut_cmdh`fn!fpmh"oi#ih[#nhY#in }$ h%  `bX& & `bXaY' aLa& (& /& 6( `% M cd<& (& /& 6( `(0) f ;h' dHe& & dHeaY' de$& (& /& 6(H ` u*++cut_commenthfpm^first^last^,X_quitWh-V^-Vh-Vh$hh)|_h.K]hfg\n1`=ZIj/U/h| }X_USER_new Yg\hn!hpXah"^i"^j0nh#p^h#hpa`0u Yg|g$kh.K]h1count_tree%h2a$j2len$0n&hh}hh\naiX1Oscan_tree5 Y2a4j2patt4^0curr6 Y36 Y0p6 Y4X_CMPpatt;hh\i0n`ih"X.]8,6X_clear_valueYh2name_pattX^0uZ Y0prevZ Y3Z Y$h5&O6[&66&b&i66"6.1vX_USER_delh-^0u Y.h1X_USER_extract Y-^0u Y0prev Yoi0jnhQ6a/%)iHib`&i(`a"X.]'6jjO`(x6['vj j&(h67kX_put_valuehjln"^h"^i!fixedhj!cookiehk0nh#hpa`#u Ya$h)_h%@kjj&jj6()Yh._h1X_USER_get Y-^0u Y7AX_add_valuehlm n"^`"^j0nh#hpai#u YX#vsk)_h'kll$&ll$6,X_get_value^-^0u Y$h&6Am mhn\h6h/r'kmm &mm 68gh0ihmhm^]9C h2id^0i hemmn-h8`,HTML_string^2ch0inith0HTML_char0str0chp^0ih ^   Cemnn_x|mnnm,}X_putchar wh2ch v&66Cnpn\\%enoh(](]:uChps4n!val^h!out^i#lenha#ih`#chb%C qq X'er r&(]r0r];GetDDT 0Init 0tp :0tv :0D us4snh69?!h2date ^0i"h0n"h3#?h O st n`66#P/9/h2date.^0i0h0n0h31?h t tn`66P9YB>h2date=^0i?h0n?h3@?h tun`6)63=PI<X_get_base^uu^,X_crypt;h2in:o2out:o0key< 0n=h0len=h&'&2&>1Kcrypt_char1u2ch0u2key0^2len0huvPnhiP`a'uv$'a&2&>:& hvPn" ^h!out ^i0i h#n h}= &0env ^0val ^$/h>MCh^^?#format Z&~#val Z&~0chp Z^#dt [}) ;h@X_dt2str oh.C hAxx.C hAxx.C hA/xx.C h?0= K'}0pos L#i Mhb)uC h(P.C h?p)Ph.C h?0#fmt $'}0val $^#chp $^Y#f %'/})C h'Ayy&(6hANyy.C hAyy@|escape_shell_cmd h.C hAyz#url &~@escape_url h.C h? )C h' z$zX BaA(zXz.C h?m)EC h''8z{P&'P('\`'faA{{)C h' J{{ a?,(#format x&~#val x&~0chp x^#dt y}) ;h@X_str2dt h.C hA}$~l0crypted L^B]'oo)qC h'}P~l&^&e}P~l~a`'}~l'a2c&>? '@B'^)C h',X&b(X66#~? pB ?'^) SC h't&(66~? B '^) C h' \&l(6)63=~?!9#string &Ȼ~#s1 hc#s2 hd#m hadx.C hA!hx#len '~.C h?!= '}.C h?"B#string &}0no h#m h\#n hX)!C h''P&'&''d(0( [(\''8P&'P(P'\`'fa?"|p#fmt '}#L }.C h%"kp&p6A".C hA##|#init = '})#C h4getpid hA#@= '}0u Y0n h#len h})#zC h%#}DHa&(X?##tv :}= '}.C hA$fl= '}0fun S0n h#len h})$:C h%$X}a&(XA$.C hA$= '}.C hA$= '}.C h%%&A &(6h'k&6A%Ux= '}.C h%%u}6(}6A%8t#T }= '}.C hA%= }'}.C hA&.)&C h4X_today vhA&L .C h?&#i ^h}#sst ^h`#f _'/}= `'}@&EXPR_parser bh)& ;h.C h0.C h &* ' c ' ; '/ Ofloat1'trim_buffh-^0ih0nhhCX_crypt;hD!hD/hDB>h ' '1(getwordh-^2noh2word^0ih0nh7(mX_printvalue h^" ^XE h^^:) hn" ^X!out ^i" hj#chp ^h= )_#fullname )#i h\#n h[?). hA)7.C h%)C&'e\&(H]H]' d X )*7+X_shmdt hn" ^h" hi" hj#io &0i h0n h0key h3 h3 h0len h#chp ^`= +=W ^h$*h)*_h)*Ph%*+-&+C(`+O`'6`&O`6['v`&``6 +-*1+ZSHM_del 8h- 7^0i 9h7-X_shmat qhn" p^h" phi" phj#io r&0i sh0n sh#key shd= shc= she#len shf#chp t^`= t+=W t^i$,@h),T_h),hPh%,+-<&+C(x+O`%,-<-j&-&-&-&-(. X.]6.%,kXh&Xh6%-G6&O6['v&`6%-k+-D&+C(+O`'6\&O\6['v\|&\|`61.)SHM_att Ih- H^2key Hh- Hh- Hh2len Hh0u J Y0i Kh0id Kh:/9} hn" ^h" hi" hj#io &#i h`0n h0sz h3 h#chp ^`= +#mode ^c= ^d=W ^b0fp  $/h)/(_h.Ph:0r hn" ^h" hi" hj#i hi0n h0sz h#io &#chp ^a= &~= ^`=W ^c0fp $0 h)0_h)01Ph'A&(6h'k&6:1g hpn" ^h" hi" hj#io &#i hi0n h0sz h#chp ^`= &~= ^d=W ^c0fp $1Bh)1V_h.Ph:2x ^hptn" ]^h" ]hi" ]hj#io _&#i `hi0n `h#sz `he3 `h#chp a^a= a+= a^d= a^j=W a^c0fp b $2Sh)2g_h.Ph:3I :ht8n" 9^h" 9hi" 9hj#io ;&#i <hi0n <h#chp =^`= =+=W =^c$3$h)38_h.Ph:4 h8n" ^h" hi" hj#io &#i hi0n h#chp ^`= +=W ^c$3h)4 _h.Ph:5w hn" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$4h)5_h.Ph:68 h$n" ^h" hi" hj#io &#i h]0n h#chp ^a= +#path ^`#mode ^h=W ^i#fp `$5h)6_h.Ph96Nnh-m^-mh-mh0ioh0noh0retp&$6|h)6Nh._h66$Ln6%`61i6=j66I66S6]/66i/66|6,7X_exec[h-Z^-Zh-Zh0i\h0n\h3]'0args]&$7xh)7Nh)7_h)7Ph4X_exec_callgh8J6L8n7a7 i7,j67867B7LH7Xȿ/87e/8)7x/857/8A77:9h8Ln"^`"hi"hj0nh#ihj0oldlenh0newlenh#out&#chp^a#cmd9ؿ=&#old&#new&$9:h)9NNh)9b_h)9vPh)9 ;h'A 8`(6h'k(&(6 9 7:X_fork hLLn" ^`" hi" hj#pid :~#nm :|0sst$:dh):xNh):_h):Ph4forkh : :;hLn"^h"hi"hj=:~#nm:|#v&3^#ih[0nh$;kh);Nh);_h.Ph7<X_clearh n"^`"hi"hj=&$<h)<&Nh)<:_h) < n= a=i=$j=0/==</==O/==c/>=w=,>X_errorh-^-h-h0msg&$>dh)>xNh)>_h. ;h>> n>!a>-i>9j>E/>>Q/>>d/>>x>7CdX_lethn"^h"hi"hj#let&0ih#nhi#chp^X3^=&~$?h)?Nh)?_hA?|.Ph?@X#val^Y.Ph?@qx)@4Ph'A&(6h'k&(6?@.Ph?@)@Ph'A&(6h'k&6?A(.Ph%AGA\|&(H6h'k\l&\l6?A`)AdPh'A<&(x6h'k,&,6%AA&(6h'k&(6?B0valx^#name2x^i)BPh%B^A&(6h'k&(6'A&(6h'k&6%BAtx&(06h'ktx&(P6%C#A &(h6h'k&6'A&(6h'k&67DJX_addhn"^`"hi"hj#add&#iha#nhb0chp^3^=&~$Dh)D%Nh)D9_h.Ph7E0X_seth¼n"^`"hi"hj#set&#iha#nhb0chp^3^=+$Dh)E Nh)E_h.Ph,EX_shellch-b^-bh-bh0outd&)ENh)E_h$Eh. ;hF"E0¼ènEG`ESZE_jEk/FEw/F E/FEE,FX_sqlnamesFh-E^-Eh-Eh0outG&$Fh)FNh._hFF"èİnF<`FHiFTjF`/FFl/FFF,GX_chdir4h-3^-3h-3h0n5h0out6&$G[h)GoNh)G_h)GPh4chdir?hHFİŐnGaGiG&j6G2G</GGH/GG[/HGo/HGG,HX_usleep"h-!^-!h-!h0n#h0out$&$Hh)HNh)H_h4usleep-hI$HŐƌnH2`H>iHJjHVH`/IHl/IH/IHH,IX_sleeph-^-h-h0nh0out&$Ih)INh)I_h4sleephJ,I$ƌLjnI;`IGiISjI_Ii/J Iu/JI/J#II7JX_sqltraphLjn"^`"hi"hj#cmd&0val^$Jh)JNh._h,KKX_htmlh-^-h-h0cmd&$K&h)K:Nh._hKJnJ`JiJjK/KK/KK&K:,LX_compileh-^--h0cmd&$Kh)LNh._hLrKnK`KiKjK/L]K/LiKL7MX_optionVhҜn"U^`"Ui"Uhj0nWh#sigWh`#cmdX&0chpX^=X^h#valX^b$M!h)M5Nh)MI_h)M]Ph)Mq ;h%M ˰˴ Bj%M $ B`?M. ;h<P4alarmh,NpX_trans_printfileKh-J^-Jh3L&0fnameL^)NANh)NUPhEa h^hNMҜnMhNiNN`/NN-/NNANU^h:Om hn"^a"hi"hj$O%h)O9_h'MpӼ&N&NpӼNNa7VX_commanduhn!fptmh"t^i"tj"thk=v P#nwh\FPX_leth^hh?T.FP4X_seth^hhFPYX_addh^hhFPX_ifhm^hh>P'h^hhFPX_sqlhm^hh)P1hBPV^hhFQ'X_Filehm^hhFQSX_xFile=hm^hh>Qv ^h^hh>Q h^hh>Q h^hh>Q} h^hh>R8 h^hh>R%w h^hh>RH h^hh>Rk :h^hh>Rrhm^hhFRX_whilehm^hh>R h^hhBRV^hh>Sh^hhBS7V^hh>SZh^hhBSsV^hhFSX_clearh^hhFSX_fork h^hhFSX_shmat qh^hhFTX_shmdt h^hh' |&Z&%Tk6Xנ&66a&6(66I66S6]п%T6נP&77`&7(67867B7L{7Xz%T<ژ&==a&=( =0}%U> ژ(&>>a&>( (>Eп~%UOE0۔L&EEZ&E۔LEk~%UF"L&FFa&F( @F`п}%UFݼ&GGa&G( X6G2G<{%UJް&K^Kea&Kl( pKп{%V*Hްl&HH`&H( HVzH`|%VgI$l(&II`&I( I_zIiп|'K(&L2&L9&L@( KzDNnhCX_errorhD^hCX_exec[h:Ya h8n!fname ^c" h#level h#file mi#fp  b= &= &#oldpath ^c#newpath :0t h0n h#sst ~= m$Wh%X:Yd&Y4YBb( 6YR'A`( 6h'k&( 06%Xj  (`& /& 6( X a?X pE h^^h?X )X ;h)XK]h' T X( )X ;h)YK]h'  X1Y`new_dir h2fname ^2newpath ^0root ^:ZYl{h8n!fpzmh"zh"zhj0i|h0j|h0n|h0sst|h3}=~&=~&$Zh%ZB |  (`& /& 6(  i( .Nh:\1hPn"^`"hi"hj!ret^k=l0ih#nhX#argsh~#out&='#val&~#chp^X#sym^X#oldReturn^~#fun Sb#vsj#u YY#x_USER Yc#hpag$[h)[Nh)[_h)[Ph)[ ;h%\v`k6( )\8h'6 O` 6['v&k67\X_signalhP$n!sighh= \}( $\h._h ]*+;]MX_error_cid^0cmd]M)]; ;hh ]^*]]$n]|/]]'( ]<G_LX_get_cid^n#iha#user^`#passwd^Z%^ ]]|( X]|( @^,X_databaseh%^nA`( 6h'k&( 6%^A,P`( 6h'k4@&4@6%^Alh( 6h'kp|&p|6( #msg:{)_#h']P]|( 8]| `jX_sqllinehn!query^c#cmd&@_X_noselect_sqlh%_  BaA`@_X_finishhB_`j']])`;h)`O ;hphHgh:aJ'h0n"^`"hi"hj#query&#cid^h$`h)aNh)a_hBa)aJ^'&V( X8jD h:brh0n!fpmg"^i"hj"hk0ih#nha0argsh#out&='#chp^X0sym^#fun Sc#hpab#vsk$bEh)bYNh)bm_h)bPh( p.>h:cRRhn!fpQmh"Q^i"Qhj#uS YX0nTh3Th=Ub#srcVh#varVs`#vVsi$cIh)c]l'h%ck&( 6Ac@t.l'h.l'h:e 4'h(n!fp&mh"&^i!sep&^j"&hk#u( YX#n)hQ=)hf=*a0src+^#val+e b#chp+^i=+&$dh)d>h)dl'h%dk&( 6?d .l'h.l'h^9el'h2fpm-h3$eYh.l'hee(ne#he.ie:`/eeFX|eZ7gX_whilehn!fpmh"^i"hj"hk0ih0jh#nhX0ssth0linesh3#out&#chp^i#cmd9ؿ=&#sep&$fh)fNh)f_h)fPhBggmh>g-4'hm^^h>gPRRhm^h)gd ;hAg.l'h'e&e&e( e:kD'h7iX_founduhn!cidt^!hpta!fptm"th#valviQ#iwhc0jwh#nwh#sstwhm#lineswhd=x=y&=y&$hh)hh)hl'h?i1 )h_h)il'h)ih' J 0 `%iJ @d B`)igh)i{ ;h<)i_hE1h^hh^ i'*7kX_sqlh n!fpmg"^i"hj"hk0noh0ih#nhܐ0showh0ssth#cmd?P#query&п#vali#cid^b#hpac$jh)jNh)j_h)jh%k x B`?k ()k5h)kIh( H)kbh)kv ;h)kh)kh' &V 8`'  &V( `8`7mX_xFile=h  @n!fp<mf"<^i"<hj"<hk#fp_OLD> c#fp_NEW> d=?&#i@hb#FF@hb$lh)lNh)l_h)lPh)l ;h)ll'h  .l'h7nBX_Fileh @n!fpmd"^i"hj"hk#fp_OLD c#fp_NEW k= &#FF!hb$mh)mNh)m_h)mPh)n ;h)n'l'h(<.l'h7r]X_ifhn!fpmj"^d"h"hk0u Y0ih0jh#nhi0ssth#Nothk#i1ha#i2hZ#linecmdhh#f1r]#f2r]ؾ#out&#chpcmd^f#chp^a0name1^#name2^`#op^a#v1^`0v2^#f_sst~$oh)oNh)o_h)oPh)p ;h>p4l{hmhhApZ04X_user_fcmph?pt x.hAp\.l'hAp.h%pA&( 6h'k&6Aq04X_user_icmph%qJ  (`& /& 6(  aAqh8l.l'h%qA<&( 6h'k,&,6Aq4X_check_datehAq. ;hAr|4accesshAr:HX4X_check_floathXh4X_check_inthdouble rwg I__iobrgITracehIX_INSERT_ID8IDebug*hIX_eofhIX_fp IX_ERRMSG&IDIR^Ix_BUFFERS _JHTMLhJX_lineshJX_lenhJContinueBreakhJContinuehJBreakhKX_stdout JReturn^JX_sqlcase h JX_sqlTRAP!hdJX_sqlFUNC"hJX_sqlTRANS#h JX_sqlcode$h JIgnoreEmpty%hIX_rowcount)h tb Jx_OPEN5tR t Jx_SHM@tv  t ?JTRAPfuncCt XJDO_fflushDh$JMY_fflushEh t +Jx_CMDyt( u&  JSignalFUNCu uN W 4#HTML_tabUu>h u{   #cidue uh  #c_freeu<#base^#key_p.h 'xGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_VAL.c/SOFT/WebX/WebX/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned charlong long intFILEJelong intoff_ttime_t@  charshort intshort unsigned intlong long unsigned intlong unsigned intulong_t _+ ino_t @blkcnt_t blksize_t long double mode_t m@ uid_t u gid_t y dev_t @ nlink_t @timespec &tv_sec '#tv_nsec (#timestruc_t >{statst_dev#st_pad1{#st_inoW#st_mode#st_nlink#st_uid#st_gid# st_rdev#$st_pad2#(st_size#0st_pad3#4st_atim#8st_mtim#@st_ctim#Hst_blksizet#Pst_blocksd#Tst_fstype#Xst_pad4#h       'name%O#val&O#entry'heapblock&m_next'#m_used(#heapblock_t*cheapalloc,smallreq-c#bigreq.c#X_heap0,avlleft#right#balance#keyU# data U#wavl_t"wavl_tree%root&#cmp'/#/fUUavl_tree_t)uX_varXnextYu#valueZO#GX_var\GX_USER0_avl`#nameaO#varb{#fixedc# cookied#"cleane#$hpf#(nextg#,iX_USERiX_FILEtextO#offset#size#stat%# path#next#  *X_FILE*&X_FUN(avl#nameO#file&#offset#var,# next2#${X_FUN ,files&#functions#x_USER#freelist# vtree5#ftree5#ctree5# hp#(8X_BUFFERSE fnrootOhu {chpO  Omf bof ,   z $ @ y$h ofmf  )regular_filef!uOsst%mf f |nrootOhuiu {"chpOQ Yf# X_heap_reducef T $ 0` ;` F{ Rc _h T x z iroot_levelf$rootO!uOchpOname ilevelfif y c% X_values>f |%Tnprog=Oh"n?f`No?fMax?fv@,"ServerA i"ConfigA i~"httpA i}"holdA }"chpAOY"S_NAMEAOX"S_PORTAOX"fpB `"X_ROOTC ("baseC "pidC hpD"uE` mf Yf# chdirmf of# getpidqf& fO' :"#(X_add_valuef' W#4#Hf' ~#d#x)fO Yf(getcwdZf      '*'X_set_cookiesf%T'xn+buff'+namelistOX+chpOa+nameO`+valOQ+cookieOh+nfb,{f-f,{f-f' ''@,f-f'P'p-f 8.Tracesf X'.entoG.Debugtf.X_BASE{O.X_BASE_hold|f.X_PAGE}O.X_ERROR~O.X_HOMEO.x_BUFFERS3'xGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)EXPR_parser.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intYYSTYPEt_intt_floatlong doubleYYSTYPEyyalloc yyss yyvs short intyysigned_char  <signed chari K'x'^ Fyyparse li'2n yystate nic yyn oib yyresult pih yyerrstatus rii yytoken ti[ yyssa F| yyss ]e yyssp ]d yyvsa cc yyvs sj yyvsp sh yystacksize m yyval c yylen ig yysetstate ' yynewstate =*( yyexhaustedlab 1 yyabortlab + yybackup ( yydefault C( yyerrlab )p yyreduce M) yyacceptlab 2@ yyerrlab1 u) yyerrorlab j) yyreturn + fy'( yysize b'(l yyss1 ]h yyptr `((@ `(@(T )|) Ei+4+ccfccfVVsViyylexdiieffvalgchphisdigitpicharEEXPR_parseri23nexprXv_intEiv_floatKjiihiQfloatvalue_int8value_float@EXPR_BUFFPEXPR_INITiTEXPR_FLOATiX V!p yytranslate (!V yyr1 x(X!=V yyr2 Ph!-eV yydefact |x!UV!& yydefgoto H!V yypact !V yypgoto P!V1 yytable .!CV1 yycheck Y!3nV yystos (!^"yychar MiX"yylval P`"yynerrs SibH63GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_EXEC.c/SOFT/WebX/WebX/srcintunsigned char long long intlong int charshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleC name#functionN#NfC X_EXEC  X_exec_call0f33n name/h args/i n1fa 3f MstrcutKf34n fnameJh argsJi nameLM strLM~valLnMf=3f Sf]c chcharjf45n fnameih argsii namekM strkM~valk ch1kQ ch2kZnlf3f Sf StrLenf56n fnameh argsi nameM lenM~valch1ch2nf3f SfTracesfT Exec'ۈ 9C6GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_check.c/SOFT/WebX/WebX/srcintunsigned char<long long intlong inttime_t@]tm$Etm_secFg#tm_minGg#tm_hourHg#tm_mdayIg# tm_monJg#tm_yearKg#tm_wdayLg#tm_ydayMg#tm_isdstNg# <charshort intshort unsigned intlong long unsigned intlong unsigned intdlong double heapblock&m_next' #m_used(l#heapblock_t*Zheapalloc,smallreq-Z#bigreq.Z#X_heap0#` patt#dimPATT#pattCACHEt X_get_intg buff val leng ig #67$^XYZ]zX_check_float*g7$7nbuff)hi+g\ len+gdot+g[X_check_date?g79Xnval>hdaylong@ۨbuffAdayBgXmonthBg` yearBgc_dayC~c_monthC~c_yearC~ spaceDg iEg nEgaatoiNg788 [788]888[ 0]88X H]g] d]c"d] jX_check_intYg9X9nbuffXhiZg] lenZgX_todayi9:(nhphnhtmjXTkDbufflHchplhd]'&g:(;npatthvalicache\currg\ig`amalloctIgdim_LOADpattg0g `!0g:x:dim_FREEpattg"freeg]X_CMPpattg;<0npatthvaliop` sstg#s&g$;;!&g!&gEX_user_cmpg<0?\nv1hopiv2jPgIg$/=p=!g!g%X_user_icmpg?\Aln&v1 gh&op i&v2 gjPg!Ig% #X_user_fcmp8gAlCn&v17 #h&op7j&v27 #` Pg!Igdouble'Tracesg OCGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)FMdate.c/SOFT/WebX/WebX/srclong inttime_t@k1tm$Etm_secF1#tm_minG1#tm_hourH1#tm_mdayI1# tm_monJ1#tm_yearK1#tm_wdayL1#tm_ydayM1#tm_isdstN1# intunsigned charcharshort intlong long intshort unsigned intlong long unsigned intlong unsigned intPlong doubleub1 ?ub2 vTdatime year #month #day #hour #minute !#second "#datetime_t $}SETdate -1CNn v ,}h  ,i  ,j  ,1k count .1] T /w tm 0X ,DEH     `h pbEFh x    ``  FG 4 ? J U `i`rX GH     $`-P <II     `HTJ,K, h s ~  (`@TGTOsecond /1v .} . . .1i 01n 01{ 1G n 1WWd)X 1W` 1WWWP8]P TOminute N1v M} M M M1i O1n O1{ PGn 1WWdX 1W` 1WWTOhour m1v l} l l l1i n1n n1{ oGn 1WWdX 1W` 1WWTOday 1v }   1i 1n 1{ GZn 1WWdyX 1W` 1WWTTOmonth 1v }   1i 1n 1{ Gn 1WWd6X 1W` 1WW TOyear 1v }   1i 1n 1{ GX 1Wn 1WWd 0 g W` 1WW o Rg W` 1WW  g W` 1WW g W` 1WW oX_date_info m1NNnyear l ohmonth l oiday l ojhours l okminutes l olseconds l omX X_dt2str x1NO<ndt wk  wY  wZ v yTh tm zX RX_str2dt 1O<On  h  idt  Rj v Th tm @!tmp k"Ok *1`"Skip *1d"Year *1h"Month *1l"Day *1p"Hours *1t"Minutes *1x"Seconds *1| Z4OGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_AVL.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublenavlleftn#rightn#balance#key# data #avl_t"avl_tree%root&#cmp'#t e  avl_tree_t) favl_insert@eORn t?f` a?i HGh^lPP}PPQPPPP]Q hihPQhlQQ}QQ RR$RR$:RdRtRdRtQlRtR}RtR]Qavl_swlrootabavl_swr'root&a(b)avl_nasty1root0 avl_removeeRVTn tfh aive` Wssteh sstehStSStSSTL7@XKiTTTTQ(lTT}TT]QATUHXllUHUT}UHUTlUU}UUlUV}UVQVV$VV$]QV$V4V$V4Uavl_removerootetfssteaavl_search"t!fa!x#etree3 tree)!UVTVnn`xiX"VVhh#oAVL_search@t?fkey?aAt$Ie%  e !VWni Y,X&6%UWW0`X"WtWP0H'AVL_removeeWXn(tfh(keyia$Ne%WX<H,XUXX<`hX"XXPH) AVL_inserteXZ4n tfa ai$ e% bYY0Y,XUY Y0`X" xYYPH*TraceseoՄ_`Z4GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)lib_TOOLS.c/SOFT/WebX/WebX/srcintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doublepX_take_stringgZ4Z^buffXvalYig\ng[X_arg_string=g buff< val< i>g n>g ch?  stop_char* ch)2pZ\|nh]lkk[0[p AX_arg_string_sepeg\|_`nbuffdhvald]sepdjifg_nfgi chgA\\ S ]\\hmA]]TSQ ]hlp]_  lkk]^( stop_sepYg chX sepX iZgc@_`GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)X_heap.c/SOFT/WebX/SQLintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleHheapblock&m_next'H#m_used(#heapblock_t*heapalloc,smallreq-#bigreq.#NX_heap0a UX_heap_new#_`` n hp$h  w  5_'__(__` C(_free0_IX_heap_alloc>` bncurrheap<asize=_i mb?` cp@h 5_  w I``]@gQt]/aaH wab(_rmalign_mbbegin_end_5_ )X_heap_free_bbnhp` mbX 5_free0_bHbPfree0_bpb|free0_ X_heap_reduce_bc@nhp` mbQ x5_c cfree0_Traces_|ic@GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libpgSQL.c/SOFT/WebX/SQLintunsigned charlong long intlong intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleI "name#value#len a#X_val"heapblock&m_next'#m_used(#Vheapblock_t*Vheapalloc,smallreq-#bigreq.#X_heap0PGconni pg_connPGresultp pg_resulta 1hp)#cid*#names+#res,#curr-a#nrows.a#nfields/a#   c X_CURSOR1/ qX_databaseGac@dPndbnameFhuserFipasswdFjdbHq~hostHaportHbchpHLa  X_finishfadPdn X_noselect_sqlnade@nquerymhnumbmaivalm jresohLaI6X_select_sqlae@incmdahcidiqueryjdallocknumb)lval mresbhp]buff6Xchp`iailenacursoraLaGede_`jaX_heap_freea Gget_cursoracidiaLasql_error aiinbuff h Tracesaconn!X_rowcounta  x_CUR4PkiGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libpost.c/SOFT/WebX/POST/src__FILEsf__FILE_cnt#f#_ptr$m#_base&m#_flag's# _file(s# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # intsunsigned charlong long intlong int 'name%#val&#charentry' POST_parserfikn enth xfb mf clfl nof chpZqstrcmp fatoi+fX_trace,fstrchr fe__iobPOST_errmsgPTracefPrkGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libEpost.c/SOFT/WebX/POST/src__FILEtg__FILE_cnt#g#_ptr$n#_base&n#_flag't# _file(t# __orientation*# __ionolock+# __seekable,# __extendedfd-# __xf_nocheck.# __filler/ # inttunsigned char#long long intFILEJflong int 'name%#val&#charentry' <CheckEnctypeMethod%gkkn strcmp g < <B  GetMethod.gklnmethod/` strcmp g < <E_POST_parser8glrnent7hbuff9{fname9zname9XSEP9`sep9.xfp:?`fp_buff:?jfp_input:?ai;g]n;gmsize;gQSEP_SIZE;gTMPDIR<iX_trace>ggetenv?ggetlinePgstrlen  <getpidUgunlinkWg8strcpy   <]memcmp g E E Lmn8dmn8pXmemcmp g E E  memcpy   E ( memcpy   E #.?+Kstrip_nameg namechpstrrchr  < g strcpy   <!f"__iob"POST_errmsg"TracegRu<rGNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)libget.c/SOFT/WebX/POST/srcintunsigned charunsigned intlong long intlong int'name%#val&#charentry'qGET_pathdrsnentqanamei id` pathb Tgetenvd strcmp d w w}GET_parser2dsu<nent1qhname1i i3db x3dccl4dno4d query5a path5` chp5X3strcmp d w w Igetenvd st`qstrlen | w strchr  w dtu4malloc  | strncpy  w |POST_errmsg^a{uS:StS(TTTT0 TD THTP TXTX T`T`TlTlTtTtTTTTTTTTT TTTUUUUU4U<mULeU&UnUU%UoUU$UpUV#VqV$V4=VLV\VhV|%VVVVVViV)VW ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_MSG.cW.WW W W$W(W0W@WHWPWTW`WpWpWxWWWWWWWaWW/WWWtWWWX XXrX,X< ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRACE.cX<X@XLX`X`XhXXXEXXYYYYY$Y8Y@YP7Y\YYYbYZ iZ(Z@ZXZhZhZxZZZZZZZZ[[[([<0[P[\_[`[d[l[x[|[[[\ \\$\(\(\0\<V\P\l\l\t\\\\\\\ \\\]]]] ] ]@]@ ]H]h]|]]]]]_]]^^@^dt ../include/usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.htime_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hsignal_iso.hsiginfo.hsignal.hprocset.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TRANS.c^d^h^|^^^^^^^^^^^^^^^^__ __0_\_t_________````$`L`````h`l` ````K``Oa"ara HaZa, a,a4 aDaD aLja\aaaaaa a5a_a5aaabaabbb0b4ub4bPubX]bhbbbbbbbbbbbcc c ccDcHcTcTc\,c|YcOcVcccccdddd,d4d4d< d@)d@kdH)dT"dTrd\]ddEd dd dd djddddeee$ e(5e(_e05e<be<2eDbeHeHe`ehexe|ue|euereeeeeeeef f f0f4f@fDfDzfLfTfhfluflfufyffffffffffggg,g8g@gHg\~g` gtgt g|gggggggggggggghVhhhh$h$h,h8hLh\h`hlh|hhh hhhhhhhiikiiii i0/i4iHYiPi\ididilixi|i| iiiiiiiiiiiidi=iWj^j jmjj j$j(j(j0j8$j@jHVjLjLajTj\ jhYjpjjjjj]jj~jjj~jкjjj jjjkkk k(k0k4$k@kH_kHkPkd k|~kk kkkkkkkk kmll5l~l$l(~l,l,~l4lDlTl\l`l|lllllllpl#ll llm !m~m m$m$~m,m4mLmTmhmpmxmmommmmmmmmmmmnnnn,nPn`nlnpntntn|nnnnnnnunnnn nnnopo0uo pp(p8pDpHpLpLpTpXp`pdppppp$pxppmpup ppppq qqqq$q@qqDqHqHqPq\q\qeqqqeqqqeqq r r(r(ur0rLrlr|rrrrrrrrrpr~rܕr~rers~sesss4s8sDsHsLsPsdsssssssssttt t t$t0t4t8t<tHtPtTtXtdtltlttttttttttttttttttuuu u4u<uPuXuXu`umu'unuuuuuuuuuuuuuuuvv$v4'vDvPyv\vpvvvvvvvvvvv vv$vpv$www w(w( w0wDwD wLw`w` whw|#w|qw#w.wfw.w2wbwwwwx x xxxx x,xDxDxLx\x`xdxhxlxtxtx|xxxx~xx{xxx}yy 2yy0y<yLy`ylyxyoyy}yyyyyyy|yyyyzz}zzzz$izXz`zdzhztz|z}zzzzizzzzz{{{ {{${@{P{\i{h{t\{{A{{{{{i{{i{|||$|81|8c|@|\|`|| ||||||||||||||}}}}$A},}4}8}@}P}\z}\}l}p}}}}}m}'}n}}}}~~~~ ~~~~~$~$~8~P~dz~li~x~~~ ~~~ ~~~ ~~ ~t~  t K,<PX|`dht~~}^$|,HT|\1p;pYx $  $(,044<P\\}dhlpxL~~"} 5 _T\`ddlpt|gd $008HP`}dhhpK%o0LTX`dl];Y0<@DLTX\pk~ m&j~Kg  (00dHhhp|||g'm,@@ HPTppx$p$      t( < <tD XX `t!ts|   $8'8m@DjHLjPTjX\jdlxa'mjjjj,<d~liS j~  k4DLkPPkhpx@| 8sHlt| ]. s@@X\\dF(,0b<<TT\`hh)mmܭ{{$4@g13a $!(04DPTThpdp0x||mej u$0488@HTT\pu uhNnn,88@d,h, un 4Hdptoo!H X`nppx$E$@LP`px| (o(0<"PX``ht2E\1f S  (88 DXohllotHn$&b 0o08D:\op|$N  <HL\hl|$b8@(lo|) 4H`lpo~ q $048TT\hxS$s($ s4!4s<PX`q0D\hl| $$,8HV\d$s$)k%r (0<<DPP`p|(4DHXdhlx(,DDLPPX&hJ|  ."r0<L\\*t ,8T`dhg   " $8@Ddx$(,P\xg  "(<Hdx8@@HXX `ptx|^(o1<P\x0LTT\ll t^(o 1$}0@@Thtu (0<L`Xhh|  (8zDTTh| |~(,,~4 8<<|DPht|!s!s   % $(,0DT\Tpx|X 2{LP``t$ ,4<LVXx!s u (@DX`jf,@Lh||Y  <@DHdX^\ `mdptxx$Va |2Y g,<<Pt i 0Tlxx~ (4Pdtt|p,#}}~  8{@DDPHDLJX`~p pt t t t t t t4 4tPP \$lt)}~  b,,48<H\}lpp~x |ؔ},00~8 <Thtp|| ~ 4L`%`ohx|||~ ~|~ ~~Xhhpt|x||~ ~,n||~  $8@~DD~\d~h~h~ |~  ~D\d~40HTdxqY  @\hx”qœ¤¤¬¼|8TpxÄÌÔÔèYô(Hlt ĈĐĠİeļ((0LX`h pxŀŐdŜŬŬ,Hdltt|ƌdƘƨƨƼ (D`hppxLjbǔǤǤǸ(0 DL\dȈȐȰb0<XlɌɰɸ f$8D`tʐʰʸ ~$8D`t˄ˤ˰~˴˸~$88TT\ppx̨̨̌̌̔ ̰ ,h f(0$@@PyXp|ẅ́͘(ͨͨ͸rqD4  008LL\'dhdp΀΀ΔeΜΤcάqμμ!F( 48<Dddlxψ7ϐϨ%o$(,04X<fD.DfP%``h||ЈАUДДЬд+&L00@<PPd lфєєѬѼѼM$$4DDTddt҄҄ҜҨ$HTpyӌӜӨӴӼy R,G088@TXQXC`h|pt|ԀԈԐԜԤԨԬ԰ԴԸ|j{ 88@T`t|Ո|դY;  Z,:4XP<XWt=|^֘6֠]ּ7\8[9 P(D0QPCX ppx׌אאטtנ ׸׸$<HtP`pBx`ؘ4ؠOENFa3j4*<V\>dUل?ٌu٨ٰf.t ,8T``|ڈڐ{ژڰڰڸ {(`D0LMhGpLیH۔۬۬۴ DXLddl܀܌ܨܴܴu44<P\x݄݄ݠݬݴݼ +~ <HHdބިް~ 4Plg߄߄ߌߠ߬ (B@@~H\h ! (0kDLx`hq|z\6   8DDTptx][   $&$n,@@HTT\hhp|| 3a   08<P\lu~ s~    (0HPcPdclpxxn   n 44<HnH\dhllxnuun U C0TodxEu~ s t  Pe4<uP hixooo(8|DPP|r  r 8PrP Xppxr ruu r  $$,,<DrD XrX prx 쬆   $(48<@DHLLTlu#o u  u 0:0Z8DP`ddp'e3a$$,DTT`lptxe/e3"ru $  (u( 0LXdlltx|:^V _-g,-4N@PTd|$(4<HLPT\hllx ((,88@HHX\hhpxxJ7i~h~  4~@DD~L P`lip~|~ i^ 4HPl=N(i$08j`ltjspp$DD LTT\x%or  r  4PX\``hpui,8Thpxx s  s 0}<P T`t| #,.,f<dlppx n%n *$8@DLTUdl#|}yyy  (,048@DHLPTdll t || "j yy yy$((88HH\`hllt|| m y(G,@DLPX\`ltt|sZ 4LPPXdhpq*g'(,48@DT\\d_~  $(48<@l4l`tv0 DXlppx #f/e/e4 $$@vd x t  ( <DHPcpt|f. $,044<Thtt   4HPXX`xp <)<kDL`|       s M 0 D L# \5 \_ d5 |             s 0 8 L$ \ d |       l        ( D X d                ( 4 8 8 T X \ ` d h l |   X   ( "         b   $% 0 @@ L ` d p             (o<PXhp|     ,,<Xddlt"$($(p0Hh  $88@TG\~~*$ ,@T%To\tw~  QC Q C(M0~Hh 0s@@Hpx|  s r    (0DLrTTpxuu r  $$,r, DrL `dd ԱF 8b@0@dHL1Lclo5_x,00x8 <H\\dtt|hydF 0Lt tt|; d t ((@ D'DTi|#|q$0HPX `hy  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_VAL.c ~,DLTTlxx~$<DLLhnt~ԧ~7,,4Ht^  $,,8<-<gDuT~hxx~ q 3  0 <~ H P T T~ l |~          !!! !$!(!(!0!H!`!t!|!!!!!!!""("@"T"\"`"t"|"""""""""##/#4#@#H#\#\#d#l#x##Q#O######$$4$P$l$|%$$%$$<$M$X%(!%4%< %D%T%`%p%p%x%%%%%% %%&q& & &((&8&8&@&t&t&|&&& &&&r&&&j&#&q''''0 '0'8 '@*'@"'Hr'P'X'h 'x U /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeEXPR_parser.csys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hEXPR.yEXPR.tab.c'x' '(''+''''q'!''''$''''1'c'1'c'1'''''(((((@(T(\(\(d(l(p(x (|(((('(((((((((((((9)) ) ~)) )<)@)@)`G)h)h)p)t)t)|))%)))m)))))) )) ))))*$*** *$*(|*0*8*@*@ *H*Tu*h*x* ***t**#*q*#*r*** ** *****}++ ++(+4u+@ +@x+\++ + ++ ++"+++ +#+ +++++, ,,,, u,4,@B,@R,H,L,T*,Tj,\*,,,,,,,I,N--(-<-P-d-x-----_-C---q...(.<S.H.H.P.`  .h}.py.tF.|F.....@/\/T-//b/(00Lq0#0l0(0g1 -1  1 u1@d1L1Lu1T11171d11u11u11u12$2(2,2024282@  2Hu22222222222223 ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_EXEC.c3C33,3H3X3X3`3l3l3t3u3333%3333344444$4@4H4L4X4pu4x44'4444445 5 5X5d5d5l5p55o555)5555566666$6@6T6`6l66r666  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_check.c6-666 666666777 7 77$7(7@7H7L 7P7P 7X7\ 7\7d7h 7h7 777!7 777777R7B7U7778888 8$8,8,8488 8@8D8T8T8\8h8l8t8t8|8 88888888888>888889,N90909D9D9XM9\9t999999999!9999::(O:0:<:<:H:H:P:P :X:d:d:l:p:p :x:::::::;;(;@p;D$;P;X;h;p;|;O;;; ;;;;;;;;;;;;;;;;;<<<< <<<05<4>$>(>(>0>D>T>T>\>h">tu>>>>>>>>>>>??(?(?0?D?\?`?t????-?d?????@@@$@$@,@@@@@H@Xq@l@t@|'@t@#@q@@@@@@@@AAA A A(A<ALALATAlApA|AAAAAAAAAAABBB,B,B4BHBHBPBh'BpcB,BcBBB+BpBBBCCCC4C4C<CTC\ ClClCCCCCCCCCC  /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysiso/time_iso.hmachtypes.hint_types.htypes.htime_impl.htime.hselect.htime.hFMdate.cC DD !DD7DXaDd}DdD}DDD&DnDDDDDDDDEEE EE E(E(E@EDEHmELEL}ETEX#ElElEtE|hE"E}EEE'EmEEEEEFFFFFF$F(F,F0F@FHFHF`FdFhlFlFl}FtF|}FFFFFFFFFF~FFG'GmGG$G(G,G4GLGTGTG\G`GdGhGxGGGGGlGG~GG~G GBGGH H H,H,HL(HLlHTH\H`HdHlHHHHHHHHHHHHHkHH~HH~I ICI(I(IH'IHmIPIXI\I`IhIIIIIIIIIIIIIlIܿI~II~J J 'J$ J,#JDJ\J\J|J|JJJ)JkJJJJJJJJKK VK K(K,K0K0~K8K@~KLTKTK\EKpKpKKKKK*KjKKKKKLLLLL$|L(L,L,L<LHL\L\L|L|LLL)LkLLLLLLLLMM M $M$M$M0M0M<M<MH'MHmMPMTMXMXM`MpMpM|MM MUMNNNNNNNNNNNNOOOOuO$O(O<O@OTOXO\O`OdOhOlOpOtOxO|OOOOOOOOO  ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_AVL.cOSOOOOOO9O[PP P P0PP06P@EPDPHPX$PXpP`P|P|PPPPYP;PNPPPPPPPPPPPPPPPPPQZQiQQQ/QQ8WQ@8QHlQLQPQ`$Q`pQhQQQQQQQ^QQQQQhQQQQQXQRRRrRR R$<R,R46R<R@R@ RHR\RdqRhRlRpRtsRxR|RRRRRR`R4RRR>RVRR6RRR8R`RSSSSSS$S@S@SLSLSTSl~SlSt~SxS|SSSSSSSSSS{SSSSSSTT TT$T0T4TL&TTT`ThTlTlTtTTTTTT~TT~TT~TTTTTsTTTTTT$TUUUUUU U0~U@UHhULUPUTU`Ul:UtUUUUhUUUUU9UU~UU UUUgUVVVV VVVVV$V(V,V0V4V<VT4VXV\V`VhVtVVVVVVVVVV VVVV VVWWW W WaWW W(W02W<aWDWHWPWhWtWWWWWW WWW_WWAXXXaXXXtX !X<.XHZXPXX<XhaXprX/X XXXXXXX~XYYYYYYY aY(Y(Y0~Y8Y<YHYP YdYhYlYlYaYYYY.Y~YYrY YYYYY~YYZZ$Z4{ ../include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hlib_TOOLS.cZ4,Z4ZLZXZXZtZZZZZZZZZZZ Z4ZZZ[[j[*[0j[<[<[P[P[d[d[p[|,[[[[[[[![[[\\ \\ \,j\, \L\T\\\d\l\|D\\\\\X\<\\q\\\\\']] ] ]k]]]0]<]<]D]T']l]p]p]]J]j]*]j^ ^ t^(^4,^<^X^\^d^h^p^!^^^^a^ ^ ^t^3^^ _9__0_8H_8t_H _Ht_P_` ../WebX/include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hX_heap.c_`6_d_t_t _|_|__ _____s___`` !``` `(`4`8B`8R`@`D`L)`Pk`\`d `d`l`x`|`````` `k```g``h``g``````````a a5a a a(a0a8a<a@aHDa`adadaaaaataadaAab6b bbb b8b<b<bHbHbPbXbXb`bpbtb|bbbbqb7bbbbbbbc ccc c c(c0 c@T ../WebX/include/apps/pgsql-8.2.4/include/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/time_iso.hmachtypes.hint_types.hsys/types.htime_impl.htime.hselect.htime.hstat.hipc.hshm.h../../POST/include/post.h../../SQL/libSQL.hAVL.hWebX.hpostgres_ext.hlibpq-fe.hlibpgSQL.cc@ZcDcXc\c`cdchclcpcxccccccc ctccccc cccdmd 'd4d@dPdTdhdpdpdxddddddd ddd ddee eee$e,e@9eHedceheeeeeeeeee.eree3eefCfWfnffdfDfDfLfPfTfXfdf|af*fjf*fjfff^f"gggg g<gDg`gdghglg|g|gggggggggrgFgnggghhhhh(h(h0h<h<hDhHhLhPhThXh\hdMhluhhUhhhhhhhiiii$Li4i<iDgiDidgilixi_iiiYii_ii^ ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibpost.ci-iijjjj j(j(j0j8j8j@jHjHjPjjjjjjjjjjjujjuj#jqkk k$k(k@ kDkHkLkT k\kdsk|kkC ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibEpost.ck8kkkkkkkkkkkklll(l(l0lDlL!lLslTlhlllpltl|lllllll lllllyllmmm$m$m,m`mhmmmmmmmm<mmmmmmmnn8nDnDnLnXnlnlntnxnxnnnn4nnunnnnnnnnnnooo$<o$Xo,o@oPododolopopoxoooo ooHoLoHp pp,ppDpdpppppppppOq qq$q,q,q4!q4q\qpqxqqqqqqqqqqqrrrrr$r,!r4r<rDrL]rTrdrlrtrrr#rrrr- ../include/usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hpost.hlibget.cr,rssss,s<s<sDsPsPsXs\s`shslsts s$sssss*sjs,stt ttttt$t,t4t@t@tPtTtX tXt`uththtt#t|ttStttt tttttttttuuu uuu u(qu,u<@ /usr/include/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includesys/va_list.hiso/stdarg_iso.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hutil.cu<.u@uDuHuTu|uuuuuuuuuuuuuvvvv v v(v8sv@vDvHvLvPvTvXvXv`vpv|v vvvvuvvvvv vvvwww,w0wXwdwhwwwow%wow%wrwx#xlx#x x,x0xPxxx"xtxx xxx x"xxxyy y yy8y<yDyHy\ylytyty|yyyyyyyyyyyyzz(z,z4z@zDz`ztzzzzzrzzzzzz{"{o{$){P{X{\ {x#{|{{u- /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_PATT.c{{{{{{~{{{{{{{{||,|0|8|<|@|D|D|P~|`|h~|pF|pN|x>|| | ||:|Z|:|%|||||||||F|N|}}}}}n} } }(}0}0}8}@}@}H}P}P}X}h}h}p}}}}}'}}}}}}}}}~ ~~~~ %~4~8~@~D~Lk~`~d~l)~t~x~N~~~~~~~Q~~~~~~~~~6~~j ,y4@dxx+]0m%u  (TT\ddl)k)c*j (0<<DHHPXXpxu /usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/include/sysmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/signal_iso.hsiginfo.hsignal.hprocset.h.hdim_CMP.c2'm'(<<DHHPPXd include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.cnpntoooo4o@ include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.hoHoXo\o\odohohop~otoxo|rooooo!osoooo*ojo*pppppp 'phpl4pl`ptpppp5p~pppppqqdql&qxqq7qqqqqqqrrrrrrrrr<rG include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.hssssss s s(~s,s0rs4s8s8s@sD!sDssLs(ssssss'sms sЈsst0t44t4`t<tP tPttXtdthtltltt9t|~t|tttttuDuLuTudut:uxu|uuuuuuuvvv vvvvvvv include/sfw10/builds/build/sfw10-patch/usr/src/cmd/gcc/gcc-3.4.3/gcc/usr/include/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includestddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hiso/stdlib_iso.hiso/stdlib_c99.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.cv | ND -  O0ODL - O - PlH -  |  S | S - V\ -  | W< -  | $X< - $X - $Zl -  | ^d - _D - _\D - _H - _ - ` - f - g\ - hX - h\ - i0l - jt - l - m \ -  mh0m\ - m - n - p` - s4 - sX - t x - tx -  u u4 - vP -   -  -  - ( -  -  - p - t - 8 -  -  - $( - L - 8 - L - L - $ -   -  -  -  -  - ¼ - è - İ - Ő - ƌ - Ljd -  -  -  - ҜX -  -  -  - 8t -  - P - $ -  - 0 - H - 0 -   - H - ( -  -  -  -  h -  @L -   -  |  ` -   -   | -  %T$ -  |  'x '  -  2t -  |  3 -  3 -  4, -  5 -  |  p6h p7$ -  p7 -  p9Xh -  p9h -  p:(\ -  p; -  p<0, -  p?\ -  pAl -  |  C  -  NT -  Nd -  O< -  |  O -  R -  VT -  V -  W -  X< -  |  Z4 Z -  \| -  | _` - `  - b - b -  | c@ - dP< - d - e@| - i$ -  | 8i -  | dk, - dkT - dl -  | r - s -  | u<d - ut -  wPwd - x, -  x`y8P - y -  z@Tz - {x( -  | 0{0 - 0{\ - 0,l - 0  -  |  -  | np -  | oH -  | 4s -  X_header ,X_avlcmp X_start wmain eTrace yX_INSERT_ID ent Debug Cookie X_eof X_fpX_BASEX_BASE_hold5X_PAGEJX_ERROR`X_HOMEuTMP_DIRX_ERRMSGDIRx_BUFFERS_X_action#=*X_envX_exitLERRMSG2g iPrintTM X_debug X_trace#$_u X_search_command /lowercase nuppercase X_fflush X_fgetsX_quitX_clear_valueoX_put_valueX_add_valueX_get_valueX_free_allCX_free_cidHTML_string}X_putchartransvalueGetDDTOdate_YEARdate_MONTHYdate_DAYX_get_baseKX_cryptX_transvalue(X_printvalue(mX_transline)X_shmdt+ZX_shmat.)X_io_fseek/9X_io_vfputs0rX_io_fputs1gX_io_fgets2xX_io_pclose3IX_io_fclose4X_io_popen5X_io_fopen6X_return7X_exec8JX_replace9X_fork:X_cookie;X_clear=X_unlink>X_error>X_letCdX_addDJX_setEX_shellFX_sqlnamesGX_chdirHX_usleepIX_sleepJ,X_sqltrapKKX_htmlLX_compileLrX_optionNpX_trans_printfileNX_includeOmX_commandVX_printfileY`X_notfoundZYX_call\X_signal]^X_error_cid]X_get_cid`xX_sqlexecaYX_functionbX_while_valuescX_while_wordselX_while_loopeX_whilegX_foundiX_sqlkX_xFilemX_FilenBX_ifsX_stdoutR9X_default_names )X_check_name yX_values X_set_cookiesXXyyerrorgyyparseEXPR_parseryycharyylvalyynerrs?bX_exec_callstrcut]chcharStrLen =X_get_int#X_check_floatzX_check_date"X_check_intjX_todayX_CMPexecX_CMPpattX_user_cmpEX_user_icmpX_user_fcmp8 X_date_info uX_dt2str X_str2dt; oAVL_searchAVL_removeAVL_insertFԆsX_take_stringX_arg_string2X_arg_string_sepPX_heap_newUX_heap_allocX_heap_free)X_heap_reducekܜX_databaseX_finishX_noselect_sqlX_select_sqlsql_errorX_rowcount. POST_parserPOST_errmsgECheckEnctypeMethodGGetMethodE_POST_parser*GET_pathGET_parserbmakeword]fmakewordpx2cunescape_urlescape_urlQplustospacerindgetlineYindescape_shell_cmdGETenvO$dim_FREEpattdim_LOADpattdim_ORpatt#dim_EXEpatt vp_SYMcmpk$__muldi3b__divdi3b__moddi3__clz_tabNS=S4W<gX<($_^d49 'x 36 @C O hԆZ4,_`ܜc@ik`rDu<d${knpo@rT4x4Plx(4 h $@(<lP00L<8 0 l l4TXL"l"!!x)*<$P$`x**<$P$`($(8081P'H(p(8181P( (,$0   <  $`$t!!$t$!!$t$!"l$$""l$$""%%""%%#$(p('',%&$H$P//X.8.$%()%X%)X)()T%X%)d)((&8'((+++,4,T,d..,,,,---..8.//X/081P1x2 2055`3P4303@2H33`3505D6D667<88:4:t89,:t;89:$:::;8>X>x?@$PPRRV$WHWdWV<VWdWVVWW4VVWW$Z$Z,bb$` `lZ|Z]L]tZZZZ]L]tZZZZZZZZ__^x^ZZ\,\^ ^4\L\l^ ^4\\^4^\\]L\]^4^\]^ __]]__^^__^^^^^^__`a$_(_,aa$_0_L_(_,_0_<_`_|`a``bb$``4````$``a$aHahaaapq,spt0rrr,rPvw$w@xy<ty<y{|4|4| }~Xt~XXt|L<XL<Xt <T`hXdd\`h`dd\`ht`ddp0tt@``p(@,4H0< $<xdt<Lt (<X<L<L,dt|$8D L`dX\HLDpthlX0XXlx|HT<LT`XxLp T,0D@0D<DX0dx X P p X h X  4 0 pp (,8`(4@\Ll000L D(tLpl|<p|L |( (| HP|pxTd0p $<p $ $ H d ` T d `  ( 0 ` \$ @\`Pd$d|$t|<dt$`hdXT|dX 8px0<H,@(HX08l\<|8l|X_add_valueERRMSGX_headerunsigned intunsigned intunsigned intunsigned intPrintTMunsigned intgetpidX_notfoundX_io_popenX_heap_reducenextX_cookieX_debugX_io_fgetsX_io_pcloseX_io_fputsfoundX_io_vfputsignoreX_select_sqlX_transvaluevaluebuffoffsetERRMSGdate_MONTHcompileX_sqlexecX_callX_io_fopentransvalueX_returnstatusX_unlinkX_free_allX_functionX_io_fseeksizeX_arg_string_sepX_arg_stringX_free_cidsql_errorX_heap_freeX_io_fcloseX_translinedate_YEARnameunsigned intX_user_cmpX_includeX_replaceX_traceX_while_loopX_while_wordsdate_DAYX_exitX_while_valuesX_printfileX_tracefnameX_arg_stringX_check_nameescape_urlunsigned intX_default_namesERRMSGX_debugX_put_valueyynewbytesunsigned intyyerrorX_traceX_arg_stringunsigned intX_get_valueX_CMPexecdim_EXEpattunsigned intERRMSGX_tracesprintfsscanfstrcpystrncmpdatebuffformatdatestrmodeunsigned intright_subtreeX_traceleft_subtreeunsigned intunsigned intX_traceunsigned intERRMSGmallocunsigned intX_traceunsigned intunsigned intunsigned intPATT_LISTunsigned intpatterncurr_pattunsigned intunsigned intunsigned intunsigned intunsigned int.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab < $$ @"1d1doG(G(`-BGGT  7BGG ABGG4 KM(M(*0QwXwXWwtwt]wwV200Fh eXXn00 4tdd{llttd<B &%aLQ|Z'%0`  ͹% `/07070100007769000081fd00000000000000000000000149fde573000000a9000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/ZoneLOAD.sh#!/bin/ksh LANG=C export LANG exec /etc/STATsrv/bin/psSTAT64_10 -O -M z -e -o zone,ntot,nact,usrtime,systime,rpcpu,vsz,sysc,nlwp,vctx,ictx,sigs,inblk,outblk,iochr -T $1 0707010000776b000081ed000000000000000000000001394a41d300000041000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/bsdlink#!/bin/sh exec /etc/STATsrv/bin/perl /etc/STATsrv/bin/bsdlink.pl 0707010000776c000081ed000000000000000000000001358a31f400000892000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/bsdlink.pl#!/bin/sh --- perl =--- eval 'exec perl -S $0 ${1+"$@"}' if 0; # # PURPOSE: # This command dumps out the sd or ssd to c?t?d?s? mapping # # REQUIREMENTS: # disks is run to maintain the /dev/rdsk/c*s2 names # # sar uses The /dev/sd* names open(P2I, "/etc/path_to_inst") || die; while () { if (/\/s*sd/) { $_ =~ s/"//g; chop; split; if (/\/sd/) { $SD{$_[0]} = $_[1]; } else { $SSD{$_[0]} = $_[1]; } } } $sonomadir="/dev/osa/dev/rdsk"; if ( -d $sonomadir ) { open(CTDS2I, "ls -l /dev/osa/dev/rdsk/*s2|"); } else { open(CTDS2I, "ls -l /dev/rdsk/*s2|") || die; } while () { # Chop off up to the io-unit....and also chop off the slice specifier. $LONGINSTANCENAME = $_; chop($LONGINSTANCENAME); $LONGINSTANCENAME =~ s^.*devices^^; $LONGINSTANCENAME =~ s^:[c],raw^^; $CTDSNAME = $_; $CTDSNAME =~ s^.*/rdsk/^^; $CTDSNAME =~ s^ .*^^; $CTDSNAME =~ s^s2^^; chop($CTDSNAME); $INST{$LONGINSTANCENAME} .= $CTDSNAME; $CTD{$LONGINSTANCENAME} = $CTDSNAME; # print "XX", $CTDSNAME, "\n"; } if ($ARGV[0] eq "-a" || $#ARGV < 0 ) { while (($key, $value) = each (%CTD)) { if ( $SSD{$key} ne "" ) { print "ssd", $SSD{$key}, " is an alias for $value\n"; } if ( $SD{$key} ne "" ) { print "sd", $SD{$key}, " is an alias for $value\n"; } } } if ($ARGV[0] =~ "ssd") { $search = $ARGV[0]; $search =~ s^ssd^^; while (($key, $value) = each (%CTD)) { if ( $SSD{$key} eq $search ) { print "ssd", $SSD{$key}, " is an alias for $value\n"; } } } if ($ARGV[0] =~ "sd") { $search = $ARGV[0]; $search =~ s^sd^^; while (($key, $value) = each (%CTD)) { if ( $SD{$key} eq $search ) { print "sd", $SD{$key}, " is an alias for $value\n"; } } } if ($ARGV[0] =~ "c.*t.*d.*") { $search = $ARGV[0]; $search =~ s^s.*^^; while (($key, $value) = each (%SSD)) { if ( $CTD{$key} eq $search ) { print $search, " is an alias for ssd$value\n"; } } while (($key, $value) = each (%SD)) { if ( $CTD{$key} eq $search ) { print $search, " is an alias for sd$value\n"; } } } 0707010000776e000081ed00000000000000000000000149fde57c00000054000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/bsdlink.sh#!/bin/sh LANG=C export LANG exec /etc/STATsrv/bin/perl /etc/STATsrv/bin/bsdlink.pl 0707010000776f000081ed00000000000000000000000149fde58800000070000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/chldPID.sh#!/bin/sh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.chldPID -PID $1 07070100007770000081ed00000000000000000000000147ab1b7200002a0c000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/cpuinfoELF4%4 (44\/usr/lib/ld.so.1%#  ! "@x" 8 8 L =<ENd WH_f`qx ~$ Tl   4 t !^0@!  __iobkstat_readstrcmp_environ__register_frame_infomainsysconf_DYNAMICget_argsperrorfprintfkstat_open_edata_initatexitgetopt_lib_versionstrcpymallockstat_lookup_etext_finiusage_exit_start_endfree_GLOBAL_OFFSET_TABLE___deregister_frame_info_PROCEDURE_LINKAGE_TABLE_libkstat.so.1SUNW_0.7libc.so.1SYSVABI_1.3& =(4=7̳G! !$0<H T` lx  @D# @CE!@C@y, @ "@@C@C㿐/C@ @# @   $?@`  ``@C   "㿐㿐/Cʮ| `` @C 㿐㿈'D'H'LDHE @C'쀢?쀢 vL *?  㿐'D`E(D@C8'D'H'''/DH  H@? @Cj'耢? Ea8@Cd?*` @C^'؀  Ea@@CR?@CS'܀  EaH@CD?''耢 ;EXȖ @C: *ؒ@ "`*`ؐ  ` *`ؐ "*`ؒ ` @C? Eah@C ?T 'Ȓ '?'?'?'?'?' `t'' `x \Ȕ*@*`  Ex@B 'Ȕ*@*`  E@B 'Ȕ*@*`  E@B 'Ȕ*@*`  E@B 'Ȕ*@*`  E@B 'Ȓ '?'??'?'*@*`  `''耢 *`ؐ  `t'? *@*`  '''Ѐ  @ ''Ѐ a)@B0'Ѐ  Ea@@B$?n""! ̀ "Ԁ ' ' А` * *@ ` @BА` * *@ `  @B * *@ ` "!? * *@ ` " " a "! ! *a *ؔ "@ 'N* :` dEa@A'Ѐ VE`@AВ E@A!c!$Eb?Ea  @AEa@AEa @AEb @A'! @Ĕ *!E0 @AuĒ 'Eb8@Al''Ѐ } q 'В?" '̀ $А`̒@A< !a ! a  '̒?" '!c&Д !$Eb?! `Eb`#\Ebh#\Eb@  @@Д ! `E"`E"hEbp! @@'@@'Ѐ  '@@' 㿐/@  ??㿐㿠㿠vUsage: %s [-v] sysconfmallockstat_opencpu_infokstat_readchip_idclock_MHzbrandimplementationcpu_type Chip %d: CPU-Type: %s Clock-Rate: %g GHz Clock-Rate: %d MHz Strands: %d Strand-IDs: %d %3d %s (%g GHz, %d strand%s) s%3d %s (%d MHz, %d strand%s) @@|x00<0H0T0`0l0x00000000000&=  @ S oȲoo oo@     x (L > JD YguX | xJd  J Yx #@)x4;D Z 8 L _<gpd yH` $ Tl   4 t <!0$@!  .cpuinfo2crti.svalues-Xa.ccrtstuff.c__do_global_dtors_auxframe_dummygcc2_compiled.force_to_data__CTOR_LIST__object.11__DTOR_LIST____EH_FRAME_BEGIN__init_dummycompleted.4fini_dummyp.3cpuinfo.c__DTOR_END____do_global_ctors_aux__CTOR_END____FRAME_END__crtn.s_END__START___iobkstat_readstrcmp_environ__register_frame_infomainsysconf_DYNAMICget_argsperrorfprintfkstat_open_edata_initatexitgetopt_lib_versionstrcpymallockstat_lookup_etext_finiusage_exit_start_endfree_GLOBAL_OFFSET_TABLE___deregister_frame_info_PROCEDURE_LINKAGE_TABLE_as: Sun WorkShop 6 update 2 Compiler Common 6.2 Solaris_9_CBE 2001/04/02 as: Sun WorkShop 6 update 2 Compiler Common 6.2 Solaris_9_CBE 2001/04/02 @(#)SunOS 5.9 Generic May 2002as: Sun WorkShop 6 update 2 Compiler Common 6.2 Solaris_9_CBE 2001/04/02 GCC: (GNU) 2.95.3 20010315 (release)as: Sun WorkShop 6 update 2 Compiler Common 6.2 Solaris_9_CBE 2001/04/02 GCC: (GNU) 2.95.3 20010315 (release)as: Sun WorkShop 6 update 2 Compiler Common 6.2 Solaris_9_CBE 2001/04/02 GCC: (GNU) 2.95.3 20010315 (release)as: Sun WorkShop 6 update 2 Compiler Common 6.2 Solaris_9_CBE 2001/04/02 ld: Software Generation Utilities - Solaris Link Editors: 5.9-1.382 <Y4.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.symtab.strtab.comment.stab.index.shstrtab.stab.indexstrvalues-Xa.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 update 1 C 5.2 Patch 109513-05 2001/06/04/on81-builds/on81_58shwpl3/usr/src/lib/libc/sparc; /opt/SUNWspro.40/SC6.1/bin/../WS6U1/bin/cc -xO3 -xarch=v8 -xspace -W0,-Lt -Xa -xildoff -errtags=yes -errwarn=%%all -erroff=E_EMPTY_TRANSLATION_UNIT -D_REENTRANT -Dsparc -Iinc -I../inc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/on81-builds/on81_58shwpl3/proto/root_sparc/usr/include -c -o values-Xa.o ../port/gen/values-Xa.c -W0,-xp ( 0"@@So@-B  7B AB KQW]2 F enxxt{<\8 4H |#$  #8$07070100007772000081ed00000000000000000000000149fde59500000047000000200000001d00000000000000000000002600000000root/etc/STATsrv/bin/dbSTRESS_STAT.sh#!/bin/sh LANG=C export LANG exec /etc/STATsrv/bin/dbsSTAT 555 2000 $1 07070100007774000081ed00000000000000000000000147aacfe6000071f8000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/dbsSTATELF 4m4 (44&&&&|( ( /usr/lib/ld.so.15N:-L+?K1/<E7M4FD329BC)'("0@J !>8H,&.%6#=*;5IGA$ X x  $ $ % & & ( ((((*( t'\D4',*H*L$*P-+2*X@!7"@HMxU& k'q(w&~'''D$ ''' T'("H' ( 'h*X@(#P('*P!(!"9'@*(G& a'h& o% |' ('''t'P'8$ _startcallocUsageatoitab1tab2_environ_end_iob__register_frame_infoGetSTAT_GLOBAL_OFFSET_TABLE_sleepabortatexitexitmallocputs_init.umultime.remSHM_initsscanftabSRC__register_frame_info_tablegetenv_DYNAMICprintf__iobtabTMP__frame_state_for_exitenvironfree__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memset_etext_lib_versionfflushmain.divmemcpystrlenshmatshmget_finilibc.so.1SYSVABI_1.3libc.so.17̳*P"*X9&*'+'<' 6','8L'D-'PK'\'h8'tJ'3'0'I'('C'H'1'F','@'/(>() @D# @FI @F@, @ P"@@F}@F~㿐@/Fᄮ @   $? 2 @P㿐㿐@/F ` @ 㿐㿀'D'HD'쀢 Ia@FB'쀢`Ia'@F:'H*@*`*#@F1'䀢? Ia @F+?@F!  @F%$  Ia8@F?@F!H @F$ !H @@F$"H!H @@F $"L㿐'DIaXDD@F?@EH'D'H'L'L ;D@E (H H $H (H ,#\H 0#`H 4#dH 8#h#lDIH@EH @HHH`<" <Ē 'D 'DH @'H'D'H'D H@ H @@E' H @@E' H @8D   H @@E}'ܒ @E ' +  * +  `@E bHs @Ep"  @Ep 'h   @@Ei'' +  * +  `@ET bLEIa@E4"H'"L''耢  `  `   $`$  @@E ` " ' $`$" 'Ѐ ̀ ''Ѐ  (`(" @E 'Ѐ  ,`," @D '̀  0`0" @D '̀  4`4" @D '̀  8`8" @D 'Ȁ Ā ''    '''܀  ؒ ܐ @D  ؔ ̖ #\#`#d#h#l <`<" #pIb@DWЀ А 'Ȑ 'Đ ' '̀ ̐ ' ' ' ' ' ' @@D1ؒ ' @' @'   @D$   @D#\#\  @D #`#`  @D#d#d  @C#h#h#lIb8Ih@C  @C@C@C  @C   @C#\#\  @C#`#`  @C#d#d  @C#h#h#lIbpIh@Cubh@C   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @C* ?''' `      & && 㿐@/B$   @@*  @    2      2 *@ @ :  @@   㿈@/B<  "  @B&@ @`@B @J z- @Be@@`  @B{ 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @BS ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @Aِ ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@A"@A~"$&b""@Aw@A0 ' @*!*@ * "`'0 &` @Ax㿐@/Ah&`&`&@ &` @&`&`"@㿐@/A &`&` &` &@@&`&`"@㿐@/@خ  ` `"@  @A7` 0 `@A4XL ؠ =  @A "7j'?$   ؐ  J zo  '  @@͔"㿐@/@0 ? ???㿐㿠4㿠 SHMKEY505### Cannot get SHM...### Cannot attach SHM... %s (dim) v.1.3 Usage: %s key MaxID timeout [skip_every_N] %s %d %d %d %d %d %d %d %d _______Group-ID__ Tot Rds Wrs SEL1 SEL2 DEL INS UPD C/N%12s-%04d %6d %4d %4d %7d %7d %7d %7d %7d %3d %12s-sum %6d %4d %4d %7d %7d %7d %7d %7d %3d ALL%12s-tps %6d %4d %4d %7d %7d %7d %7d %7d %3d eh( ((*(&&*@(00<0H0T0`0l0x00000000000000 0,080D0 $ $o Xo { &   x8 (|e  e 4 (L 8<H HTX - ett - e - el( - e - e"@H - e"H - e" - e8#P( - e X x  $ $ % & & ( ((((*(+ '(+(9(G $] $l((  *(  & & <H*@L4'l(8(HTSt^gp{*$$x$x($(( t'\D4', *H*L*P+!*X@!&"@H<xD& Z'`(f&m'r'y'D~$ ''' T'("H' ( 'h*X@(#P(' *P!(".'5*(<& V']& d% q'x (}'''t'P'8$ dbsSTATcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummydbsSTAT.cgcc2_compiled.frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.s_startcalloc_START_Usageatoitab1tab2_environ_end_iob__register_frame_infoGetSTAT_GLOBAL_OFFSET_TABLE_sleepabortatexitexitmallocputs_init.umultime.remSHM_initsscanftabSRC__register_frame_info_tablegetenv_END__DYNAMICprintf__iobtabTMP__frame_state_for_exitenvironfree__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memset_etext_lib_versionfflushmain.divmemcpystrlenshmatshmget_finias: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4, d"d,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$i)@h)@h )$4)$~)@})@} )$L)*<$<*O@*m@ *w@ *$H*$*@*$T*$*@*@*@*@+ @+$+$t+0@+<$+=$'+N@&+Y$+Z$Rl+s@Q+}@Q+$(+$+@}+@}+@~+@~+$+$"@+@,@,$H,$ ",7@ ,E@ ,Q$H,R$",r@,$,$4#P,@3,@3,$(,(P*@,d$x.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpframe.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  {o X X - x x 7    A (G$$M$$S%%[&& `&&T e( ( n(( t(({((((T*(*(p*(F15K7$$ 7H\ >?;@,07070100007775000081ed0000000000000000000000013fd0547500006208000000200000001d00000000000000000000001b00000000root/etc/STATsrv/bin/grepXELF l4]4 (44sstt|/usr/lib/ld.so.15?>32$09%<-7*=86+45"!1;/ )(&.#,:' t   l $ 8 t   $,4 lt@!pH1t GlMTY$` fHl rH@(!`0 xs 8 #* @/T6<=D$ J_start_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_abortatexitexitmalloc_init.umulfputs__register_frame_info_table_DYNAMIC__iob__frame_state_for_exitenvironfree__deregister_frame_infostrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_memset_etext_lib_versionfflushmainmemcpystrlenstrstr_finifprintflibc.so.1SYSVABI_1.3libc.so.1R7̳\+#$->2< (8$%01<;H'T:`/l"x5 @D# @CF $@C@Z, @ "@9@C@C㿐@/Cᐮ @   $? 2 @㿐㿐@/C ` @x 㿐'D'HD  HcF@@CB?@C9X !@C: 1 'D X *H@ @@C&  'D X @Cc@C   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @B* ?''' `      & && 㿐@/B༮   @@*  @    2      2 *@ @ :  @@   㿈@/AԮ  "  @B&@ @`@B @J z- @B @@`  @B 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @Aې ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @Aa ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@A"@A!"$&b""@A@A0 ' @*!*@ * "`'0 &` @A㿐@/@&`&`&@ &` @&`&`"@㿐@/@⸮&`&` &` &@@&`&`"@㿐@/@p  ` `"@  @@` 0 `@@XL ؠ =  @@"7j'?$   ؐ  J zo  '  @@p"㿐@/@Ȯ ? ???㿐㿠㿠Usage: %s word [word2 [word3 ...]] eh 4hp(00<0H0T0`0l0x0000000000h  $o to     0|e  e  4 ( L 8 lH H TX - et - e - e( - e - epH - eH - e - e8( - e t   l $ 8 t   $,4y% )$7,E [ j4}$ \  h h p  lH L 4#(44D TOZclw$0( lt@!pHt 2l8?D$K QHW ]H@(!`0 xs 8  @ T'<.5$ ;grepXcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummygrepX.cgcc2_compiled.frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.s_start_START__environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_abortatexitexitmalloc_init.umulfputs__register_frame_info_table_END__DYNAMIC__iob__frame_state_for_exitenvironfree__deregister_frame_infostrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_memset_etext_lib_versionfflushmainmemcpystrlenstrstr_finifprintfas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4, d "d ,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$i )@h)@h )$4)$~ )@})@} )$L)*<$ l*O@*m@ *w@ *$H*$ *@*$T*$*@*@*@*@+ @+$+$+0@+<$+=$'+N@&+Y$+Z$R+s@Q+}@Q+$(+$+@}+@}+@~+@~+$+$p+@,@,$H,$ ,7@ ,E@ ,Q$H,R$,r@,$,$4,@3,@3,$(,(P,d.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpframe.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  o t t -  7   A l l GM$$S88;[tt ` en  t$${,,44ThF"C%['4$ 'X\ ./;0,07070100007778000081ed0000000000000000000000013c8cb42500014828000000200000001d00000000000000000000001900000000root/etc/STATsrv/bin/harELF4CP4 (44uuxx>c@/usr/lib/ld.so.1  !#$%')*,-.124578<=>?CDEFGJKLMOQSTUVY]_`abcefghjlmostvwxz{|}~ "&(+/0369:;@ABHINPRWXZ[\^diknpqruyg p( ?!@ PTXe {09  HR8 .  8H! P'\/"G$D` RaH` { l"| d 0P $8!0@'d(5I( GVe4 h }" p@ $όwpt #p <&|5 DTITx\ y!< 8(D\ HH$ $l c   0|J ["< nu0@!h0 x>H  K (4 P$- @\ O, Uۼddrty( h( !8L l  (H c $ 4( l ?hKRt_ }(#P "T f( _ x$(   $T2<(@H [,e rg` `Cx  X  |`  `u <E`(Tda( print_memory_percpu_us3errnop_onlineper_second_memory_us3pcpc_eset_getname___Argvdi_prom_initps_memory_events_us3iatexitcpc_strtoeventper_instruction_us2print_percpu_us3i_environstrerrorper_instruction_us3maindi_prom_finipset_assignenvironstrcat__cg92_usedcpc_shared_closestrrchr_get_exit_frame_monitormax_metricprocessor_bindprint_memory_metrics_us3p_startcpc_event_accumdi_walk_nodecpc_eset_accumper_second_memory_us3i__environ_lock_initps_memory_events_us3_lib_versioncpc_shared_take_sampleps_events_us2__iobps_events_us3print_metrics_us2pi_events_us3pprint_metrics_us3per_instruction_us3icpc_eset_numeventsper_instruction_us3pdi_initcallocps_memory_events_us3pper_second_us3p__fsr_init_valuecpc_eset_neweventliststrcmprealloccpc_shared_bind_eventpr_events_us3p_ex_deregisterfreecpc_accessfprintf__1cH__CimplKcplus_fini6F_v_cpc_eset_geteventnanosleeppi_events_us3i__priocntlthr_create_exitatofcpc_eset_neweventcpc_eventtostrprint_percpu_us2atoimy_gtickprint_percpu_us3perrorper_reference_us3i_PROCEDURE_LINKAGE_TABLE_print_title_us3pcpc_eset_nexteventmalloccpc_getcciname_iobsysconfper_reference_us3p_endcpc_shared_openper_reference_us2print_memory_percpu_us3idi_prom_prop_lookup_bytesper_reference_us3cpc_eset_newprintfvfprintfprint_metrics_us3icpc_eset_clone_finips_events_us3pcpc_getcpuveroptindprint_memory_title_us3pgetoptpr_events_us2pr_events_us3processor_info_edatacpc_eset_freeprint_title_us3iget_bus_clockmetricsprint_title_us2exitprint_title_us3per_second_us3imy_cpustatcpc_versionstrcpycpc_seterrfn__1cG__CrunMdo_exit_code6F_v_pr_events_us3isum_metricgettextcpc_eset_resetprint_memory_title_us3cpc_event_diffper_second_memory_us3_GLOBAL_OFFSET_TABLE_avg_metricprint_memory_percpu_us3ppi_events_us2pi_events_us3di_finiprint_metrics_us3ppset_bind_ex_registerprint_memory_metrics_us3uk_stringsetvbufper_second_us2per_second_us3__1cG__CrunVdo_exit_code_in_range6Fpv1_v_print_memory_metrics_us3iprint_percpu_us3pstrdup_etext__1cH__CimplKcplus_init6F_v__DYNAMICps_events_us3ikonly_stringprint_memory_title_us3ilibcpc.so.1SUNW_1.1librt.so.1SUNW_0.7libdevinfo.so.1SUNW_1.1libthread.so.1SISCD_2.3alibc.so.1SUNW_1.1SUNWprivate_1.1libcpc.so.1librt.so.1libdevinfo.so.1libthread.so.1libc.so.1/usr/lib/lwpy =' =( =' O =' Nq9=$\v0'ptc oC/ KY$00 <6HFT:`lx<]yVP7?%|S h,8DBP\\hstu;bQ5etAHD @D"cT, @'H $H+`-` `?-)#L- =--% # @eh@eϐ!,#X #\@e@! @p@e@e㿈'i7@e@'@e@'G@e @@e@e@e@e @e@e @e@e 㿘i`@eH ? 8⃆I0 88 #\`\8㿠 @e} H" ?" " p @eqЄ@& ( (@eg2@& &(_Є (r @_p_p_p_p _p(@eM(!( 0 &H& &㿠 @e/ @  ( (@e# 2@ @e* &  &  & &  H   Z vXvXvXvX v X(v( 8@e 0&08 &O 㿠  *H   &  H( (  (@d0   6H *  (   08 X Gp  `8 &O   & 㿠 H @ O@d @d   @   ( (@   @   ( (@`0  6@  "  H" Ξ 4H" 㿠` H@dhѐΐO㿠@ ϔ@ <`@O@dB`@d@ 㿠!i"P@d:"Hi@d0@d0H *`b(  `@F&O㿠#\\ H *`b(  H @&OX 14 ?!@c ?@ %@c#pi@c!P@cؘ @c?@ %@c#pi@cՐ!P@c˜  0 *0" *p "@*"@ " 沔bj '(J@ " ' @c( 4@4 @ (H  (  @c @W@c @c@OȠ @c 0 O ( , 2O V  @R#\ (HB (  @cz @$Ar@ct Ar@cq@Ȯ@cm_0_" t  0  Oܐ ( %@cD#pi@cCT P@c0@cO  , \#\2O @c? P@c$ ?"@@c11#pH1@c#pi@cd!P@b @c @b !@ i@b!@bP `H,(  ?@c  H ?"H  "H'` "@  "H'` 2H Ȫ`@b?`'``  ` ` @OܐĐ?? ( @bޔ??@@b#pi@b P@b, `H)  ?"H` `@b??@@b#pi@b P@b` Ā2H%``  &O` `$H' 0 H "` &O' 0  0@bt( & `` &O 0`H0 ? "H#`   '``@I'``   @bt @i ` @bE P@b3`'`` &O`HW`  88J *0" *p "@*"@ " 沔bj 'J@ " '@b, ?@'i?􀠠"H  i@b;  `@*@b @b/` 0 $  0 `O`?􀠠"H    @ @a  0 $  O`H  "H  &2H  `@&O@a\\\\\ \\\\\\\\ \\\\\\\\\\\\\\\\\\\\\\\\\\h\t\@\@@A'D'H'`3@a /a@&a&aa&a@a  @i@aq @a aP@a[  H@ap@a?@Pi@a?@Ki@a@ai@a@ & 4 TN& R& R& R& U@as@ati@at@ & 4 <T8& X& X& Y4& 9@aW@aXi@aX@ & 4 \& `& `& a& @a;@a<i@a<@ބ & 4 8c& gl& g& g& &  ?& &?&?@I& & $i@a?H5`Y?'IDaZ0|ROHhe]#\pV#`P#dxc#h\#lT#p8N#t_#xa#|a#a#HW##Y#Y'"`? 68H2 K* a?&?D 4@ &  $& & & D 4@i|&  & & & D 4@x&  TD 4@t&  <D 4@p&  D 42HDl 8& D 4@h&  8D 4@d&  dyD 4@`&  #oD 42HkD\ &  `dD 42@ 4&  [D2@ 4&  SD2@ 4&  KD2HHD&  CD&?@D &?<D &?8D 5D`1Dd-D& $*Dj@`8Ȑ   @` ?2Hj@_<Ș ' ??7'@` ?2H Dj@_hDD'jH@_?@2 O"`?`"H $H    @_`<O #& 3ctD"H1  "H ct @'Hct(@_& ctH(@_#KpKx FȁB9@‰J#&  B# &  ' "@ H'2@ ??2H ? & 2H ?@@jPj@_4 @_$?@1j< @ @@_v i@_@_R@_Sa@_P @_ @a@^P Pj@^@^Ð RD@_%j@_"k@_0k@_@^ @^  C0A@i㿀'LN'T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@^a^a!@sxx$%ƉƑ JHa(&)Ƒƙ JL `P&&()Ƒƙ JL`@,&-ƙƝJN ̙&&H (HTXȑD9 ` (&)&ƉƅJB`("&#ƅƉ JD …&&&9 ^`x^`!^`^`!@spp()ƉƅJB`("&#ƅƉ JD …&&&9 ^`^`!shh()ƉƅJB`H("&#ƅƉ JD …&&&9 ^a^a!s``()ƉƅJB`H("&#ƅƉ JD …&&&9 (a8()ƉƅJBa@"&#ƅƉ JD ap&&"#ƅƉ JDah$&%Ɖƙ JLĉ&&&Ba"#ƅƉ JDa($&%Ɖƙ JLĉ&&B9 0aȇ(&)ƉƅJBa("&#ƅƉ JD …&&&9 8b()ƉƅJBa("&#ƅƉ JD …&&9 @b0()ƉƅJBb(("&Ɖ J#&ƅD 8HC0A@i?@Y㿈'LO'T 'P. 'X `& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@^a^a!@spp$%ƉƑ JHa(&)Ƒƙ JL `P&&()Ƒƙ JL`@(@,&-ƙƝJN ̙&&&H HTXȑD9`` (&)&ƉƅJB`(@"&#ƅƉ JD …&&&9`^`^`@sh^`x^`h@s`()ƉƅJB`"&#ƅƉ JD  & ( H9 `$%Ɖƙ JL`(,&-ƙƝJN ̙&&&ĉ H9 a$%Ɖƙ JLa(,&-ƙƝJN ̙&&&ąH9 (a8"&#ƅƉ JDa@$&%Ɖƙ JLap&&$%Ɖƙ JLah,&-ƙƝJN ̙&&&Da$%Ɖƙ JLa(,&-ƙƝJN ̙&&DH9 0aȋ"&#ƅƉ JDa(H$&%Ɖƙ JLĉ&&&9 8b"#ƅƉ JDa(H$&%Ɖƙ JLĉ&&9 @b0"#ƅƉ JDHb(("&Ɖ J#&ƅD 8HC0A@ip'LP'T`'P. 'X``& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@^a^a!@s$%ƉƑ JHa(&)Ƒƙ JL `P&&()Ƒƙ JL`@,&-ƙƝJN T&X&H (H ̙& D9 ` $&%ƉƑ JH`((&)Ƒƙ JL ȑ&&&9 ^`x^`!s$%ƉƑ JH`p^`^`(!sx&)Ƒƙ JL x&&()Ƒƙ JL`(,&-ƙƝJN ̙&&HD9 ^`^`!sp&p$%ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9 ^a^a!shh$%ƉƑ JHDa("&#&ƅƉ JD …&&&9 (^a8^a@s``()ƉƅJBa0"&#ƅƉ JD ah&&"#ƅƉ JDa`($&%Ɖƙ JLĉ&&B9 0a(&)ƉƅJBa("&#ƅƉ JD …&&&9 8ap()ƉƅJBa`("&#ƅƉ JD …&&9 @a()ƉƅJBa("&Ɖ J#&ƅD 8Hkb܂@[+`HE(k  1H6 ` #\#``#d#h` #l#p`(#t#x`0#|#`8##`@##`H##``@ @Z&O |  x; ; ; ; ; ; ;Ȑ ;А ;k##`#d#\##h#l#p#t#x#|####@ZLC0A@Y@(H'LR'T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJNTX ̉H H Ν& D9`^d^d@s&$%Ɖƙ JLDd(@$&%&Ɖƙ JLĉ&&&9`` "#ƅƉ JD`(@$&%Ɖƙ JLĉ&&&9`^`P^`@s^`H^`x@s"(#@ƅƉ JDH$&%Ɖƙ JLĉ&&&9` ^a^a@s"#ƅƉ JDa(@$&%Ɖƙ JL H ‰&&&9`(`"#ƅƉ JD`(H@$&%Ɖƙ JLĉ&&&9`0c "#ƅƉ JDc(H@$&%Ɖƙ JLĉ&&&9`8^cH^cx@s"#ƅƉ JDcP(@$&%Ɖƙ JL H ‰&&&9`@^c^c@s"#ƅƉ JD`(H@$&%Ɖƙ JLĉ&&&9`H^c^c@s^c^c@sx"(#@ƅƉ JDxH$&%Ɖƙ JLĉ&&&9`P^ap^ah@^a@^a@sp^a^bp@sh"#ƅƉ JDh$&%Ɖƙ JL  LDa($&%&Ɖƙ JLĉ&&&H9 Xb("#ƅƉ JDb0(H$&%Ɖƙ JLĉ&&&9 `b`"#ƅƉ JDbX(H$&%Ɖƙ JLĉ&&9 h^b^b^b^bs``"#ƅƉ JDHb("&Ɖ J#&ƅD 8pC0A@Y@(h'LT'T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJN TXH H ̙& D9`^d^d@s&$%ƉƑ JHDd(@"&#&ƅƉ JD …&&&9`` ()ƉƅJB`(@"&#ƅƉ JD …&&&9`^`P^`@s()ƉƅJB`x(@"&#ƅƉ JD …&&&9` a()ƉƅJBa(@"&#ƅƉ JD …&&&9`(`()ƉƅJB`(@"&#ƅƉ JD …&&&9`0c ()ƉƅJBc(@"&#ƅƉ JD …&&&9`8cP()ƉƅJBcH(@"&#ƅƉ JD …&&&9`@^c^c@s()ƉƅJBcx(@"&#ƅƉ JD …&&&9`H^c^c@sxx()ƉƅJBcx(@"&#ƅƉ JD …&&&9`P^ap^ah@^a@^a@sp^a^bp@sh()ƉƅJBh"&#ƅƉ JD DBa("&#&ƅƉ JD …&&&9 Xb(()ƉƅJBb0("&#ƅƉ JD …&&&9 `b`()ƉƅJBbX("&#ƅƉ JD …&&9 h^b^b^b^bs``()ƉƅJBb("&Ɖ J#&ƅD 8pC0A@Y@(h'LV'T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJN T&XH H ̙& D9`^d^d@s&$%ƉƑ JHd(D@(&)Ƒƙ JL ȑ&&&9`` $%ƉƑ JH`(@(&)Ƒƙ JL ȑ&&&9`^`P^`@s$%ƉƑ JH`p(D@(&)Ƒƙ JL ȑ&&&9` a$%ƉƑ JHa(D@(&)Ƒƙ JL ȑ&&&9`(`$%ƉƑ JH`(D@(&)Ƒƙ JL ȑ&&&9`0c $%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`8cP$%ƉƑ JHc@(D@(&)Ƒƙ JL ȑ&&&9`@^c^c@s$%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`H^c^c@sxx$%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`P^ap^ah@^a@^a@sp^a^bp@sh$%ƉƑ JHh(&)Ƒƙ JL  LHa((&)&Ƒƙ JL ȑ&&&D9 Xb($%ƉƑ JHb (D(&)Ƒƙ JL ȑ&&&9 `b`$%ƉƑ JHbP(D(&)Ƒƙ JL ȑ&&9 h^b^b^b^bs``$%ƉƑ JHDb("&Ɖ J#&ƅD 8p?@PC0A#LW#P* `L&P&& BD`$%ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&&8` $%ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&&8 `H$%ƉƑ JH`@b(D(&)Ƒƙ JL ȑ&&&8(`P$%ƉƑ JH`@b(D(&)Ƒƙ JL ȑ&&&80`x$%ƉƑ JH`pb(D(&)Ƒƙ JL ȑ&&&88`$%ƉƑ JH`pb(D(&)Ƒƙ JL ȑ&&&8@`$%ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&8H`$%ƉƑ JHD`b("&Ɖ J#&ƅD 8Pb(b((b(D8b(DHb(D8b( b(0b(D@b(DPb(D8b(b(b(D8@kc@Tk8H^(k  1HO ` #\#``#d#h` #l#p`(#t#x`0#|#`8##`@##`H##`P##`X##``##`h##`p##``@ @T&OА  ; ;Ȱ ;А ;ؐ ; ; ; ; ; ; ; ; ;  ;(l##`#d#\##h#l#p#t#x#|########## ##(##@S0l`a@S㿘H"(l  1H ` #\#```@ @Sq&O㿈  ;` ;h#pl#\lp`dh@SVC0A@Y@(?H'LZ 'T'P. 'X?`&?$L%P&&&ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&&:`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`П,&-ƙƝJNTX ̉Hb(H Ν& D8^d^ds&$%Ɖƙ JLDdb($&%&Ɖƙ JLĉ&&&8` "#ƅƉ JD`b($&%Ɖƙ JLĉ&&&8^`P^`s^`H^`xs"b(#ƅƉ JDH$&%Ɖƙ JLĉ&&&8 ^a^as"#ƅƉ JDab($&%Ɖƙ JL H ‰&&&8(`"#ƅƉ JD`b(H$&%Ɖƙ JLĉ&&&80c "#ƅƉ JDcb(H$&%Ɖƙ JLĉ&&&88^cH^cxs"#ƅƉ JDcPb($&%Ɖƙ JL H ‰&&&8@^c^cs"#ƅƉ JD`b(H$&%Ɖƙ JLĉ&&&8H^c^cs^c^csx"b(#ƅƉ JDxH$&%Ɖƙ JLĉ&&&8P^ap^ah^a^asp^a^bpsh"#ƅƉ JDh$&%Ɖƙ JL  LDab($&%&Ɖƙ JLĉ&&&H8Xb("#ƅƉ JDb0b(H$&%Ɖƙ JLĉ&&&8`b`"#ƅƉ JDbXb(H$&%Ɖƙ JLĉ&&&8h^b^b^b^bs``"#ƅƉ JDbb(H$&%Ɖƙ JLĉ&&&8pd8"#ƅƉ JDd@b(H$&%Ɖƙ JLĉ&&8xdh"#ƅƉ JDdpb($&ƕ J%&ƉJ …H8C0A@Y@(h'L['T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJN TXH H ̙& D9`^d^d@s&$%ƉƑ JHDd(@"&#&ƅƉ JD …&&&9`` ()ƉƅJB`(@"&#ƅƉ JD …&&&9`^`P^`@s()ƉƅJB`x(@"&#ƅƉ JD …&&&9` a()ƉƅJBa(@"&#ƅƉ JD …&&&9`(`()ƉƅJB`(@"&#ƅƉ JD …&&&9`0c ()ƉƅJBc(@"&#ƅƉ JD …&&&9`8cP()ƉƅJBcH(@"&#ƅƉ JD …&&&9`@^c^c@s()ƉƅJBcx(@"&#ƅƉ JD …&&&9`H^c^c@sxx()ƉƅJBcx(@"&#ƅƉ JD …&&&9`P^ap^ah@^a@^a@sp^a^bp@sh()ƉƅJBh"&#ƅƉ JD DBa("&#&ƅƉ JD …&&&9 Xb(()ƉƅJBb0("&#ƅƉ JD …&&&9 `b`()ƉƅJBbX("&#ƅƉ JD …&&&9 h^b^b^b^bs``()ƉƅJBb("&#ƅƉ JD …&&&9 pd8()ƉƅJBd@("&#ƅƉ JD …&&9 xdp()ƉƅJBdh("&Ɖ J#&ƅD 8C0A@Y@(h'L]'TP'P. 'XP`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJN T&XH H ̙& D9`^d^d@s&$%ƉƑ JHd(D@(&)Ƒƙ JL ȑ&&&9`` $%ƉƑ JH`(@(&)Ƒƙ JL ȑ&&&9`^`P^`@s$%ƉƑ JH`p(D@(&)Ƒƙ JL ȑ&&&9` a$%ƉƑ JHa(D@(&)Ƒƙ JL ȑ&&&9`(`$%ƉƑ JH`(D@(&)Ƒƙ JL ȑ&&&9`0c $%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`8cP$%ƉƑ JHc@(D@(&)Ƒƙ JL ȑ&&&9`@^c^c@s$%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`H^c^c@sxx$%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`P^ap^ah@^a@^a@sp^a^bp@sh$%ƉƑ JHh(&)Ƒƙ JL  LHa((&)&Ƒƙ JL ȑ&&&D9 Xb($%ƉƑ JHb (D(&)Ƒƙ JL ȑ&&&9 `b`$%ƉƑ JHbP(D(&)Ƒƙ JL ȑ&&&9 h^b^b^b^bs``$%ƉƑ JHb(D(&)Ƒƙ JL ȑ&&&9 pd8$%ƉƑ JHd0(D(&)Ƒƙ JL ȑ&&9 xd@$%ƉƑ JHDd0("&Ɖ J#&ƅD 8?@PC0A#L_#P* `L&P&& BD`$%ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&&8` $%ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&&8 `H$%ƉƑ JH`@b(D(&)Ƒƙ JL ȑ&&&8(`P$%ƉƑ JH`@b(D(&)Ƒƙ JL ȑ&&&80`x$%ƉƑ JH`pb(D(&)Ƒƙ JL ȑ&&&88`$%ƉƑ JH`pb(D(&)Ƒƙ JL ȑ&&&8@`$%ƉƑ JH`b(D(&)Ƒƙ JL ȑ&&8H`$%ƉƑ JHD`b("&Ɖ J#&ƅD 8Pb(b((b(D8b(DHb(D8b( b(0b(D@b(DPb(D8b(b(b(D8@l`Ђ@L(Hh(l  1HY ` #\#``#d#h` #l#p`(#t#x`0#|#`8##`@##`H##`P##`X##``##`h##`p##`x##`##``@ @L4&O㾰ɒ  ;А ;ذ ; ; ; ; ; ; ; ; ;  ;( ;0 ;8 ;@ ;Hl##`#d#\##h#l#p#t#x#|###### ##(##0##8##@##H##@Klaa̒@K㿘H"(l  1H ` #\#```@ @K&O㿈  ;` ;h#pl#\lp`dh@KnC0A@Y@(H'La'T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJNTX ̉H H Ν& D9`^d^d@s&$%Ɖƙ JLDd(@$&%&Ɖƙ JLĉ&&&9`` "#ƅƉ JD`(@$&%Ɖƙ JLĉ&&&9`^`P^`@s^`H^`x@s"(#@ƅƉ JDH$&%Ɖƙ JLĉ&&&9` ^a^a@s"#ƅƉ JDa(@$&%Ɖƙ JL H ‰&&&9`(`"#ƅƉ JD`(H@$&%Ɖƙ JLĉ&&&9`0c "#ƅƉ JDc(H@$&%Ɖƙ JLĉ&&&9`8^cH^cx@s"#ƅƉ JDcP(@$&%Ɖƙ JL H ‰&&&9`@^c^c@s"#ƅƉ JD`(H@$&%Ɖƙ JLĉ&&&9`H^c^c@s^c^c@sx"(#@ƅƉ JDxH$&%Ɖƙ JLĉ&&&9`P^ap^ah@^a@^a@sp^a^bp@sh"#ƅƉ JDh$&%Ɖƙ JL  LDa($&%&Ɖƙ JLĉ&&&H9 Xb("#ƅƉ JDb0(H$&%Ɖƙ JLĉ&&&9 `b`"#ƅƉ JDbX(H$&%Ɖƙ JLĉ&&9 h^b^b^b^bs``"#ƅƉ JDHb("&Ɖ J#&ƅD 8pC0A@Y@(h'Lc'T'P. 'X`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJN TXH H ̙& D9`^d^d@s&$%ƉƑ JHDd(@"&#&ƅƉ JD …&&&9`` ()ƉƅJB`(@"&#ƅƉ JD …&&&9`^`P^`@s()ƉƅJB`x(@"&#ƅƉ JD …&&&9` a()ƉƅJBa(@"&#ƅƉ JD …&&&9`(`()ƉƅJB`(@"&#ƅƉ JD …&&&9`0c ()ƉƅJBc(@"&#ƅƉ JD …&&&9`8cP()ƉƅJBcH(@"&#ƅƉ JD …&&&9`@^c^c@s()ƉƅJBcx(@"&#ƅƉ JD …&&&9`H^c^c@sxx()ƉƅJBcx(@"&#ƅƉ JD …&&&9`P^ap^ah@^a@^a@sp^a^bp@sh()ƉƅJBh"&#ƅƉ JD DBa("&#&ƅƉ JD …&&&9 Xb(()ƉƅJBb0("&#ƅƉ JD …&&&9 `b`()ƉƅJBbX("&#ƅƉ JD …&&9 h^b^b^b^bs``()ƉƅJBb("&Ɖ J#&ƅD 8pC0A@Y@(h'Le'Tx'P. 'Xx`& $L%P&&&ƉƑ JH`(D(&)Ƒƙ JL ȑ&&&9@`$%ƉƑ JH`(&)Ƒƙ JL `&&()Ƒƙ JL`(@,&-ƙƝJN T&XH H ̙& D9`^d^d@s&$%ƉƑ JHd(D@(&)Ƒƙ JL ȑ&&&9`` $%ƉƑ JH`(@(&)Ƒƙ JL ȑ&&&9`^`P^`@s$%ƉƑ JH`p(D@(&)Ƒƙ JL ȑ&&&9` a$%ƉƑ JHa(D@(&)Ƒƙ JL ȑ&&&9`(`$%ƉƑ JH`(D@(&)Ƒƙ JL ȑ&&&9`0c $%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`8cP$%ƉƑ JHc@(D@(&)Ƒƙ JL ȑ&&&9`@^c^c@s$%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`H^c^c@sxx$%ƉƑ JHc(D@(&)Ƒƙ JL ȑ&&&9`P^ap^ah@^a@^a@sp^a^bp@sh$%ƉƑ JHh(&)Ƒƙ JL  LHa((&)&Ƒƙ JL ȑ&&&D9 Xb($%ƉƑ JHb (D(&)Ƒƙ JL ȑ&&&9 `b`$%ƉƑ JHbP(D(&)Ƒƙ JL ȑ&&9 h^b^b^b^bs``$%ƉƑ JHDb("&Ɖ J#&ƅD 8plb4@F68H^(l  x1HO ` #\#``#d#h` #l#p`(#t#x`0#|#`8##`@##`H##`P##`X##``##`h##`p##``@ @Eِ&OАn  j; f;Ȱ ;А ;ؐ ; ; ; ; ; ; ; ; ;  ;(l##`#d#\##h#l#p#t#x#|########## ##(##@Ei؁lc4aؒ@E]㿘H"(l  D1H ` #\#```@ @E<&O㿈Ғ  ;` ;h#pl#\lp`dh@E!`㿠@,??@@㿠@? @??@@get_bus_clockinspect_node_clock_frequencycpc_eset_newcpc_eset_neweventcpc_eset_clonecpc_eset_deleventcpc_eset_freecpc_eset_geteventcpc_eset_getnamecpc_eset_numeventscpc_eset_nexteventcpc_eset_resetcpc_eset_accumcpc_eset_neweventlistcpustat_errfnsum_metricavg_metricmax_metricmy_gtickmy_cpustatmainper_instruction_us2per_reference_us2per_second_us2print_title_us2print_percpu_us2print_metrics_us2per_reference_us3per_instruction_us3per_second_us3per_second_memory_us3print_title_us3print_percpu_us3print_metrics_us3print_memory_title_us3print_memory_percpu_us3print_memory_metrics_us3per_reference_us3pper_instruction_us3pper_second_us3pper_second_memory_us3pprint_title_us3pprint_percpu_us3pprint_metrics_us3pprint_memory_title_us3pprint_memory_percpu_us3pprint_memory_metrics_us3pper_reference_us3iper_instruction_us3iper_second_us3iper_second_memory_us3iprint_title_us3iprint_percpu_us3iprint_metrics_us3iprint_memory_title_us3iprint_memory_percpu_us3iprint_memory_metrics_us3i/clock-frequency,sys,sys,nouser%s: %s: %s: cannot bind lwp to cpu%d - %s %s: cannot access performance counters on cpu%d - %s %s: cpu%d - %s %s: cannot access cpu performance counters - %s %s: out of heap %s: pset_bind - %s %s: pset_assign - %s %s: cannot create thread for cpu%d %4s %4s %s: library version mismatch: needed %d found %d %s: CPU performance counter hardware not available on this machine. UltraSPARC I&IIUltraSPARC IIIUltraSPARC III+UltraSPARC IIIi%s: %s is not a recognized cpu type DisrnphuakmMRMemory statistics are not available on this system. RTWarning: RT scheduling class does not existWarning: unable to put har into the RT scheduling classDisrnphuakmMRUsage: %s [-{i|s|r|M}] [-{u|a|k}] [-DnmRh] [interval [count]] -i outputs per-instruction stats (default) -s outputs per-second stats -r outputs per-reference stats -M switches to memory bandwidth stats -u tracks user mode (default) -k tracks kernel mode -a tracks both kernel and user modes -n suppress titles -p includes per-cpu output -D enable debug mode -m outputs MAX cpu stats (instead of AVG) -R runs har in the RT scheduling class -h print extended usage information Version 1.4 2001/10/29 Statistics: mips: million instructions per second bus: percentage utilization of address bus from CPUs flops: million floating-point instructions per second cpi: cycles per instruction dcm: data-cache misses icm: instruction-cache miss ecm: external-cache misses itlb: instruction TLB misses dtlb: data TLB misses brr: branch rate bmr: branch misses dsr: data stall rate isr: instruction stall rate fsr: FP-unit stall rate bsr: branch-misprediction stall rate rwb: remote writebacks recm: external-cache misses referencing remote memory US-III Memory Controller Statistics: bw: total bandwidth in MB/s rd: total read bandwidth in MB/s wr: total write bandwidth in MB/s Getting started: o per-instruction and per-second stats are ratios o per-reference stats are percentages o works with UltraSPARC I/II/III and Solaris 8 o needs to be run as root o be careful with interpreting data on idle systems o some counters may not be working properly mips bus cpi dcm icm ecm dsr isr fsr bsr %4d %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s %4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr rwb recm %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s %4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s %4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]    .  , 8 8 E ooDod` oo|dxInstr_cnt,Cycle_cntCycle_cnt,EC_wbDC_rd,DC_rd_hitDC_wr,DC_wr_hitIC_ref,IC_hitEC_ref,EC_hitLoad_use,Cycle_cntCycle_cnt,Load_use_RAWDispatch0_storeBuf,Cycle_cntDispatch0_IC_miss,Cycle_cntCycle_cnt,Dispatch0_FP_useCycle_cnt,Dispatch0_mispredInstr_cnt,Cycle_cntInstr_cnt,EC_wbDC_rd,DC_rd_hitDC_wr,DC_wr_hitIC_ref,IC_hitEC_ref,EC_hitLoad_use,Load_use_RAWDispatch0_storeBuf,Dispatch0_FP_useDispatch0_IC_miss,Dispatch0_mispredInstr_cnt,Cycle_cntInstr_cnt,EC_wbDC_rd,DC_rd_hitDC_wr,DC_wr_hitIC_ref,IC_hitEC_ref,EC_hitLoad_use,Instr_cntInstr_cnt,Load_use_RAWDispatch0_storeBuf,Instr_cntDispatch0_IC_miss,Instr_cntInstr_cnt,Dispatch0_FP_useInstr_cnt,Dispatch0_mispredMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3Instr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3Instr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,EC_wbEC_miss_local,EC_missesInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,Instr_cntInstr_cnt,EC_miss_remoteInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,EC_miss_remoteMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3Instr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completiondi_initdi_prom_initdi_walk_nodecpuallbwrdwrbwrdwrbwrdwrD$0< `   , x|$0|x  ('2 <CX`\sL|  d H#p\ - 9 > ( ,C` CIJ  `R  wX  _  h( o  wP  ~    &  =x  T[gr g p !@ T  09 . @HIRR8 f.  kx8H!P\"$D` H`   l("| 7d N0]P c$x80@d(I( e4  " p@ .6$=όSwpt ct#p <| Tx !< 8(-8DCIN\ `HoH$ $l c   | "<  0@!h0 -x2B>H T mK (4 P \ , ۼdt( !h/(= LS!8L al r (H c  ( l ht ( #P  ("T 7f( N ]_ sx $(  T <(   , g` `  &Cx  5X D n|`  ` u  `( d ( harcrti.s_ex_shared0_cpp_finidata0_ex_range0_ex_text0crt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cbus.cinspect_node_clock_frequencycpu.ccpc_eset_deleventhar.coptscpustat_errfn___const_seg_900000718us2.c___const_seg_900000106___const_seg_900000201___const_seg_900000301us3.c___const_seg_900000106___const_seg_900000201___const_seg_900000301___const_seg_900000401us3p.c___const_seg_900000106___const_seg_900000201___const_seg_900000301___const_seg_900000401us3i.c___const_seg_900000106___const_seg_900000201___const_seg_900000301crtn.s_ex_shared1_ex_range1_ex_text1_START__END_print_memory_percpu_us3errnop_onlineper_second_memory_us3pcpc_eset_getname___Argvdi_prom_initps_memory_events_us3iatexitcpc_strtoeventper_instruction_us2print_percpu_us3i_environstrerrorper_instruction_us3maindi_prom_finipset_assignenvironstrcat__cg92_usedcpc_shared_closestrrchr_get_exit_frame_monitormax_metricprocessor_bindprint_memory_metrics_us3p_startcpc_event_accumdi_walk_nodecpc_eset_accumper_second_memory_us3i__environ_lock_initps_memory_events_us3_lib_versioncpc_shared_take_sampleps_events_us2__iobps_events_us3print_metrics_us2pi_events_us3pprint_metrics_us3per_instruction_us3icpc_eset_numeventsper_instruction_us3pdi_initcallocps_memory_events_us3pper_second_us3p__fsr_init_valuecpc_eset_neweventliststrcmprealloccpc_shared_bind_eventpr_events_us3p_ex_deregisterfreecpc_accessfprintf__1cH__CimplKcplus_fini6F_v_cpc_eset_geteventnanosleeppi_events_us3i__priocntlthr_create_exitatofcpc_eset_neweventcpc_eventtostrprint_percpu_us2atoimy_gtickprint_percpu_us3perrorper_reference_us3i_PROCEDURE_LINKAGE_TABLE_print_title_us3pcpc_eset_nexteventmalloccpc_getcciname_iobsysconfper_reference_us3p_endcpc_shared_openper_reference_us2print_memory_percpu_us3idi_prom_prop_lookup_bytesper_reference_us3cpc_eset_newprintfvfprintfprint_metrics_us3icpc_eset_clone_finips_events_us3pcpc_getcpuveroptindprint_memory_title_us3pgetoptpr_events_us2pr_events_us3processor_info_edatacpc_eset_freeprint_title_us3iget_bus_clockmetricsprint_title_us2exitprint_title_us3per_second_us3imy_cpustatcpc_versionstrcpycpc_seterrfn__1cG__CrunMdo_exit_code6F_v_pr_events_us3isum_metricgettextcpc_eset_resetprint_memory_title_us3cpc_event_diffper_second_memory_us3_GLOBAL_OFFSET_TABLE_avg_metricprint_memory_percpu_us3ppi_events_us2pi_events_us3di_finiprint_metrics_us3ppset_bind_ex_registerprint_memory_metrics_us3uk_stringsetvbufper_second_us2per_second_us3__1cG__CrunVdo_exit_code_in_range6Fpv1_v_print_memory_metrics_us3iprint_percpu_us3pstrdup_etext__1cH__CimplKcplus_init6F_v__DYNAMICps_events_us3ikonly_stringprint_memory_title_us3i<:4<:4<:4*<:4<:4<;4<;4cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)libdevinfo.h 1.8 01/02/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)param.h 1.76 00/02/14 SMI@(#)types.h 1.66 00/02/14 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)sunddi.h 1.115 00/10/23 SMI@(#)dditypes.h 1.27 00/08/22 SMI@(#)ddipropdefs.h 1.15 99/04/05 SMI@(#)devops.h 1.42 99/04/21 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.46 00/10/23 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)kstat.h 1.15 99/07/26 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)as.h 1.69 99/08/31 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.4 98/07/17 SMI@(#)thread.h 1.105 00/08/22 SMI@(#)klwp.h 1.36 99/07/28 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)pcb.h 1.33 00/08/22 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.37 99/11/16 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)seg.h 1.59 99/05/04 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.86 99/06/01 SMI@(#)page.h 1.126 00/08/22 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.38 99/05/19 SMI@(#)ddidevmap.h 1.13 00/07/23 SMI@(#)nexusdefs.h 1.14 99/04/08 SMI@(#)nexusintr.h 1.7 99/04/05 SMI@(#)cmn_err.h 1.29 99/03/23 SMI@(#)ddi_implfuncs.h 1.32 00/08/22 SMI@(#)ddi_isa.h 1.8 99/07/14 SMI@(#)model.h 1.20 97/09/22 SMI@(#)devctl.h 1.15 00/12/11 SMI@(#)nvpair.h 1.1 00/07/14 SMI@(#)sunpm.h 1.7 00/06/08 SMI@(#)sysevent.h 1.2 00/10/10 SMI@(#)openpromio.h 1.17 99/05/05 SMI@(#)ddi_impldefs.h 1.69 00/12/11 SMI@(#)autoconf.h 1.31 99/06/04 SMI@(#)dacf_impl.h 1.1 99/01/26 SMI@(#)dacf.h 1.1 99/01/26 SMI@(#)devinfo_impl.h 1.6 99/09/10 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)types.h 1.66 00/02/14 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)libcpc.h 1.1 99/08/15 SMI@(#)cpc_event.h 1.1 99/08/15 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)libpctx.h 1.1 99/08/15 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)ucontext.h 1.13 98/07/27 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)cpucmds.h 1.1 99/08/15 SMI@(#)processor.h 1.6 98/02/06 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)types.h 1.66 00/02/14 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)libcpc.h 1.1 99/08/15 SMI@(#)cpc_event.h 1.1 99/08/15 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)libpctx.h 1.1 99/08/15 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)ucontext.h 1.13 98/07/27 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)cpucmds.h 1.1 99/08/15 SMI@(#)processor.h 1.6 98/02/06 SMI@(#)pset.h 1.2 98/01/06 SMI@(#)priocntl.h 1.14 98/02/24 SMI@(#)rtpriocntl.h 1.12 98/01/06 SMI@(#)thread.h 1.105 00/08/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)klwp.h 1.36 99/07/28 SMI@(#)pcb.h 1.33 00/08/22 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.37 99/11/16 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)thread.h 1.47 98/08/14 SMI@(#)synch.h 1.46 99/11/15 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)libcpc.h 1.1 99/08/15 SMI@(#)types.h 1.66 00/02/14 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)cpc_event.h 1.1 99/08/15 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)libpctx.h 1.1 99/08/15 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)ucontext.h 1.13 98/07/27 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)cpucmds.h 1.1 99/08/15 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)processor.h 1.6 98/02/06 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)libcpc.h 1.1 99/08/15 SMI@(#)types.h 1.66 00/02/14 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)cpc_event.h 1.1 99/08/15 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)libpctx.h 1.1 99/08/15 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)ucontext.h 1.13 98/07/27 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)cpucmds.h 1.1 99/08/15 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)processor.h 1.6 98/02/06 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)libcpc.h 1.1 99/08/15 SMI@(#)types.h 1.66 00/02/14 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)cpc_event.h 1.1 99/08/15 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)libpctx.h 1.1 99/08/15 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)ucontext.h 1.13 98/07/27 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)cpucmds.h 1.1 99/08/15 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)processor.h 1.6 98/02/06 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1cg: Sun WorkShop 6 2000/04/07 Compiler Common 6.0@(#)libcpc.h 1.1 99/08/15 SMI@(#)types.h 1.66 00/02/14 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)cpc_event.h 1.1 99/08/15 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)libpctx.h 1.1 99/08/15 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)ucontext.h 1.13 98/07/27 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)cpucmds.h 1.1 99/08/15 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)processor.h 1.6 98/02/06 SMIacomp: Sun WorkShop 6 2000/04/07 C 5.1ld: Software Generation Utilities - Solaris-ELF (4.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.cpp_finidata.rela.data.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.cpp_finidata.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrbus.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa bus.c -W0,-xpcpu.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa cpu.c -W0,-xphar.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa tick.il har.c -W0,-xpmainus2.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa us2.c -W0,-xpus3.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa us3.c -W0,-xpus3p.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa us3p.c -W0,-xpus3i.cXa ; O ; V=3.1 ; R=Sun WorkShop 6 2000/04/07 C 5.1/home/fparient/har/src-1.4; /install/SC6.0fcs/SUNWspro/bin/../WS6/bin/cc -c -xO2 -dalign -xarch=v8plusa us3i.c -W0,-xp   `" EoDD-B0 =B$$  PB00  [B<<$ eB``d ouP{,, xx|| ($$ 00:XS J    1p =H >h0707010000777c000081ed0000000000000000000000014a2fa9f40003fd20000000200000001d00000000000000000000001a00000000root/etc/STATsrv/bin/har2ELF\44 (44qqtt 4hh/usr/lib/ld.so.1 !"#$%')*+,-./0589:;<>?@ABDEIJKLMNPQSTXYZ[]^abefghjlmopqsuvwx{}     "#$'(*,./01345678:;<=>?@ABDEFGIJLMPQRTUVWXZ\^_`bcehimoprsuwy|  &(123467=CFGHORUVW\_`cdiknrtyz|~ !%&)+-29CHKNOSY[]adfgjklnqtvxz{}~8` %ը( ;xJU۔X  4 b  G n@ < ^  |$ 0 /  Ө$ w dh *"G,V qi4 t  (\<Dx  WcD nv8(  Dx $  Cx $ $ 083< X l! x  (x ݼڀ'0_| (T $j 2  \(| $ ` ^ ,  p ܄ '(( ڼ8( &  ,<E,$ YۈdԤ      0Ҭ TD e<( p xX  4t \   b0( `  x I ;4t fh\ $ x  , h `$ R\ @, 7܄  |  8 ژ d$ @ `$  ;PX 8  8 $ *     ݤ'-ڰ4 J qm   A ˌ$ d4  1:x  h հ     ' K  g  P$ $ ڌ 8`  hHL D  _ !_ ,H [5  X ۬$ 8P +l Y۠`Tz| Tqƈ$ ; 0 ( <6 cmt 0  x  `t  ۸Ȅ  7? e l@44 @l  t"d =. P/0  lxX \ը(  0V@ h  H Zܨg X$ D("x S٨Z  X x  H ܜ;l <$   X ?/` b(8t8  a4 D   : H  ( 5( H  d` al  $$ ( , .x  S  yܸ   x8 D ! 0H B ` dvI [h ?t ]   h| ݌ $ ,  =XYݘh`h @" I  2!$ P _ !$=@l do i݀y@!~$ (h *  @xX L"  38 E j`D 0   $! " < ! >  !. p !@ch !Wp8!h!pH !$ !!m  ! !!|$ "@ "> X "cl", "X  "$ "h #'#.&4 #L@#ZiX #4#x $<$x  $h  $( $t $ %( %)\ %<ܴ%I'` %sh%{PP % %D%߰%I  %t  %`D &$ &H&2d$ &C(&^@l &|4"&ƈ &8t &h&4 'B@ p 'U$ 'ht's$ '0( '  '' '؈$ ' @  (  ( ((ݰ(L(  )@ p )*8)<)D)Md)]$ )pX)y(  )t  )PP )`)\  )ش$ )  )( *"  *6 *WH`*f *ȸd *$ **( *"+ + P +G8$ +Xl  +z +d$ + ,P,,܌ ,9X ,V  ,g,np ,  ,8,|(ٴ,8,ڤ,Px@ܐ__1cDUS2Pper_instruction6MippXdd_v___1cHSparc642t5B6M_v___1c2k6Fpv0_v_thr_create__1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___Hreplace6MIIIc_r1_pset_assigncpc_npic__1cPcpc_setgrp_free6FpnM__cpc_setgrp__v___1cCP6Lprint_title6M_v___1cKsum_metric6Fii_d___1cHSparc64Tprint_memory_percpu6MipnGtstate__v___1cEUS4pRper_second_memory6MippXdd_v___1cEUS4pPper_instruction6MippXdd_v_.ld_llong__RTTI__1CpknEUS4p___1cDUS22t6M_v___div64__1cEXeon2T6M_v___RTTI__1CpnHOpteron___1cEUS4p2T5B6M_v___1cEUS3iRper_second_memory6MippXdd_v___1cH__CimplKcplus_fini6F_v_cpc_set_sample__1cEUST1Lprint_title6M_v___1cEUS3iLprint_title6M_v_vfprintffree_GLOBAL_OFFSET_TABLE___1cDCpuLgetPiEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E______cpc_walk_events_pic__mul64__1cEUS3p2t5B6M_v___1cKavg_metric6Fii_d__Q_qtoucpc_buf_createcpc_version__1cCP62T6M_v_di_fini__RTTI__1nDCpu___1cDUS3Kper_second6MippXdd_v_di_init__RTTI__1CpknEUS3i___RTTI__1CpnDUS2___1cCP6G__vtbl___1cG__CrunMex_rethrow_q6F_v_snprintf__1cMcpc_strtoset6FpnF__cpc_pkci_pnJ__cpc_set____1cHOpteronKper_second6MippXdd_v___1cEUS3p2t6M_v___1cHOpteronNprint_metrics6MipFii_d_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2t6Mpkcrkn0C__v__Q_utoqsysconf__1cG__CrunIex_throw6Fpvpkn0AQstatic_type_info_pF1_v_v___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t5B6Mpkn0D_4rkn0E__v___1cRcpc_setgrp_newset6FpnM__cpc_setgrp_pkcpi_1_optind__1cEUS3iNprint_metrics6MipFii_d_v___1cHSparc64Rper_second_memory6MippXdd_v___1cHOpteronPper_instruction6MippXdd_v___RTTI__1CpknHOpteron___1cDCpuMcalc_metrics6MippXdd_v_.ld_float__1cQcpc_setgrp_reset6FpnM__cpc_setgrp__v___1cDUS32t6M_v___1cDUS2Rper_second_memory6MippXdd_v___1cDCpuLgetPrEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E______pset_bind__1cDstdJbad_allocG__vtbl___1cEUST12t6M_v__endtargetCpu__1cHOpteronRper_second_memory6MippXdd_v___1cDCpuOsetMetricsType6Mi_v___1cG__CrunHex_skip6F_b___RTTI__1nHSparc64_cpc_cpuref__1cEUST2Tprint_memory_percpu6MipnGtstate__v___1cEUS3pKgetCpuType6kM_pc___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2T6M_v___1cCP6KgetCpuType6kM_pc___1cEUST2Nprint_metrics6MipFii_d_v___1cEUST22t6M_v___1cEUS3pNprint_metrics6MipFii_d_v_cpc_cciname__1cEUS4pNper_reference6MippXdd_v___1cEUST1Uprint_memory_metrics6MipFii_d_v___1cScpc_setgrp_nextset6FpnM__cpc_setgrp__pnJ__cpc_set____1cDstdEendl4Ccn0ALchar_traits4Cc___6Frn0ANbasic_ostream3CTACTB___4___1cEUS4pNprint_metrics6MipFii_d_v___1cDCpuLgetPsEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E_______PROCEDURE_LINKAGE_TABLE___1cEUS3iNper_reference6MippXdd_v___1cEUST2Uprint_memory_metrics6MipFii_d_v___1cDUS3Pper_instruction6MippXdd_v___RTTI__1CpnEUS3i___1cEUS4pKgetCpuType6kM_pc_strdup__1cDCpuLprint_title6M_v___RTTI__1nEUST2___1cEUS3iPper_instruction6MippXdd_v___1cEXeonRper_second_memory6MippXdd_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2G6Mrk1_r1__Q_mul__1cEUST2Pper_instruction6MippXdd_v___1cEUS3pG__vtbl_processor_info__RTTI__1nEUS3i___1cHSparc64Nper_reference6MippXdd_v___RTTI__1nDUS2___1cG__CrunKvector_des6FpvIIpF1_v_v___1cDstdEcopy4Cpkn0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____Cp1_6FTA5TB_6___1cEUS4pG__vtbl__lib_version__1cHOpteronG__vtbl___RTTI__1nEUST1___1cEXeon2t6M_v___1cHOpteron2T6M_v___1cEUST22T5B6M_v_cpc_set_add_request_exitstrcmp__1cHOpteron2T5B6M_v___1cEUS4pMprint_percpu6MipnGtstate__v___1cEUS4p2t5B6M_v___1cDstdNbasic_ostream4Ccn0ALchar_traits4Cc___Dput6Mc_r1___1cEUST12T5B6M_v___1cEXeonNprint_metrics6MipFii_d_v___RTTI__1CpknCP6___1cFgtick6Fpv_0___1cNget_bus_clock6F_d__environ__1cDstd2l6Frn0ANbasic_ostream4Ccn0ALchar_traits4Cc____pkc_2___1cDCpuXsetMemoryMetricsCapable6Mb_v_errno__1cHOpteronNper_reference6MippXdd_v___1cDUS2Kper_second6MippXdd_v___1cDUS3Lprint_title6M_v___1cEUS3pNper_reference6MippXdd_v___1cEUST1Nprint_metrics6MipFii_d_v___1cEUST1KgetCpuType6kM_pc___1cHSparc64KgetCpuType6kM_pc___RTTI__1CpnEUS4p___RTTI__1CpknEXeon_calloc__1cDCpuG__vtbl_.st_double__1cDCpuOgetMetricsType6kM_i___1cDhar6F_i___1cDUS3KgetCpuType6kM_pc_.st_llong.ld_double__1cScpc_setgrp_getname6FpnM__cpc_setgrp__pkc___1cEXeonPper_instruction6MippXdd_v___1cDCpu2T5B6M_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2G6Mpkc_r1___RTTI__1CpnDUS3___1cDUS3G__vtbl___1cQcpc_setgrp_clone6FpnM__cpc_setgrp__1___1cEUS3iTprint_memory_percpu6MipnGtstate__v_getopt__1cG__CrunIex_clean6F_v_strrchr__1cCP62T5B6M_v____Argvstrtoset_errfn_etextcpc_bind_cpu__RTTI__1CpknHSparc64___1cEUS3pMprint_percpu6MipnGtstate__v___1cDCpuNgetNbCounters6kM_i___1cDUS2Nprint_metrics6MipFii_d_v___1cEUS3pRper_second_memory6MippXdd_v___1cEUS3iUprint_memory_metrics6MipFii_d_v___1cEUST2KgetCpuType6kM_pc___1cHSparc64Kper_second6MippXdd_v___1cDUS3Uprint_memory_metrics6MipFii_d_v___1cHSparc64Lprint_title6M_v_strcpy__1cDUS2KgetCpuType6kM_pc___1cEUS3pTprint_memory_percpu6MipnGtstate__v__edata__1cEXeonLprint_title6M_v___1cEUST1Mprint_percpu6MipnGtstate__v___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2G6Mrk1_r1_strtoll__1cEUS4pLprint_title6M_v___1cEXeon2T5B6M_v___1cEXeonKgetCpuType6kM_pc___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____J__destroy6Mpn0D_3_v_strerror__cg92_used__1cHSparc642t6M_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___J__nullref___1cDUS22T5B6M_v___1cDCpuJgetEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E________1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2T5B6M_v___1cDUS32T5B6M_v_di_walk_node__1cEUS4pTprint_memory_percpu6MipnGtstate__v___RTTI__1CpnHSparc64_cpc_buf_add__1cDstdZ__RTTI__1nDstdJbad_alloc___ex_register__1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t6Mrk1_v_atexit__1cDUS3Mprint_percpu6MipnGtstate__v___1cDCpu2T6M_v___1cEUS4p2T6M_v___1cRcpc_setgrp_gethdr6FpnM__cpc_setgrp__pkc_di_prom_init__1cEXeonKper_second6MippXdd_v___RTTI__1nCP6___fsr_init_value__1cDUS3Nprint_metrics6MipFii_d_v___1cEXeonNper_reference6MippXdd_v___1cEUST1G__vtbl___1cHOpteronKgetCpuType6kM_pc_.st_float_foreff__1cEUST22t5B6M_v___1cDCpuNprint_metrics6MipFii_d_v___1cEUS3pLprint_title6M_v___1cDCpuUprint_memory_metrics6MipFii_d_v___1cHOpteron2t5B6M_v___1cEUST12t5B6M_v___1cDstdJexception2T5B6M_v___1cEUST1Kper_second6MippXdd_v_.st_double_foreff__1cScpc_setgrp_getbufs6FpnM__cpc_setgrp_pppnJ__cpc_buf_55_i___RTTI__1nEUS4p___1cDstdJbad_alloc2T5B6M_v___1cScpc_setgrp_sysonly6FpnM__cpc_setgrp__i___1cHSparc64Sprint_memory_title6M_v___1cDCpuMprint_percpu6MipnGtstate__v___1cDUS2Mprint_percpu6MipnGtstate__v_strncat__1cCP6Rper_second_memory6MippXdd_v___1cEUS3iG__vtbl_strlenuk_string__1cOcpc_setgrp_new6FpnF__cpc_i_pnM__cpc_setgrp____1cCP62t6M_v___1cDCpu2t5B6M_v___1cCP6Nprint_metrics6MipFii_d_v_cpc_walk_requests__1cEUS3i2T5B6M_v_di_prom_prop_lookup_bytesatof__rem64__1cEUS3iKper_second6MippXdd_v___1cEUS3pUprint_memory_metrics6MipFii_d_v_atoi.ld_int__1cCP62t5B6M_v___1cDstdSuninitialized_copy4Cpkn0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____Cp1_6FTA5TB_6_strncpy__1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t6Mpkn0D_4rkn0E__v_getsubopt__RTTI__1CpknEUS3p___1cEUS3pKper_second6MippXdd_v___1cG__CrunKpure_error6F_v_cpc_set_create__1cEUST2Nper_reference6MippXdd_v___1cG__CrunVdo_exit_code_in_range6Fpv1_v___1cDstdJexception2T6M_v___1cEUS3i2T6M_v___RTTI__1CpnDCpu___1cEUST1Rper_second_memory6MippXdd_v_.st_int__1cG__CrunIex_alloc6FI_pv___1cEUST2Mprint_percpu6MipnGtstate__v_maincpc_walk_attrs__iob__RTTI__1CpknEUST2___1cEUST1Nper_reference6MippXdd_v___1cEXeon2t5B6M_v___1cEXeonMprint_percpu6MipnGtstate__v___1cG__CrunMdo_exit_code6F_v___1cDCpuWisMemoryMetricsCapable6kM_b___1cEXeonG__vtbl___1cEUST1Pper_instruction6MippXdd_v___1cRcpc_setgrp_getset6FpnM__cpc_setgrp__pnJ__cpc_set____1cDUS22t5B6M_v___1cDCpuSprint_memory_title6M_v___xargv__RTTI_____1cEUS3pPper_instruction6MippXdd_v___1cEUS3pSprint_memory_title6M_v___1cDUS32t5B6M_v___1cKmax_metric6Fii_d___1cDUS2G__vtbl_setvbuf__1cDCpu2t6M_v___RTTI__1CpknEUST1_strncmp__1cEUS4p2t6M_v___1cHSparc642T5B6M_v___1cDstdNbasic_ostream4Ccn0ALchar_traits4Cc___Fflush6M_r1___RTTI__1nHOpteron___1cQcpc_setgrp_accum6FpnM__cpc_setgrp_1_v___1cCP6Mprint_percpu6MipnGtstate__v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2t6Mrk1_v___1cDCpuKgetCpuType6kM_pc___1cEUS4pSprint_memory_title6M_v___RTTI__1nDUS3___1cScpc_setgrp_numsets6FpnM__cpc_setgrp__i___dtou__1cHOpteronLprint_title6M_v___1c2k6Fpv_v___1cEUS3iMprint_percpu6MipnGtstate__v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___I__unLink6M_v___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t5B6Mrk1_v___1cDstdNbasic_ostream4Ccn0ALchar_traits4Cc___2l6MpFr1_2_2___1cDUS3Tprint_memory_percpu6MipnGtstate__v___1cDUS22T6M_v___1cDstdJbad_alloc2T6M_v___1cEUS4pUprint_memory_metrics6MipFii_d_v___1cEUST2Lprint_title6M_v___1cHOpteron2t6M_v___1cEUS3p2T5B6M_v_di_prom_fini__1cHOpteronMprint_percpu6MipnGtstate__v_gettext__1cDstdJbad_alloc2t5B6M_v___xargccpc_buf_copy__environ_lock__1cEUS3iKgetCpuType6kM_pc___1cEUST2Sprint_memory_title6M_v_.st_float__RTTI__1CpnEUST2___1cG__CrunKex_rethrow6F_v___RTTI__1CpnCP6___1cDstdJexceptionG__vtbl___1cCP6Kper_second6MippXdd_v__ex_deregister__1cEUST2Kper_second6MippXdd_v___1cHSparc64Uprint_memory_metrics6MipFii_d_v__DYNAMIC__1cH__rwstdJ__destroy4CpnDstdMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc_____6FTA4_v___1cEUS3i2t5B6M_v___RTTI__1CpnEUST1_cpc_unbind__RTTI__1CpknDUS3___1cHSparc64Pper_instruction6MippXdd_v___1cEUS3p2T6M_v_malloc__1cDUS3Rper_second_memory6MippXdd_v___RTTI__1nEXeon___1cDUS3Sprint_memory_title6M_v___1cDCpuRgetPsMemoryEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E________1cHSparc64Nprint_metrics6MipFii_d_v___1cH__CimplKcplus_init6F_v_cpc_set_destroycpc_open__1cEUS4pKper_second6MippXdd_v___1cEUS3i2t6M_v___1cEUST2G__vtbl_reallocpriocntlcpc_seterrhndlr__RTTI__1CpknDUS2_cpc_caps__1cDUS32T6M_v___1cEUST1Sprint_memory_title6M_v___1cDstdJbad_alloc2t6M_v___1c2n6FIpv_0__start__RTTI__1CpnEXeon___1cEUST12T6M_v___1cCP6Pper_instruction6MippXdd_v___1cHSparc642T6M_v___1cCP6Nper_reference6MippXdd_v___1cDstdEcout___1cHSparc64Mprint_percpu6MipnGtstate__v___1cDUS2Nper_reference6MippXdd_v___RTTI__1CpknDCpu_metrics__1cWcpc_setgrp_has_sysonly6FpnM__cpc_setgrp__i__get_exit_frame_monitornanosleep__1cEUST2Rper_second_memory6MippXdd_v___RTTI__1nEUS3p___1cEUS3iSprint_memory_title6M_v___1cEUST1Tprint_memory_percpu6MipnGtstate__v___RTTI__1CpnEUS3p___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2T6M_v_cpc_buf_destroykonly_string__1cDUS2Lprint_title6M_v___1cDCpuNsetNbCounters6Mi_v___1cEUST22T6M_v_perror__1cDUS3Nper_reference6MippXdd_v___1cDCpuTprint_memory_percpu6MipnGtstate__v___1cHSparc64G__vtbl___1c2n6FI_pv_cpc_buf_tickp_onlinecpc_buf_getlibcpc.so.1SUNW_1.2librt.so.1SUNW_0.7libdevinfo.so.1SUNW_1.1libthread.so.1SISCD_2.3alibCstd.so.1SUNW_1.1.1libCrun.so.1SUNW_1.5libc.so.1SUNW_1.21SUNWprivate_1.1libm.so.2/usr/lib/lwp:/ssc/software/compilers/SS11.latest/sparc/SUNWspro/lib/rw7:/ssc/software/compilers/SS11.latest/sparc/SUNWspro/lib/v8plus:/ssc/software/compilers/SS11.latest/sparc/SUNWspro/lib:/opt/SUNWspro/lib/v8plus:/opt/SUNWspro/lib:/usr/ccs/lib:/lib:/usr/lib- ='-- =(-"-+ ='-;-D O-S-^0 '!-k ='--v ='--y- Nq-D`hp xH{(S8F$9٨ٴzE` ,8DP\hHt\ڀ5ڌژlڤڰ{ڼD4i"($4<@:LhXpdnpV|ۈN۔۠۬۸m8) -$06<LHQT`tl3x܄hܐܜܨܴF,l. ,c8#DKP\ht݀݌ݘݤyݰgݼ3p>/f(4U@ LX @9"b D9"b7"cԥ, @'7Ȁ $+`-` `?-)7#- =--% # @@ x7#؀ 7#܀@@yt@~@@ "      **`* @*  ""  "     + **      + **     **   㿘 "    //// 77㿘 "" "   ////    ////   7777 `" 2 2 *@2 *`2 *`*`2@2`""2 2 **2 **2`*2`*2`**222`22"㿘`" 6 6 6 6 .@.`.`.`'6@6`'㿘" &"6 6 6 6 ....6`6`6`....?6`6666?&`" 2 2 2 2 *@*`*`*`2@2`"""2 2 2 2 ****2`2`2`****2`2222"㿠'H%9 a#7c@ c  a@!9  @㿈!?@9"* @.`@``D??%$%$㿐ڒ@' ?%$%$㿈!?@@9"*` .`@``聩?`?%$%$'DD`@@@'@'%7  @ Ж@@e@''@ 沖@]@'_0p @ 沖@T@' @Q, 'LL!7#@ !9  @C, L, & 'L' !7# #9`$`@-?tpl@D@'P@$`$l @" `$l@ 'X'\`$t l @'HH!9 @-!9 $l `@ @ !9@ !'h!9  !@!7# h@א@l'_`0p .H,  ` ` 'H_X0p ., ` `!9 $@ !9  !@!7# `!9@!@@ܣ@@@y!7#  `H`@`D!7# 8 <;XX\;XX@?]'' '` !9@ܤ!'h!9  !@ܟ!7# `h@p@!9 $@ܖ''@܌ @܌ P!9  !@x!7# @K@ '@@$@q@'``@,,$ @$ D',,'''`?, , '@@R  $ , ![#`@#7c$ 8$ @ & Ⱥ` )7#  @ Ж@@0@#  @%@@'p't@ 沖@@'h_p0p @ 沖@@'lh@# / "yb@9!7#  !7# h@"b@$!7#  ,!7# @ 0@! !7#  !7# h@Ӓ!7#  ,!7# @ 0@'@@,`,`'d`? @,`d$   '`@ݐ'iHiHi$h㺸'D''''Ԡ'''$  'Ƞ''''ܐ H@ڻ#@!" ?8 ?@@8(@ڲ#@(: 0@ڮ: ' '(@'0'''@'$'$$ '̠g'|h''xx'' $''9''('' $'''''''` $`'\`'t /'ptp@k'%7$  `$$ @[' ;"@"'@N'!9  !7#  @ 'h@@@Ԣ'0 '4''(`',,Ф$< < @' '$' , '@%@v @#'!9@<$ $@''`"@'!9  !7# `@٨ 'h@@Ԣ''''`'Ф$< < Ԁ@''', '@@3!9 $@''X!9 $Xa@#Xa!8$ T!9 $@''TTb@ٟ'  Tc @ٕ'  P@''@!7$#Tc@}'  P@٨''@!7$#Tc(@e'  P@ِ''@2!7$#Tc@@M'  TcP@C'  P@n''@&'!7$#Tce@+'  P@V'xx'||@=|!7$#Tct@'tt  P@>'ll@J>!7$#Tc@'hh  Tc@'dd  P@'\\@P!7$#xTc@'XX  P@'PP@_!7$#bTc@'LL  P@'DD@e!7$#LTc@ر'@@  P@'88@Wb!7$#6#@؊'!9  !7# T@X 'h@ح@:Ԣ'0 '4''(`',,Ф$< < @' '$' , '@ؒ@!7#@'!9$ !9 $@ؐ'!9 $@ؑ' !9 @^#c!7#$ ?!7#$  !7#$ !7#$ #Xc!7#$ 0!7# @/[h'hh 'll?'dd '`h` O[@^h'\!9 $!7#@ ''!7#@5$  ?@'!9  !7# @ 'h@#@Ԣ''''`'Ф$< < ̀@'''ܡ, '@@YDP@@'?'䀤 !7#` $`!7# @!7# @{!7# @t!7#$  !7#$  '\/h' '?' 'h O@h'h!7#@h!7#@|#Xch!7#v$ 0t`^@׻p@׸'?' a@ײp''l?l4 ?l$ ? @ן'?' @יG C'A􀤠k&RD?iMlh Ra}i\p $k , !a $p , !a (D!7#@̒D@4!7#@ 4'H`'T`'PTP$< < 'L'@'', ''' '!7# @'||!7#$ `0;!9"$ , @@ 'xx!7#$ !9"$, @@?pp!"D';X[X0p @!7#$  'D!9"$$ , !a !7#` `  '䀤 \ !7# @ 'll'!7#`:$ \!9  @?,!9  ' @G'``!7# @\ "@U"@Q!9@M!@I"T@D@ @!7# @ !9   @@y'\\'48<@@'@'D8' '8`'<<8$< <  @''4'0, ',@%@DHL@P''H''`'  H$< < @''', '@@h@@Ԣ''''`'Ф$< < @'''С, '@@64@@h@C@@@@@|@ǐ@Ð@տ@ջ@շ@4@D|}||{{}|{{}||h  @# '' '`'< < '̢@@'', '@|@㿀@@ '''`@''@a@X'D'HHD@5'`'` '$< < ' '`'`'$< < g'''' '$< < ''', '@+'@'@O @X'!7#c(@I'D 'LH 'dH '`d`@'DD'hh'H L$'TP'\'X'PD w D`'p` ' '$< < p 'l'',`'|@ϐDp$  '@`'<@<$< < '8'4 '040$< <  ', '$' `'$ @+'(D0 D ' ' '`'  $< < '`',`@ H'D``'`'$< < '''`''$< < '-,@JD'H`'`'Ԥ$< < 'ܣ, $-'+@ԃ* 4  'H`'`'ؤ$< <  '''С,`'@'@g8@W@d@S'HH@'`@ @M@@H'@4* 4   @^@,@@@1@$@㿐9"8"`'㿘'㿐%98& '#9b(& & @@ 㿠9b(& 㿠'D㿐@''@ӄ@ 㿐@ '`@@Ò@'x'!#(7c@Ӯ'܀'@x @ @ӧ'؀'#2@l@ c@Ӛ #?@]@Ԑ @Ӓ@ӓ?㿐@`L@Ӆ  #a #Тb@< .! ' $ $ ?@#8` & &  'D'@$`$`` ''|'$  'HH'P'd'\ P@#@!# ?@ ?H@@0@#@ 0: 8@: 'x (@''t'hh'LP@'' D$  ''$`$`` '8'4'<$  '''' P@ґ#@!# ?@ ?H@@0@҈#@ 0: 8@҄: '0 (@'','  '@$  $''$`$`` '''$  '''Ը'̐ P@P#@!# ?@ ?H@@0@G#@ 0: 8@C: ' (@'''ؤ'@$  4'l'h$`$`` '''$  'pp'x'' P@#@!# ?@ ?H@@0@#@ 0: 8@: '` (@''''tx@`l$  @'dd '!9  c`@ъ @с@G'``& DB 4@ $> < @#8` &  4``@N` '_'`'|`&@< < '`@'x't, 'p@ѧ@ $  / '' '`%< < '@'', '@ш@  ''''`'$< < ̀@'''ܡ, '@g@ '   ' '$ ''`'$< < @''', ' @F@@x $  @nȺ 4``@` 'X3'\`'P`&@< < '4@'L'H, 'D@@ $   'g' '`%< < 'h@''|, 'x@@ y ''Ĥ''`'$< < @''', '@А@ ' Y Ȣ '' ''`'$< < Ԁ@''', '@Я@ 4 $    @@㿘'D#'㿘 D@㿠& D㿘 H@㿠& H㿘 L/`6 㿠.`2`. L㿠`@㿠`$@㿠`@㿠`4@㿠'`@ސ`$@א`@А`4@ɐ`@`H$  , !f#4P㿠'P'T'X\F'\  PX@;XX\;XX  PX@;XX\;XX  PX@;XX\;XX  PX@;XX\;XX H$  , !g!HD㿠'D㿠'D㿠'D'H'L㿠'D'H'L㿠'D'H'L㿠'D'H'L㾘& &  '@'<` 'LK'8'D$` '''Ⱥ' (@ #@!# ? ? @@#@: @: 'ܠ` (@'''̤'@ &  '''x`'`'$< < 't'p', '@'|@'@ !8 Dc(@ @ $`` $  'T'P $'\X'd'`'X㿘@ '?$ $ $ $ '㿘'H'L'P'T\'\`'`'` "`` *㿐'L'P'T'X\'\`'`\@`,``\@Δ  \?.`%`-  @.`%p'L  @$@L` $`   , , @Ν'!9   c@@ǐ@Ϳ&   , , $ , , $   , , ,   , , h@n@``, ,    %`  , ,  @,   , , $  , ,  , , @ؐ   , , $   , ,  hX@/@  , ,  ,   , ,  @  -`@   , ,   , , @ ݸ  @,@@'  , , $ !9   @E@@ @@'ܨ  , , $  @@'ب  , , $  @Ւ@'  , , $ !9   @@@ސ ` $` ` $`㿘 ` @  ? *`*` &` `* * @ & `* * @ & `* * @ @㿈@  , , @ & & && &  &@@,`,` @ '/`/`'!9   @̕@k@c /`/`@: '/`/`$ !9   @z@P@H /`/` ,  $ @/`/`$` @`/`/`$` @ `/`/``$` `!9  !@=@@  /`/`  @  /`/`  @  /`/`  @ h`'㿈'DD`` ?$D `Z ,`,`@ D  , , @  D  , , @ D   , , @̓ D   , , @̉ D   , , @ D D`?`--`, , ' $`&' %㿠  ` @@˯`@˭㿘`` `**@@㿘`` `**@ @㿘`` `**@ @㿘 @㿘   $@$@㿠 ` "`㿘@ `@@@`@ ,`,``` ``@`㿘  * * @ @㿘 @㿘 @͒!9  !;@ʹ@ʏ@ʇ@'㿘'H'L'P'T'X#8`T H'`T!\?㿠'H@%"  !9$ p㿘#9$`p!9 tl@@+@`p@㿘!9 x?@  !9 |- - L ?@!9 x?@!`@!9 x@@ʒ #9` $`!9 |/`/` @" `㿘!9 .  )9 |@-`-` L  !i@@g/?@@L`  !@@V?@@  !@@G@?#9` $` |/`/` @@ʟ"㿐'H!9 .  $@?,'!9 x@2+9`. -@Β  !9 |/`/` "` ?$``. @ɻ  !9 |/`/` "` $`??ͺ`㿈!9 .  $@?,'!9 xA@ !9 . $@@-'`'` 쀤@ !@``@@|@ ?  $$ '9-`@'`$!9 |-`-` "` $``㿠a@@͔    & 㿘'm@ߐ@㿐'@@ɧ  @ɴ@'   ' !9 /` $@N@Őh'D'H'LD%9$t!9$ @{t%9$x* * @!9$ |x@, !9$ '-9x@7+9`|,`,` , `|, , $" `|, , $"@Ő )9 , $' , $ @<` ,`$ $  , $  '#9u`t%9$@* !9$ '`tm0@Lx,\@ %9$@,`!9$ @, !9$ @, !9$ '!9 @!9 ,`$!9 , $ ''!9 x@%@b '9/`$@!"! @ +9`/`$`,$ 'l!9 /`$` ''!9 x@$@8 '9/`$@!"+ @” +9`/`$@`$ 'l!9 /`$` ''!9 x@$@ '9/`$@!"; @ș +9`/`$@`$ 'l!9 /`$` ''!9 @`!9 ,`@ ''!9 x@+@'9/`$@E'9, @^, +9`/`$@`$ 'm@!9 /`$` '@'9/`$@J'9, @6-+9`/`$@?`$ 'm@!9 /`$`'/M79/`$@19  /`$@? $ 5l39``$`/`$@ /`$@? $ `$`/`$@H   ?#h@ǚH'L *!9 @'Ԁ?؀  "c@.!9 ԣ* ؟?!9@ t '"s@f@ݐ'!9 xc!9 |- - L VL @!9 |, , "@, ''!9 , '@`- $``` $`$`  '`')9 t!9 |, ,   #\@nj#`?@ t@LJ"@Ʊ!9@ƪ!@ @ '@'@  !9$!'㿐@!9 @ !9 ,`@Ƥ`!9@Ɵ @!9 x@!9 ,`@`@ƍ@`!9@Ɔ @!9 ?@ !9 ,`@y`!9@t !9@q |!9@n !9@k 㿘+9`|. . " @G !""   " " '9. @" $`|. . "` $`+9`|. . " @# !""   " " '9. @" $`|. . "` $`㿘@Ր "@=@Ŵ@'㾸898`p& 3 p& b. LВ@Ɯϐ`@Ƙΐ`$@Ɣ͐ `4@Ɛ̐`D@ƌː`R@ƈʐ``@Ƅɐ`s@ƀȐ `@|ǐ$`@xƐ(`@tŐ,`@pĐ0@ q`@ca@_~a@[} a.@W|a>@S{aL@OzaZ@Kyam@Gx a@Cw$a@?v(a@;u,a@7td0@c 8d<<a@*;b@&:b@"9 b(@8b8@7bF@6bT@5bj@4 b@ 3 $ @Y $ $($, @+7@W+7  ` @hdlhp "@@E  @ "@@5  @Җ-7   @ǖ/7 -7 +7` )7 '7 %7  #7 ` !7 7 7` ld7   @ŝ(7% 7" 7` 7 7` 7 7 7 7 ` ;7 ` 97 77 37` 9/7   @j@8`p" aC0A@i?@Yr#ȇ*` ## D* 9** `"*b*&'******ʃʿʫKA_IWWH]#***ʓEICHGIہ*; [`Z` sp D+ @  D4* 5 p`bA./":#;**ʏWʃʗIUEWAHGʷ]ʓG˗ʿ]IWWK******HCIS]IۏHCIїIG;``"# bʷʄ]["#**ʃWʋUGAIWIݙ**8 X`  [ @ shZ X`b s`h"#`ʫʇAU"#**ʋWʗI_EWH]ñ**ՏIM:` "#bʿʘ@I_"#**ʻWʫCEH]IWHGˉ**߃IM; "#`bʋʒCE"#**ʏIWʿKAHGW]ե**œM:`( "#ʃʿKA"#`**"#  ʻWʃʋUG]IWʻA"# **"#`b**"#IIWʏC߿ʗIEʃW_ʓGHAʃIWK*****Ç]AWHEʓE*HG˿HAM:`0$ $"#bʏʘ@CG"#**ʓIWʫAI_IWM]; 8(("#`bʃʒKA"#ʫWʋCUGIWIMI:`@, ,"#bʇʆ@_C"#ʋIWʃKEUIWIM]8HxC0A@is#Ї*` ## D * 9** `"*b*&'******ʃʟʛKAOIWWHU#***ʃI_E*HGI; [`Z` sx D+ @  D4*  5x`bO_./":#;**ʻIWʟʏEʛIWH]ʃʏEHKOWIISûWAHK]******IۗHGIџIK; `"#`bʇʖ_C"#**ʻIWʏEU]WI͙**:XX` #[` Z`"@spp"# bʷʒ@A["#**ʻWʫGIH]IWHKϱ**:`Z Z shh"# bʋʒ@CE"#**ʻWʓUK]IWMI߉**:` Z Z s``"# bʏʒ@[G"#**ʻIWʗIMH]WO**:`( "#ʫʏEU"#`**"# ʻWʋʛKOH]IWʏE"#  **"# b**"@#ʻWAʗIMÿAW]ʃʗʋCʻIAKIW******ŋWMHG_EɗH]:`0$ $"#bʃʄ@MA"#**ʇWʏEICWH]88( ("# bʇʒ@OC"#ʋIWʓGUEIW]:`@, ,"#bʋʆ@AE"#ʏWʫIKGIWH]8HC0A@ipu#*` ## D* 9** `"*b*&'******ʃʟʛKAOIWWHU#***ʃI_E*HGI; [`Z` s D+ @  D4*5 bO_./":#;**ʻIWʟʏEʛIWH]ʃʏEHKOWIISûWAHK]******IۗHGIџIK;``"#bʇʄ@_C"#**ʻIWʏEU]WI͙**8[ Y "@ s D(`"#  Y  [`A[" sx" D# + **ʻWxGIH]IW"#b**"@#ʏʟHKʗʇAGϋ[WKIWH]M****I߷HCI[:`ZX`! sp D+`p"# bʓʘ@EI"#**ʗWʃ_HKCIWIOHUť**; Y [` sh D(`h"# bʛʒ@IM"#**ʟWʫCOEIWIA]ɽ**:`(XZs` D+``"#  Dʃ*ʟM_"#**"# bʃWʒ@ʿʋUGAIWM_"#****ʃWH]ʏE˗IWA]**IۿHO:`0 D (@  "# bʋʚAE"#**ʏWʗ]MHGWHO;`8 D*` "#`bʏʈCG"#ʓIWʛKOHIIWUI9 @ D * @  "#bʓʆ@EI"#ʻWʟMU]WA8H㿠6;a@`@C 39/ 7bဢ@6P `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @## `` @J@&O;( ;ؐ$ ;Аƀ ;Ȑƀ ;ƀ ;ƀ ;ƀ ;ƀ ;ƀ ;ƀ ;#h#`#\#d#l#p#t#x#|######@b#?5?|hr ě &  & /w&  #@'@ ]`]spsx#@@p@` *H '@&:` @ & @ 2@%8@ #c``(@& &  꺒&  $@ @  @@@ @@@898`& 3먐 & c4 . L@;`@7`%@3 `6@/`G@+`W@'`f@#`@ `@$`@(`@,`@0`@ 4a@8a9@<aT@@ar@Da@Ha@La@Pa@Tb@X7 $$b'@ڔ# b;@֔" bP@Ҕ! be@Δ  by@ʔ b@Ɣ b@” b@ b@ $b@ (b@ ,c@ 0c3@ 4cK@ 8cq@ <c@ @c@ Dc@ Hc@ Lc@ Pd@ TdD@ XՖ 膒dj@x`d~@t`d@p` d@l`d@h`d@d`d@``d@\` e@X`$e@T`(e1@P`,eI@L`0ee@H`4e}@D`8e@@`<e@<`@e@8`De@4`Hf@0`Lf@,`PfE@(`Tfs@$x`Xxsw $$ddf@cf@bf@a f@ `PPYO 4 TXT\ @7@W7`   @|| "@@E  @ "@@5  @Җ "@@%  @–焐7   @/7  -7  +7` )7 '7 k%7   @F#7C` !7@ 7= 7:` 77 74 71 7.` 7+ 7(` 7% 7" 7 7` ;7` 37` /7 -7 +7 ` )7  '7 %7 #7` !7   @KF7C 7@` 57= 97: 77 74 71 7.` 7+ 7(` 7% 7" 7 7` ;7` 37` /7 -7 +7 ` )7  '7 %7 #7` ɐ!7   @ꎐ@8`" ꄞ}b)C0A@Y@(Hz#*` # # DP*P 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]IQHGӱ****ۻHMI]8TX`T[ @ s DT* "#bʓʚEI"#**ʷWʿU[AWIM]ř**;``"#bʛʂ[M"#**ʫWʻACUIWEɱ**8`X[ @ sZ X`b s@"#ʿʫM_"#**ʃIWʏEHAIWQHKՉ**: Z X` s"#`bʇʐAC"#**ʋIWʗIMEWUIQIۥ**: ( ` "# bʓʚEI"#**ʗWʃ_HKCIWIQH]ǽ**;`0@`@"#bʫʂKU"#**ʃIWʋ]AGIWQI͙**8`8D[ H[` sD"# bʇʘ@AC"#**ʻWʓGKH]IWHMIQ۱**; @L[`LZ` s"#`bʏʚ]G"#**ʓIWʃUI_IWIQHCʼn**;`HPZ`PZsL[ L[`b sx"#xʛʗIM"#**ʫWʻCHUEIWQHG˥**8`P [  [`  XX`@  sp$X(X`@ sh$p"#hʿʃU_"# b**"#ʇIWʿʏEIHCWʇ_****HKWEIO]AɫIQ:X,,"#`bʿʚA_"#**ʇWʓGHCKIWIQHM;``0`0"# bʏʖCG"#ʻIWʫMH]AIWQC:h4X8X`<@ Z`4Z  s`<`"#bʗʆ@]K"#ʛIWʿCHMEWIQHG8pC0A@Y@(h|#*` ## DH*H 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT* "#bʓʚEI"#**ʷWʿU[AWIM]ř**;``"#bʛʂ[M"#**ʫWʻACUIWEɱ**8`X[ @ s"# bʿʄ@M_"#**ʃIWʋCGHAIWI͉**8  "#`bʇʖ@_C"#**ʻIWʓGKH]IWHMߥ**:(   "#`bʋʘCE"#**ʏIWʛKUHGIWAý**; 0@`@"#`bʓʐEI"#**ʗWʃU_HKIWHCř**: 8D`D"#bʛʚIM"#**ʫWʇ_EHUW]ɱ**;`@LZ`LZ@sH"# bʃʒ@MA"#**ʇIWʻEGCIWI͉**:`HPZPZ sxHx"#`bʿʖ@A_"#**ʋWʓGKHEIWHM**:P Z  X` [`Z`@  sp$[`(Z`@ sh$p"#hʏʋ_G"# b**"#ʻIWʏʛKUH]IWʻG****AIWIOHKEI8X,`,"#`bʷʂ_["#**ʏIWʗIMHGWHU8``0 0"# bʓʄ[I"#ʻWʫMA]IWC8h4[`8Z`<@ [ 4Z @ s`<`"#bʗʆ@IK"#ʛIWʇA_HMWE8pC0A@Y@(h~#*` ## Dȋ* 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT("#bʓʒ@EI"#**ʷWʿU[AWIM]ř**:`"#bʛʘ@[M"#**ʫWʻACUIWEɱ**; [`Z` s D+ "#@ bʿʄM_"#**ʃIWʏEHAIWICHKՉ**8  D(`@ "#`bʇʄAC"#**ʋIWʗIMEWUIAIۥ**8( D (`@  "#`bʓʄEI"#**ʗWʿUAHKW]IE۽**80 D@(`@ @"#`bʫʄKU"#**ʃIWʇ]EAWHGIKIۙ**88 DD(`@ D"#`bʇʄAC"#**ʻWʓGKH]IWHMIA۱**8@LX`L[ @ s DL("#bʏʒ@]G"#**ʓIWʃUI_IWIMHCʼn**:`HPZPX` sx DP*`x"#@ bʛʄIM"#**ʫWʻCHUEIWI_HG˥**8P [` Z` @ [ [` @sp$[`(Zsh D$) p"#hʿʃU_"#@ b**"#ʇIWʿʏEIHCWʇ_****HKWEIO]AɫIM8`X D,( ,"# bʿʖ@A_"#**ʇWʏ]IHCWHKIU:` D0(` 0"# bʏʚCG"#ʻIWʛKUH]IWAICI;`h4Z8X`< [ 4@[` s` D<* `"# bʗʆ@]K"#ʛIWʇ_HMEWIAHG8p?@PC0A#P*` #T D9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8b8@H8@\ 39/ 7b{@OP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @## p ##   @  @@&OȐ;ǒ ;(Ò @; վ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;ȟƀ @;ƀ  ;0#h#`#\#d#l#p#t#x#|################(,04@lbہcK@bx;E ;hA ;`= `h#p#t;x;#\x|p@GcN㿘@  93 7bcc@P   @#\#`   @ @"&O898a & 3.! & `T . L@`@`%@ `6@`G@`W@`f@`@ `@$`@(`@,`@0`@4a@8a9@<aT@@ar@Da@}Ha@yLa@uPa@qTb@mXb'@i\b:@ex`w fxbR@X bf@T b{@P b@L b@H b@D b@@  b@<  b@8  $c@4  (c*@0  ,cB@, 0c^@( 4cv@$ 8c@  <c@ @c@ Dc@ Hc@ Ld@  PdA@ Tdo@ Xd@ \d@ `K d@`d@`d@` d@`e @ޔ`e@ڔ`e+@֔`eD@Ҕ` e]@Δ`$ew@ʔ`(e@Ɣ`,e@”`0e@`4e@~`8e@}`<f@|`@f7@{`DfH@z`Hf\@y`Lfp@x`Pf@w`Tf@v`Xf@ud`\dc $ܖPPg@Og'@Ng>@M gU@|L<<˖; 4|@^D@H @7@7   @dhLlhp "@@  @T< "@@  @D|x,| "@@  @47   @)/7  -7  +7` )7 '7 ݐ%7   @I#7F` !7C 7@ 7=` 7: 77 74 71` 7. 7+` 7( 7% 7" 7` ;7` 37` /7 -7 +7` )7  '7  %7 #7` !7 ۉ7   @L7I` 57F 97C 7@ 7= 7: 77` 74 71` 7. 7+ 7( 7%` ;7"` 37` /7 -7 +7` )7 '7 %7  #7 ` !7 7 7` 2x57   @c@8a " cC0A@Y@(?H#*` 9# # D*  "*&b**'*******ʃʿʫKA_IWWH]#***ʓEICHGIہ*8@ D +    . D/4(`5@ ʃbʗIAUWEW]HG"۳:#;****ʏʃʗʿ]GAWKIWHCIQ]Iӱ****IۏHCIG9 TX`T[  s DT* "#@bʷʚ]["#**ʃWʏEAIWIUHKߙ**;`"#bʋʈCE"#**ʏIWʻK_HGIWAձ**9 X`[  sZ Y bs"#ʗʓGK"#**ʻIWʫC]EIWIQHGˉ**8 Z Y s"#bʇʐ_C"#**ʫIWʓGKHUIW]IQۥ**: (   "#`bʓʚEI"#**ʗWʇAHKUWQEɽ**;`0@@"#bʃʈ]A"#**ʇWʓGHCKIWIQ]**9 8DX`H[  sD"# bʏʂUG"#**ʓIWʿ]AIWHCIQ۱**8`@L[ L[` s"# bʿʘ@K_"#**ʃIWʏEAIWIQHK߉**; HP[`PZsLX`L[ b sx"#xʋʫCE"#**ʏIWʿ]HGAWQHCť**9 P`X` [   Z $X`  spZ (X` sh$p"#hʿʗI_"# b**"#ʻWʫCH]ʏIWEʃ]HGCIWOHU_Iǽ****Q: X,`,"# bʃʚ[A"#**ʇIWʓGHCKIWIQ]**;``0 0"#bʏʂUG"#**ʓIWʃ_ICIWIQHUǽ**8`h4[ 8[`<Z4Z  s`<`"#bʿʂK_"#**ʃIWʏEAIWIQHK8`pX X"#`bʋʄCE"#ʏIWʿ]HGAWQHC8x\`\"#bʿʆ@I_"#ʻWʫCEH]IWHG˻H߃IQ8C0A@Y@(h#*` ## D* 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT* "#bʓʚEI"#**ʷWʿU[AWIM]ř**;``"#bʛʂ[M"#**ʫWʻACUIWEɱ**8`X[ @ s"# bʿʄ@M_"#**ʃIWʋCGHAIWI͉**8  "#`bʇʖ@_C"#**ʻIWʓGKH]IWHMߥ**:(   "#`bʋʘCE"#**ʏIWʛKUHGIWAý**; 0@`@"#`bʓʐEI"#**ʗWʃU_HKIWHCř**: 8D`D"#bʛʚIM"#**ʫWʇ_EHUW]ɱ**;`@LZ`LZ@sH"# bʃʒ@MA"#**ʇIWʻEGCIWI͉**:`HPZPZ sxHx"#`bʿʖ@A_"#**ʋWʓGKHEIWHM**:P Z  X` [`$Z`@  sp[`(Z`@ sh$p"#hʏʋ_G"# b**"#ʻIWʏʛKUH]IWʻG****AIWIOHKEI8X,`,"#`bʷʂ_["#**ʏIWʗIMHGWHUå**8``0 0"# bʓʄ[I"#**ʻWʫMA]IWCŽ**8h4[`8Z`<@ [ 4Z   s`<`"#`bʗʐIK"#**ʛIWʇA_HMWE: pX`X"#bʫʈ@KU"#ʃIWʋ_GAIWHI9 x\\"#bʇʆ@UC"#ʋIWʓGKEIWH]8C0A@Y@(h#*` ## D* 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT("#bʓʒ@EI"#**ʷWʿU[AWIM]ř**:`"#bʛʘ@[M"#**ʫWʻACUIWEɱ**; [`Z` s D+ "#@ bʿʄM_"#**ʃIWʏEHAIWICHKՉ**8  D(`@ "#`bʇʄAC"#**ʋIWʗIMEWUIAIۥ**8( D (`@  "#`bʓʄEI"#**ʗWʿUAHKW]IE۽**80 D@(`@ @"#`bʫʄKU"#**ʃIWʇ]EAWHGIKIۙ**88 DD(`@ D"#`bʇʄAC"#**ʻWʓGKH]IWHMIA۱**8@LX`L[ @ s DL("#bʏʒ@]G"#**ʓIWʃUI_IWIMHCʼn**:`HPZPX` sx DP*`x"#@ bʛʄIM"#**ʫWʻCHUEIWI_HG˥**8P [` Z` @ [ $[` @sp[`(Zsh D$) p"#hʿʃU_"#@ b**"#ʇIWʿʏEIHCWʇ_****HKWEIO]AɫIM8`X D,( ,"# bʿʖ@A_"#**ʇWʏ]IHCWHKIU**:` D0(` 0"# bʏʚCG"#**ʻIWʛKUH]IWAICI۽**;`h4Z8X`< [ 4[`@  s` D<+ `"# bʗʒ@]K"#**ʛIWʇ_HMEWIAHG:`p DX)  X"#`bʃʂMA"#ʇIWʏEICW]IMI8`x DX*  X"#bʋʆ@CE"#ʏWʗ]MHGWHUIC8?@PC0A#P*` #T D9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8c@(@f 39/ 7b@YP  ` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @## p ##x ##` ## @`` @&O㾨;q ;Hm @;@h @;8ƀ @;0ƀ @;(ƀ @; ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;؟ƀ @;Пƀ @ (08;P#h#`#\#d#l#p#t#x#|####################H8LPT@`a@㿘@  93 7ba@P   @#\#`   @ @ِ&Ox;ȷ ;hȳ ;`ȯ `h#p#t;x;#\x|p@a!898ax& 3Ȑ!x& b . L@[`@W`%@S `6@O`G@K`W@G`f@C`@? `@;$`@7(`@3,`@/0`@+4a@'8a9@#<aT@@ar@Da@Ha@La@Pa@ Tb@XW $$b'@# b;@" bP@! be@  by@ b@ b@ b@ޔ b@ڔ $b@֔ (b@Ҕ ,c@Δ 0c3@ʔ 4cK@Ɣ 8cq@” <c@ @c@ Dc@ Hc@ Lc@ Pd@ TdD@ X Цdj@`d~@`d@` d@`d@`d@`d@`d@|` e@x`$e@t`(e1@p`,eI@l`0ee@h`4e}@d`8e@``<e@\`@e@X`De@T`Hf@P`Lf@L`PfE@H`Tfs@Dx`Xx擖w $Dddf@6cf@2bf@.a f@*`PPyO 4*T XT\ @7@w7`   @|| "@@e  @ "@@U  @ "@@E  @Ϥ7   @ז/7  -7  +7` )7 '7 ϋ%7   @F#7C` !7@ 7= 7:` 77 74 71 7.` 7+ 7(` 7% 7" 7 7` ;7` 37` /7 -7 +7 ` )7  '7 %7 #7` :!7   @kF7C 7@` 57= 97: 77 74 71 7.` 7+ 7(` 7% 7" 7 7` ;7` 37` /7 -7 +7 ` )7  '7 %7 #7` !7   @Ү@8ax" ҤҝaC0A@Y@(H#*` # # DЋ* 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]IQHGӱ****ۻHMI]8TX`T[ @ s DT* "#bʓʚEI"#**ʷWʿU[AWIM]ř**;``"#bʛʂ[M"#**ʫWʻACUIWEɱ**8`X[ @ sZ X`b s@"#ʿʫM_"#**ʃIWʏEHAIWQHKՉ**: Z X` s"#`bʇʐAC"#**ʋIWʗIMEWUIQIۥ**: ( ` "# bʓʚEI"#**ʗWʃ_HKCIWIQH]ǽ**;`0@`@"#bʫʂKU"#**ʃIWʋ]AGIWQI͙**8`8D[ H[` sD"# bʇʘ@AC"#**ʻWʓGKH]IWHMIQ۱**; @L[`LZ` s"#`bʏʚ]G"#**ʓIWʃUI_IWIQHCʼn**;`HPZ`PZsL[ L[`b sx"#xʛʗIM"#**ʫWʻCHUEIWQHG˥**8`P [  [`  XX`@  sp$X(X`@ sh$p"#hʿʃU_"# b**"#ʇIWʿʏEIHCWʇ_****HKWEIO]AɫIQ:X,,"#`bʿʚA_"#**ʇWʓGHCKIWIQHM;``0`0"# bʏʖCG"#ʻIWʫMH]AIWQC:h4X8X`<@ Z`4Z  s`<`"#bʗʆ@]K"#ʛIWʿCHMEWIQHG8pC0A@Y@(h#*` ## Dȋ* 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT* "#bʓʚEI"#**ʷWʿU[AWIM]ř**;``"#bʛʂ[M"#**ʫWʻACUIWEɱ**8`X[ @ s"# bʿʄ@M_"#**ʃIWʋCGHAIWI͉**8  "#`bʇʖ@_C"#**ʻIWʓGKH]IWHMߥ**:(   "#`bʋʘCE"#**ʏIWʛKUHGIWAý**; 0@`@"#`bʓʐEI"#**ʗWʃU_HKIWHCř**: 8D`D"#bʛʚIM"#**ʫWʇ_EHUW]ɱ**;`@LZ`LZ@sH"# bʃʒ@MA"#**ʇIWʻEGCIWI͉**:`HPZPZ sxHx"#`bʿʖ@A_"#**ʋWʓGKHEIWHM**:P Z  X` [`Z`@  sp$[`(Z`@ sh$p"#hʏʋ_G"# b**"#ʻIWʏʛKUH]IWʻG****AIWIOHKEI8X,`,"#`bʷʂ_["#**ʏIWʗIMHGWHU8``0 0"# bʓʄ[I"#ʻWʫMA]IWC8h4[`8Z`<@ [ 4Z @ s`<`"#bʗʆ@IK"#ʛIWʇA_HMWE8pC0A@Y@(h#*` ## DH*H 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT("#bʓʒ@EI"#**ʷWʿU[AWIM]ř**:`"#bʛʘ@[M"#**ʫWʻACUIWEɱ**; [`Z` s D+ "#@ bʿʄM_"#**ʃIWʏEHAIWICHKՉ**8  D(`@ "#`bʇʄAC"#**ʋIWʗIMEWUIAIۥ**8( D (`@  "#`bʓʄEI"#**ʗWʿUAHKW]IE۽**80 D@(`@ @"#`bʫʄKU"#**ʃIWʇ]EAWHGIKIۙ**88 DD(`@ D"#`bʇʄAC"#**ʻWʓGKH]IWHMIA۱**8@LX`L[ @ s DL("#bʏʒ@]G"#**ʓIWʃUI_IWIMHCʼn**:`HPZPX` sx DP*`x"#@ bʛʄIM"#**ʫWʻCHUEIWI_HG˥**8P [` Z` @ [ [` @sp$[`(Zsh D$) p"#hʿʃU_"#@ b**"#ʇIWʿʏEIHCWʇ_****HKWEIO]AɫIM8`X D,( ,"# bʿʖ@A_"#**ʇWʏ]IHCWHKIU:` D0(` 0"# bʏʚCG"#ʻIWʛKUH]IWAICI;`h4Z8X`< [ 4@[` s` D<* `"# bʗʆ@]K"#ʛIWʇ_HMEWIAHG8p?@PC0A#P*` #TX DX9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8a@h8@\ 39/ 7b`@OP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @## p ##   @  @ @&OȐ; ;( @; ޒ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;ȟƀ @;ƀ  ;0#h#`#\#d#l#p#t#x#|################(,04@ab0@㿘@  93 7bb3@P   @#\#`   @ @_&Ox;= ;h9 ;`5 `h#p#t;x;#\x|p@?bM898a& 3N!& c< . L@`@ݔ`%@ٔ `6@Ք`G@є`W@͔`f@ɔ`@Ŕ `@$`@(`@,`@0`@4a@8a9@<aT@@ar@Da@Ha@La@Pa@Tb@Xb'@\b:@x`Ֆw ņxbR@x bf@t b{@p b@l b@h b@d b@`  b@\  b@X  $c@T  (c*@P  ,cB@L 0c^@H 4cv@D 8c@@ <c@< @c@8 Dc@4 Hc@0 Ld@, PdA@( Tdo@$ Xd@  \d@ `k d@`d@ `d@` d@`e @`e@`e+@`eD@` e]@`$ew@`(e@`,e@`0e@ޔ`4e@ڔ~`8e@֔}`<f@Ҕ|`@f7@Δ{`DfH@ʔz`Hf\@Ɣy`Lfp@”x`Pf@w`Tf@v`Xf@ud`\dc $ĶPPg@Og'@Ng>@M gU@L<<; 4Ĝ@~D@H @7@7   @hllhp "@@  @t\ "@@  @d|xL| "@@  @T7   @I/7  -7  +7` )7 '7 %7   @.I#7F` !7C 7@ 7=` 7: 77 74 71` 7. 7+` 7( 7% 7" 7` ;7` 37` /7 -7 +7` )7  '7  %7 #7` !7 é7   @ږL7I` 57F 97C 7@ 7= 7: 77` 74 71` 7. 7+ 7( 7%` ;7"` 37` /7 -7 +7` )7 '7 %7  #7 ` !7 7 7` Rx57   @@8a"  bC0A@Y@(?H#*` 9# # D*  @"*&b**'*******ʃʿʫKA_IWWH]#***ʓEICHGIہ*8@ D +  @  . D/4(`5@ ʃbʗIAUWEW]HG"۳:#;****ʏʃʗʿ]GAWKIWHCIQ]Iӱ****IۏHCIG9 TX`T[  s DT* "#@bʷʚ]["#**ʃWʏEAIWIUHKߙ**;`"#bʋʈCE"#**ʏIWʻK_HGIWAձ**9 X`[  sZ Y bs"#ʗʓGK"#**ʻIWʫC]EIWIQHGˉ**8 Z Y s"#bʇʐ_C"#**ʫIWʓGKHUIW]IQۥ**: (   "#`bʓʚEI"#**ʗWʇAHKUWQEɽ**;`0@@"#bʃʈ]A"#**ʇWʓGHCKIWIQ]**9 8DX`H[  sD"# bʏʂUG"#**ʓIWʿ]AIWHCIQ۱**8`@L[ L[` s"# bʿʘ@K_"#**ʃIWʏEAIWIQHK߉**; HP[`PZsLX`L[ b sx"#xʋʫCE"#**ʏIWʿ]HGAWQHCť**9 P`X` [   Z $X`  spZ (X` sh$p"#hʿʗI_"# b**"#ʻWʫCH]ʏIWEʃ]HGCIWOHU_Iǽ****Q: X,`,"# bʃʚ[A"#**ʇIWʓGHCKIWIQ]**;``0 0"#bʏʂUG"#**ʓIWʃ_ICIWIQHUǽ**8`h4[ 8[`<Z4Z  s`<`"#bʿʂK_"#**ʃIWʏEAIWIQHK8`pX X"#`bʋʄCE"#ʏIWʿ]HGAWQHC8x\`\"#bʿʆ@I_"#ʻWʫCEH]IWHG˻H߃IQ8C0A@Y@(h#*` ## D * 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT* "#bʓʚEI"#**ʷWʿU[AWIM]ř**;``"#bʛʂ[M"#**ʫWʻACUIWEɱ**8`X[ @ s"# bʿʄ@M_"#**ʃIWʋCGHAIWI͉**8  "#`bʇʖ@_C"#**ʻIWʓGKH]IWHMߥ**:(   "#`bʋʘCE"#**ʏIWʛKUHGIWAý**; 0@`@"#`bʓʐEI"#**ʗWʃU_HKIWHCř**: 8D`D"#bʛʚIM"#**ʫWʇ_EHUW]ɱ**;`@LZ`LZ@sH"# bʃʒ@MA"#**ʇIWʻEGCIWI͉**:`HPZPZ sxHx"#`bʿʖ@A_"#**ʋWʓGKHEIWHM**:P Z  X` [`$Z`@  sp[`(Z`@ sh$p"#hʏʋ_G"# b**"#ʻIWʏʛKUH]IWʻG****AIWIOHKEI8X,`,"#`bʷʂ_["#**ʏIWʗIMHGWHUå**8``0 0"# bʓʄ[I"#**ʻWʫMA]IWCŽ**8h4[`8Z`<@ [ 4Z   s`<`"#`bʗʐIK"#**ʛIWʇA_HMWE: pX`X"#bʫʈ@KU"#ʃIWʋ_GAIWHI9 x\\"#bʇʆ@UC"#ʋIWʓGKEIWH]8C0A@Y@(h#*` ## D* 9** `"*b*&'******ʃʫʛKAUIWW]#***ʇIAE*HG; D +`   . D/4(`@ 5ʻ`bʓG]KIWAWHMHC"۳:#;****ʃʛʋʗIAMWEW]ISHGѱ****ۻHMI]8TX`T[ @ s DT("#bʓʒ@EI"#**ʷWʿU[AWIM]ř**:`"#bʛʘ@[M"#**ʫWʻACUIWEɱ**; [`Z` s D+ "#@ bʿʄM_"#**ʃIWʏEHAIWICHKՉ**8  D(`@ "#`bʇʄAC"#**ʋIWʗIMEWUIAIۥ**8( D (`@  "#`bʓʄEI"#**ʗWʿUAHKW]IE۽**80 D@(`@ @"#`bʫʄKU"#**ʃIWʇ]EAWHGIKIۙ**88 DD(`@ D"#`bʇʄAC"#**ʻWʓGKH]IWHMIA۱**8@LX`L[ @ s DL("#bʏʒ@]G"#**ʓIWʃUI_IWIMHCʼn**:`HPZPX` sx DP*`x"#@ bʛʄIM"#**ʫWʻCHUEIWI_HG˥**8P [` Z` @ [ $[` @sp[`(Zsh D$) p"#hʿʃU_"#@ b**"#ʇIWʿʏEIHCWʇ_****HKWEIO]AɫIM8`X D,( ,"# bʿʖ@A_"#**ʇWʏ]IHCWHKIU**:` D0(` 0"# bʏʚCG"#**ʻIWʛKUH]IWAICI۽**;`h4Z8X`< [ 4[`@  s` D<+ `"# bʗʒ@]K"#**ʛIWʇ_HMEWIAHG:`p DX)  X"#`bʃʂMA"#ʇIWʏEICW]IMI8`x DX*  X"#bʋʆ@CE"#ʏWʗ]MHGWHUIC8?@PC0A#P*` #T D9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8b@(@f 39/ 7b @YP  ` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @## p ##x ##` ## @`` @&O㾨; ;H @;@ @;8ƀ @;0ƀ @;(ƀ @; ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;؟ƀ @;Пƀ @ (08;P#h#`#\#d#l#p#t#x#|####################H8LPT@&cuc@㿘@  93 7bc@P   @#\#`   @ @&Ox;ג ;hӒ ;`ϒ `h#p#t;x;#\x|p@ِ`898b(& "(3&  `. L@{@wǖ x?@jV@fh@b z@^@Z@V@R@N @J$Ϛ K@=` @9`/@5` X@1x`ρw $2xpp@$o\`t[ 4%\`\d`h @@r@m|x| @7@e7   @ "@@S  @ "@@C  @\@kx7   @і/7  -7  +7` )7 '7 %7   @#7` !7 7 7` 7 7  7  7` 7 7` [ 7   @ @8b(" b|C0A@Y#P*` #T#X D* 9 `"*P&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;`X.`/ Dʃ*bG@KIWIUMIӧ45:;ʃʟʿ]AOWʃIWHC_GAIK:` D*  "#bʛʘ@IM"#ʟWʃ_CHOIWEII;  b;`b@: b8(b8`0b9 8b@:`@b:Hb:Pb@; Xb;``b@8hC0A@Y#*` ## D* 9"`"*&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;`ț.`/ Dʃ*bG@KIWIUMIӧ45:;**ʃʟʿ]AOWʃIWHC_****GAIK:` D*  "#`bʛʚIM"#**ʟWʃ_CHOIWEIIۉ**;`"b:` "#bʿʂO_"#**ʃIWʏEIAWHKϥ**8`  "#`bʇʒ_C"#**ʋIWʗIMEWHO߽**:`( Z  Zhsh[`Y bj s`@h"#`ʏʋCG"#**ʓIWʟM_IWH]C80 "#`bʗʒGK"#ʛIWʻ_AMIWHC:`8 "#bʟʂKO"#ʻIWʇAE]WHG8`@b; Hb@9 Pb@: Xb:`b@8hpC0A@Y#*` ## D* 9#X`"*&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;`ț.`/ Dʃ*bG@KIWIUMIӧ45:;**ʃʟʿ]AOWʃIWHC_****GAIK:` D(@ "# bʛʒ@IM"#**ʟWʃ_CHOIWEIIۉ**:`#Xb8 D*"#`bʿʈ@O_"#**ʃIWʏEIAWHKIOIۥ**9  D(@ "# bʋʒ@AE"#**ʏWʛKOHGIW]IA۽**:`( D ) X  X`k@ sh D) X X`bk@ s`h"#`ʗʓGK"#**ʛIWʃ_MCIWI]EI:0 D("#`bʿʈ@M_"#ʻWʋCGH]IWIIM9 8 D*  "#bʇʘ@]C"#ʋIWʗIMEWOI]I; @b@:`Hb: Pb8Xb8``b@8hp?@PC0A#P*` #T@ D@9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8b@n@@W 39/ 7bɀ@JP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @##   `` @@&Oؐ; ; @; @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;Ȑƀ @;ƀ @;ƀ ; #h#`#\#d#l#p#t#x#|############## $@cc@㿘@  93 7bc@P   @#\#`   @ @r&Ox;P ;hL ;`H `h#p#t;x;#\x|p@Rc898b& "b3&  `. L@@A 4@S@y@ܔ @ؔ@Ԕ@Д@̔@Ȕ @Ĕ$ Œ@`%@`I@` ^@`r@p`o $phh@gT`S 4TXT}\X` @@@tppxt| @7@7`   @v^ "@@  @fN "@@  @VT@p7   @G/7 -7  +7 ` )7 '7 %7 #7`   @)!7 7 7` 7 7 7  7 ` 7 7` 7 ΐ7   @@8b" bC0A@Y#P*` #T#X D* 9"X`"*P&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;`X.`/ Dʃ*bG@KIWIUMIӧ45:;ʃʟʿ]AOWʃIWHC_GAIK:` D*  "#bʛʘ@IM"#ʟWʃ_CHOIWEII; "Xb;`b@: b8(b8`0b9 8b@:`@b:Hb:Pb@; Xb;``b@8hC0A@Y#Ї*` ## D* 9 `"*Ћ&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;`؛.`/ Dʃ*bG@KIWIUMIӧ45:;**ʃʟʿ]AOWʃIWHC_****GAIK:` D*  "#`bʛʚIM"#**ʟWʃ_CHOIWEIIۉ**;` b:` "#bʿʂO_"#**ʃIWʏEIAWHKϥ**8`    "#`bʇʒ_C"#**ʋIWʗIMEWHO߽**:`(Z Zhsx[`Y bj sp@x"#pʏʋCG"#**ʓIWʟM_IWH]C80 **"#`bʗʒGK"#**ʛIWʻ_AMIWHCDZ**:`8 "#bʟʄ@KO"#**ʻIWʇAE]WHG8@   "#`bʿʒO_"#ʃIWʏEIAWHK:`H Z  Zhsh$[`$Zbj@s`h"#`ʇʃ_C"#ʋIWʗIMEWHO8`Pb; Xb@:`b@8hC0A@Y#*` ## D* 9"`"*&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;`ț.`/ Dʃ*bG@KIWIUMIӧ45:;**ʃʟʿ]AOWʃIWHC_****GAIK:` D(@ "# bʛʒ@IM"#**ʟWʃ_CHOIWEIIۉ**:`"b8 D*"#`bʿʈ@O_"#**ʃIWʏEIAWHKIOIۥ**9  D(@ "# bʋʒ@AE"#**ʏWʛKOHGIW]IA۽**:`( Y  Zsh D +`h"# bʗʂGK"#**ʛIWʃ_MCIWI]Eə**8`0 D(@ "#`bʿʖM_"#**ʻWʋCGH]IWIIM۱**:8 D(` "#`bʇʈ@]C"#**ʋIWʗIMEWOI]I9 @ D*"#bʓʒ@EI"#ʗWʿOAHKW]IE:`HY Z#s` D* `"# bʟʈ@KO"#ʃIWʋCAGIWI]I9 Pb8`Xb8`b@8hp?@PC0A#P*` #T@ D@9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8b+@n@@W 39/ 7bj@JP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @##   `` @@&Oؐ; ; @; @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;Ȑƀ @;ƀ @;ƀ ; #h#`#\#d#l#p#t#x#|############## $@bāc.@㿘@  93 7bc1@P   @#\#`   @ @r&Ox;P ;hL ;`H `h#p#t;x;#\x|p@RcK898b& "b3&  `8. L@m@@ =ߐ ̶̒;@ː@ܔʐ,@ؔɐ @ԔȐ$ Ւ@ǔ s@Ô @  $A@`X@~`o@}` @|l`k 4lpltpx @7@7   @w "@@  @gĀ "@@  @oW쀢 "@@  @_!l7   @T/7  -7  +7` )7 '7 %7   @9 #7 ` !7 7 7` 7   @!7  7  7` 7 7` Ր 7   @@8b" `C0A@Y#Ї*` ## D* 9"8`"*Ћ&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;` ؛.`( D/ʃ*bG@K45:;**ʛIWʓʿ]MʇWAIMHCWISGHOե****I߷E:`ZX` sx D* x"# bʛʘ@IM"#**ʟWʇAHOEWI_HGˉ**; "#`bʿʒO_"#**ʃIWʏEIAWHKϥ**:`"8b: b@; (X[`@spZ X`(b shp"#hʇʃ_C"#**ʋIWʛKEOIWIS]**:`0b:8b@; @"#`bʓʒEI"#**ʗWʿ]HKAWSHC:`H "#bʟʘ@KO"#ʻIWʋC]GIWISI; Pb;`Xb:``Y (Z0s``"# bʃʐ@]A"#ʇWʓGKHCIWMI: hb@8pC0A@Y#*` ## D* 9#(`"*&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;` ț.`( D/ʃ*bG@K45:;**ʛIWʓʿ]MʇWAIMHCWIUGHOӥ****I߷E:`ZX` sh D* h"# bʛʘ@IM"#**ʟWʇAHOEWI_HGˉ**; "#`bʿʒO_"#**ʃIWʏEIAWHKϥ**:` "#`bʇʄ_C"#**ʋIWʗIMEWHO߽**8 `("# bʏʖ@CG"#**ʓIWʟM_IWH]Ù**:(X`[  s``"#`bʗʂGK"#**ʛIWʻ_AMIWHCDZ**8`0 8"#`bʟʐKO"#**ʻIWʇAE]WHGˉ**: 8`0"#bʿʘ@O_"#**ʃIWʏEIAWHKϥ**; @ ` "#bʇʒ_C"#**ʋIWʗIMEWHO:`H  "#`bʏʚCG"#ʓIWʟM_IWH];`P#(b8Xb:``   "#bʗʘ@GK"#ʛIWʻ_AMIWHC; hb@8ppC0A@Y#*` ## D* 9!p`"*&b**'*******ʃʟʛKAOIWW]#***ʇIAE*HG;` ț.`( D/ʃ*bG@K45:;**ʛIWʓʿ]MʇWAIMHCWIUGHOӥ****I߷E:`ZX` sh D*`h"#@ bʛʄIM"#**ʟWʇAHOEWI_HGˉ**8`"#`bʿʂO_"#**ʃIWʏEIAWHKϥ**8` D+  "#` bʇʂ_C"#**ʋIWʗIMEWHOI_I۽**8`  D+  "#`(bʓʂEI"#**ʗWʻO_HKIWAIEۙ**8`([ [` s` D(``"#@ bʟʄ@KO"#**ʻIWʋC]GIWIAIͱ**80 D*"#`8bʃʄ@]A"#**ʇWʓGKHCIWMI]ۉ**88 D*"#`0bʏʄ@CG"#**ʓIWʟM_IWH]ICIۥ**8@ D*"#`bʛʄ@IM"#**ʟWʃ]COIWEII8H D*"#`bʃʄ@OA"#ʻWʏEI]WHKIO8P!pb:Xb@; ` D* @ "# bʋʈ]E"#ʏWʛKOHGIWAI]9 hb@8pp?@PC0A#P*` #T D9+` @ ,,?"#P,?(,)@,,,,,,̧I_̯U[QY̫UY̯QY,,,,HWWI;` D+ @ 0 1̂U̯IQU67,,HW̳W,IQ̳Y,HWWI8`  D+` <`=̄U̯IQU"#,,HW̳W,IQ̳Y,HWWI8( D(` "#̈@U̯IQU"#,,HW̳W,IQ̳Y,HWWI9 0 D(@"# ̒U̯IQU"#,,HW̳W,IQ̳Y,HWWI:`8 D) "#`̖U̯IQU"#,,HW̳WIQ̳YHWWI:@ D *`@ "#̘@U̯IQU"#HW̳WIQ̳YHWWI; H D * @  "#̂U̯IQU"#HW̳WIQ̳YHWW8`P` (HO`8K H@HI8@ 0@HG@HC`PA;` `H_8`@zz8@\ 39/ 7b)@OP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ##h @## p ##   @  @z@&OȐ; ;( @;  @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;ȟƀ @;ƀ  ;0#h#`#\#d#l#p#t#x#|################(,04@yaa@y㿘@  93 7ba@P   @#\#`   @ @yq&Ox;O ;hK ;`G `h#p#t;x;#\x|p@yQb898c0& 3`#0& c . LԒ@yӐ@yҐ9@yѐ N@yАc@yϐ@yΐ@yܔ͐@yؔ̐ @yԔː$@yДʐ( @y̔ɐ, ͒7@yU@yo@y @y@y@y@y@y @y$2@y~(O@y}l,k lLLf@yK @yJ @yI @y~H @yzG @yvF @yrE4 43 $r8T<8@ @/7@x/7   @yZplBtpx "@@x  @yJ2Ā "@@x  @y:37  ` @y//7 -7 +7` )7  '7  %7 #7` !7 ڐl7   @y %7"` 7 7 7 7` 7 7` 7  7 7 7` ;7` 97   @xۖo@xk8c0" e^b=C0A@r@Y#P 9#T"#X*` "*"`*"*&P'*******ʛʿʇAM_SS#***ʇH]E*HGIK8@ XIY `כ."/4@5ʛʇʏʗIMCSGISOII]͙****:( :`;"ʘ@ʻ_A"#**ʇISʗIHCMSIGOݽ**; `"#`"ʏʐCG"#**ʓISʟM_ISH]Ù**: `"#"ʗʘ@GK"#**ʛISʃ]MCISQEɱ**; `"#`"ʿʐM_"#**ʻSʏEH]ISQHKω**: ( ` "#"ʇʘ@]C"#**ʋISʛKEOISIQ]**; 0`"#`"ʓʐEI"#**ʗSʿ]HKASQHCǽ**: 8`"#"ʟʘ@KO"#**ʻISʋC]GISIQI͙**; @`"#`"ʃʐ]A"#**ʇSʗIHCMSQHO߱**: H`"#"ʏʘ@CG"#**ʓISʻOI_ISIQA; P ` "#`"ʛʐIM"#ʟSʇAHOESQHG: X$`$"#"ʿʄO_"#ʃISʓGAKISIQM݁8`C0A@r#P 9#T!#X*` !*"`*"*&P'*******ʛʣʇAMQSS#***ʃ]E*HGIK8@ XIY `Iכ."/4@5ʗʿʇʓGK_ISCISMEIQə****:( :`;"ʄ@ʟMQ"#**ʻSʋC]GISIAIͽ**8 "#`"ʿʖ@Q_"#**ʃISʏEIASHKϙ**: "#`"ʃʄ@]A"#**ʇSʓGKHCISMѱ**8  "#`"ʇʖ@_C"#**ʋISʗIMESHO݉**:(   "#`"ʋʄ@AE"#**ʏSʛKOHGISHQߥ**80 "#`"ʏʖ@CG"#**ʓISʟMQIS]**:8 "#`"ʓʄ@EI"#**ʗSʣO_HKISH]Ù**8@ "#`"ʗʖ@GK"#**ʛISʿQAMS]ű**:H "#`"ʛʄ@IM"#**ʟSʃ_CHOISH]8P   "#`"ʟʖ@KO"#ʣISʇAEQS]:X$ $"#"ʣʆMQ"#ʃSʋCGAISH]ˁ8`C0A@rA.#P 9#T#8#X*` *" *b*&P'*******ʛʿʇAM_SS#***ʇH]E*HGIK8@XIY `כ.b/4@5ʛʇʏʗIMCSGISOII]͙****: :`;bʘʻ_A"#**ʇISʗIHCMSIGOݽ**; `"#`bʏʐCG"#**ʓISʟM_ISH]Ù**: #8`b"#ʗʓGKISMե**I8  b"@#ʋʷCESHGձ**I:`(b"#ʃʻ_AISCIս**8`0 b"#ʟʛKOIS]IՉ**; 8 `b"@#ʓʏEISHKտI:@  b"@#ʷʇA[SEI՛9 Hb"#ʿʻO_ISAՏI;`P`b"#ʛʗIMSHOՇI: Xb"@#ʏʋ[GISIIջс8`㿠h;99ÐbH;@t}b^#@t|H@R 39/ 7b◀@EP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ## @  @sg@&O;E ;A @;< @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;Ȑƀ @;ƀ @;ƀ @;ƀ ;#h#`#\#d#l#p#t#x#|############ @rb㿠@s @s898c& 3#& ` . LԒ@sӐ5@sҐg@sѐ @sА@sϐ@sΐ@@s~͐a@sz̐ @svː$@srʐ(@snɐ, o4@sai@s]@sY @sU2@sQs@sM@sI@sE )@sA$_@s=~(@s9}l,k :lLL@s,K @s(J @@s$I @s H @sG @sF 5@sE4 4c3 $8<8@ @/7@ra/7   @rpltpx "@@rO  @rĀ "@@r?  @rܖ37  ` @rі/7 -7 +7` )7  '7  %7 #7` !7 |l7   @r%7"` 7 7 7 7` 7 7` 7  7 7 7` ;7` L97   @r}@r 8c" bC0A@r@Y#P#T*` #X DH*H 9** `"*Pb*&'******ʃʟʛKAOISS]#***ʇIAE*HG;  XIY` D*`כ. /bʘ@ʗIM45**ʟSʋCHOGISI_Iͥ**;  D+` (:;b D"#* ʻʗʃʓG]KISASMHCI]۱****;@`"#bʏʐCG"#**ʓISʟM_ISH]Ù**:  `"# ʗʓGK"# b**"@#ʛISʗʻ_AMISʛK****HCISOG]IQ:` "#ʓʷGI"# b**"@#ʗSʓʻO_HKISʗI****ASMEHOQI; (   "#`bʷʖ@E["#**ʓSʻOI_ISIQAŽ**:0"# bʛʘ@IM"#**ʟSʇAHOESQHG˙**; 8 "#`bʿʖ@O_"#**ʃISʓGAKISIQMݱ**:@"# bʋʘ@AE"#**ʏSʟMHG_SQH]É**; H "#`bʗʖ@GK"#**ʛISʃ]MCISQE:P  "# bʿʘ@M_"#ʻSʏEH]ISQHK; X$ $"#bʇʆ@]C"#ʋISʛKEOISIQ]8`C0A@r#P#Tc#X*`  Dc* 9** "*P"*&'******ʃʟʛKAOISSHQ#***ʃI_E*HGI;@ XIY` D*Iכ.@/"ʚʓGK45**ʛISʃ_MCISIQEɥ**;` D( (`:;" D"#* ʛʋʣʇAMESQSHG]IKI۱****;@"#`"ʿʊQ_"#**ʃISʏEIASHKϙ**9` "#`ʃʿ]A"# "**"@#ʇSʻʃʓGK]ISHCASMHCQIDZ****8 `"#ʣʟMQ"#`"**"#ʷSʛʣʃ_CMISH[QSE]I****8`(   "#`"ʓʒEI"#**ʗSʣO_HKISH]ý**:`0"#`"ʗʂGK"#**ʛISʿQAMS]ř**8`8 "#`"ʛʒIM"#**ʟSʃ_CHOISH]DZ**:`@"#`"ʟʂKO"#**ʣISʇAEQS]ɉ**8`H "#`"ʣʒMQ"#**ʃSʋCGAISH]:`P  "#`"ʃʂOA"#ʇISʏEICS]8`X$ $"#"ʇʆQC"#ʋISʓGKEISH]ρ8`C0A@rA.#P*` #T#X D* 9!`"*P&b**'*******ʃʟʛKAOISS]#***ʇIAE*HG;XIY` D*`כ.@ /bʄʗIM45**ʟSʋCHOGISI_Iͥ**8 D+` `:;b D"#*  ʻʗʃʓG]KISASMHCI]۱****;@`"#bʏʐ@CG"#**ʓISʟM_ISH]Ù**: ! "#bʗʚGK"#**ʛISʻ_AMISHCGIձ**;` `"#bʃʐ@OA"#**ʻSʏEI]SHKOՉ**I: (  b"#ʏʋCGISIIՙ**9 0`b"@#ʇʃ_CISH]ե**I:8 `b"#ʷʟM[SAՋI; @ b"#ʗʓGKISMտI;`H`b"#ʋʻCEISHG՟I8`P b"#ʿʃ[_ISHCIՓ8Xb"@#ʟʛKOISH[ջс8`㿠;99ÐbH;@mb#@mH@T 997 ;"ـ@GP` D-#\#``#d#h #l#p (@#t#x 0#|#8@## @##H##`P##X@## `##  @  @l@&O; ;{ @;v @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;Ȑƀ @;ƀ @;ƀ @;ƀ ;#h#`#\#d#l#p#t#x#|############ @l4c-898c& 3D#& `\. LԒ@lؔӐ@lԔҐ9@lДѐ N@l̔Аc@lȔϐ@lĔΐ@l͐@l̐ @lː$@lʐ( @lɐ, 7@lU@lo@l @l@l@l@l@l @l$2@l~(O@l{}l,˖k |lLLf@lnK @ljJ @lfI @lbH @l^G @lZF @lVE4 43 $V88<8@ @/7@k/7   @l>pl&tpx "@@k  @l.Ā "@@k  @l37  ` @l/7 -7 +7` )7  '7  %7 #7` !7 l7   @k%7"` 7 7 7 7` 7 7` 7  7 7 7` ;7` 97   @kS@kO8c" IBcC0A@r@Y#P 9#T#@#X*` #@*"`*"*&P'*******ʛʿʇAM_SS#***ʇH]E*HGIK8@ XIY `כ."/4@5ʛʇʏʗIMCSGISOII]͙****:( :`;"ʘ@ʻ_A"#**ʇISʗIHCMSIGOݽ**; `"#`"ʏʐCG"#**ʓISʟM_ISH]Ù**: `"#"ʗʘ@GK"#**ʛISʃ]MCISQEɱ**; `"#`"ʿʐM_"#**ʻSʏEH]ISQHKω**: ( ` "#"ʇʘ@]C"#**ʋISʛKEOISIQ]**; 0`"#`"ʓʐEI"#**ʗSʿ]HKASQHCǽ**: 8`"#"ʟʘ@KO"#**ʻISʋC]GISIQI͙**; @`"#`"ʃʐ]A"#**ʇSʗIHCMSQHO߱**: H`"#"ʏʘ@CG"#**ʓISʻOI_ISIQA; P ` "#`"ʛʐIM"#ʟSʇAHOESQHG: X$`$"#"ʿʄO_"#ʃISʓGAKISIQM݁8`C0A@r#P 9#T!#X*` !*"`*"*&P'*******ʛʣʇAMQSS#***ʃ]E*HGIK8@ XIY `Iכ."/4@5ʗʿʇʓGK_ISCISMEIQə****:( :`;"ʄ@ʟMQ"#**ʻSʋC]GISIAIͽ**8 "#`"ʿʖ@Q_"#**ʃISʏEIASHKϙ**: "#`"ʃʄ@]A"#**ʇSʓGKHCISMѱ**8  "#`"ʇʖ@_C"#**ʋISʗIMESHO݉**:(   "#`"ʋʄ@AE"#**ʏSʛKOHGISHQߥ**80 "#`"ʏʖ@CG"#**ʓISʟMQIS]**:8 "#`"ʓʄ@EI"#**ʗSʣO_HKISH]Ù**8@ "#`"ʗʖ@GK"#**ʛISʿQAMS]ű**:H "#`"ʛʄ@IM"#**ʟSʃ_CHOISH]8P   "#`"ʟʖ@KO"#ʣISʇAEQS]:X$ $"#"ʣʆMQ"#ʃSʋCGAISH]ˁ8`C0A@rA.#P 9#T##X*` *" *b*&P'*******ʛʿʇAM_SS#***ʇH]E*HGIK8@XIY `כ.b/4@5ʛʇʏʗIMCSGISOII]͙****: :`;bʘʻ_A"#**ʇISʗIHCMSIGOݽ**; `"#`bʏʐCG"#**ʓISʟM_ISH]Ù**: #`b"#ʗʓGKISMե**I8  b"@#ʋʷCESHGձ**I:`(b"#ʃʻ_AISCIս**8`0 b"#ʟʛKOIS]IՉ**; 8 `b"@#ʓʏEISHKտI:@  b"@#ʷʇA[SEI՛9 Hb"#ʿʻO_ISAՏI;`P`b"#ʛʗIMSHOՇI: Xb"@#ʏʋ[GISIIջс8`㿠L;99ÐbH;@gac#@g`H@R 39/ 7b䀢@EP `` #\#` #d#h  @#l#p ( #t#x0 #|#`8 ##@ ##`H @##P ##`X ##` ## @  @fK@&O;) ;% @;  @;ƀ @;ƀ @;ƀ @;ƀ @;ؐƀ @;Аƀ @;Ȑƀ @;ƀ @;ƀ @;ƀ ;#h#`#\#d#l#p#t#x#|############ @eސ`8㿠@㿠@?㿠@? `?????? @@@ @@@ 㿠@(? @???쀤 @@,pT,,,,,-H-X-`-x-x-....0h.<H.@(.T.`.d.x...H. .. . . . . `/ @/ / /( /4 /4 /D /P h/P /` 0/l /l /| / / </ / X/ L0( 04 04 0D \0 0 0 0 X1 01 $11$112\h2hH2p,2222|2X4 4444456  6,6864606,6,6$66p6(P6H6(066:>@>\t>,>$?4F\F,F FG GGHHIIIJJJuPuLuHuDu@u<u8tu4du0Tu,Du(4u$$u$uuuuxu\u @u$uutttt|tDt ttttttttXt<t tttt<t(t0tttttL  p`P@0 lL0|xtpllPh4d`\XTPLpHTD8@<@884d0H,,($ h L0lP4|`$,408t4<4 t d T D 4 $  tdT|Dx4t$pphhd`h\LX0TPLHD@<l8P440,($ pT8 dH,hL0lP4|`$ ,4<DX`XD  p`P@0߼ ߸ߴ߰߬ߨߤߤߜlߜLߘ0ߔߐߌ߈߄߀|lxPt4plhd`\XpTTP8LHLDD@d<H8,40,($ hL0 lP4|`$,408t4<4   t d T D 4 $  tdTD4$||ttplhhLd0`\XTPLHlDP@4<840,($p T8 dH,hL0lP4|`$ ,4<DX`XD1110d0D0(0 000000d0,000000\0H040000 0000000d0l0d0PHLHHHHH@H@`H<DH8(H4 H0H,H(H$H H HH$HHHH HH\HHH4HGGG,GGGGGHHpGxHpH\ahada`a`xaXTaX4aTaPaLaLaDaDda@Ha<,a<a4a4a0a,xa(\a($a aa$@a,,a(4a0a0La,Ta4a4xa0a8xa8d~p~`~P~@~0~ ~~~~~~~|~\~@~$~~~~|~x~t|~p`~lD~l ~d~d~`~\~Xt~TX~P<~L ~P~H~D~L~T~P~X~X~T~\~\|p`P@0 |\@$||x`tDt llhd`t\XX<T XPLT\X``\dd|TpP`LPH@D0@ <840,,$|$\ @$ |`D tX< |%s: %s: %s: cannot read buffer - %s %s: error unbinding on cpu %d - %s %s: cpu%d - %s %s: out of heap Pentium Pro with MMX, Pentium II%s: pset_bind - %s %s: pset_assign - %s %s: cannot create thread for cpu%d %4s cpu%4s all@`%s: library version m ismatch: needed %d found %d %s: cannot access performance counters - %s UltraSPARC I&IIUltraSPARC I&IIUltraSPARC IIIUltraSPARC IIIi & IIIi+UltraSPARC III+UltraSPARC III+ & IVUltraSPARC IV+UltraSPARC T1UltraSPARC T2UltraSPARC T2+Pentium Pro with MMX, Pentium IIAMD Opteron & Athlon64SPARC64 VI & VII%s: %s is not a recognized cpu type. CPU Type: %s with %d counters Reference: %s %s: out of heap DisrnphuakmMRRTWarning: RT scheduling class does not existWarning: unable to put har into the RT scheduling classUsage: %s [-{i|s|r|M}] [-{u|a|k}] [-DnmRh] [interval [count]] -i outputs per-instruction stats (default) -s outputs per-second stats -r outputs per-reference stats -M switches to memory bandwidth stats -u tracks user mode (default) -k tracks kernel mode -a tracks both kernel and user modes -n suppress titles -p includes per-cpu output -D enable debug mode -m outputs MAX cpu stats (instead of AVG) -R runs har in the RT scheduling class -h print extended usage information Version 2.0 2008/11 Statistics: mips: million instructions per second bus: percentage utilization of address bus from CPUs flops: million floating-point instructions per second cpi: cycles per instruction dcm: data-cache misses icm: instruction-cache miss ecm: external-cache misses itlb: instruction TLB misses dtlb: data TLB misses brr: branch rate bmr: branch misses dsr: data stall rate isr: instruction stall rate fsr: FP-unit stall rate bsr: branch-misprediction stall rate rwb: remote writebacks recm: external-cache misses referencing remote memory US-III Memory Controller Statistics: bw: total bandwidth in MB/s rd: total read bandwidth in MB/s wr: total write bandwidth in MB/s Getting started: o per-instruction and per-second stats are ratios o per-reference stats are percentages o works with Solaris 10 and up o needs to be run as root o be careful with interpreting data on idle systems o some counters may not be working properly CPU info2: %s ?5?|hr ě@@$lVJ=@.../di_initdi_prom_initdi_walk_nodeclock-frequency%s: cannot access performance counters ?5?|hr ě$| UM[f'Cpu$T UM[f'Cpu*$( UM[f'const Cpu* UM[f'$lVJ=@...picnumcpc_setgrp: no re memory available %8s%-2d piccpc_setgrp: no memory available cpc_setgrp: no memory available cpc_setgrp: cpc_strtoset() failed cpc_setgrp: no memory available cpc_setgrp: no memory available cpc_setgrp: no memory available cpc_strtosetrepeated 'pic%d' token missing 'pic%d' value pic%d cannot measure event '%s' on this cpu nousersysinvalid value '%s' for attribute '%s' picnumpicnumno memory available picnumpic%dpicnouser%dnousersys%dsys%s%d%snousernousersyssysbad token '%s' no memory available cpc_set_add_request() failed: %s count_sibling_usrcount_sibling_sysno memory available Instr_cnt,Cycle_cntCycle_cnt,EC_wbDC_rd,DC_rd_hitDC_wr,DC_wr_hitIC_ref,IC_hitEC_ref,EC_hitLoad_use,Cycle_cntCycle_cnt,Load_use_RAWDispatch0_storeBuf,Cycle_cntDispatch0_IC_miss,Cycle_cntCycle_cnt,Dispatch0_FP_useCycle_cnt,Dispatch0_mispredInstr_cnt,Cycle_cntInstr_cnt,EC_wbDC_rd,DC_rd_hitDC_wr,DC_wr_hitIC_ref,IC_hitEC_ref,EC_hitLoad_use,Instr_cntInstr_cnt,Load_use_RAWDispatch0_storeBuf,Instr_cntDispatch0_IC_miss,Instr_cntInstr_cnt,Dispatch0_FP_useInstr_cnt,Dispatch0_mispredInstr_cnt,Cycle_cntInstr_cnt,EC_wbDC_rd,DC_rd_hitDC_wr,DC_wr_hitIC_ref,IC_hitEC_ref,EC_hitLoad_use,Load_use_RAWDispatch0_storeBuf,Dispatch0_FP_useDispatch0_IC_miss,Dispatch0_mispredPentium Pro with MMX, Pentium IImips bus cpi dcm icm ecm dsr isr fsr bsr %4d %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f $a5$"Q5XUS2$|a5$"Q5XUS2*$Pa5$"Q5Xconst US2*$lVJ=@... UM[f'a5$"Q5XԀInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3UltraSPARC IIImips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%9.2f %9.2f %9.2f %4d %9.2f %9.2f %9.2f $qd)AMij-LUS3$|qd)AMij-LUS3*$Pqd)AMij-Lconst US3*$lVJ=@... UM[f'qd)AMij-LInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_PC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_DC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,EC_wbEC_miss_local,EC_missesInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_PC_missRstall_IU_use,Re_RAW_missInstr_cnt,Re_DC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,Instr_cntInstr_cnt,EC_miss_remoteInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_PC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_DC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,EC_miss_remoteMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3UltraSPARC III+mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr rwb recm %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f $y8<@VUS3p$|y8<@VUS3p*$Py8<@Vconst US3p*$lVJ=@... UM[f'y8<@VInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_DC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_PC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3UltraSPARC IIIi & IIIi+mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f $# k4?US3i$|# k4?US3i*$P# k4?const US3i*$lVJ=@... UM[f'# k4?ƀInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_PC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_DC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missDC_rd,DTLB_missDC_wr,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,EC_wbEC_miss_local,EC_missesInstr_cnt,Cycle_cntInstr_cnt,DC_rd_missInstr_cnt,DC_wr_missInstr_cnt,EC_missesCycle_cnt,EC_wbInstr_cnt,IC_missInstr_cnt,IC_miss_cancelledRstall_storeQ,Re_PC_missRstall_IU_use,Re_RAW_missInstr_cnt,Re_DC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Instr_cntInstr_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Instr_cntDispatch_rs_mispred,Instr_cntInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,Instr_cntInstr_cnt,EC_miss_remoteInstr_cnt,Cycle_cntDC_rd,DC_rd_missDC_wr,DC_wr_missEC_ref,EC_missesCycle_cnt,EC_wbIC_ref,IC_missIC_ref,IC_miss_cancelledRstall_storeQ,Re_PC_missRstall_IU_use,Re_RAW_missCycle_cnt,Re_DC_missCycle_cnt,Re_FPU_bypassDispatch0_IC_miss,Cycle_cntCycle_cnt,Rstall_FP_useDispatch0_br_target,Dispatch0_mispredDispatch0_2nd_br,Cycle_cntDispatch_rs_mispred,Cycle_cntIC_ref,ITLB_missInstr_cnt,DTLB_missInstr_cnt,DTLB_missIU_Stat_Br_count_taken,IU_Stat_Br_count_untakenIU_Stat_Br_miss_taken,IU_Stat_Br_miss_untakenFA_pipe_completion,FM_pipe_completionEC_wb_remote,EC_miss_remoteMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3UltraSPARC III+ & IVmips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr rwb recm %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f $xRulEKhRJ0US4p$|xRulEKhRJ0US4p*$PxRulEKhRJ0const US4p*$lVJ=@... UM[f'xRulEKhRJ0FP_instr_cnt,Instr_cntL2_imiss,Instr_cntL2_dmiss_ld,Instr_cntFP_instr_cnt,Instr_cntDC_miss,Instr_cntIC_miss,Instr_cntL2_imiss,Instr_cntL2_dmiss_ld,Instr_cntITLB_miss,Instr_cntDTLB_miss,Instr_cntBr_taken,Instr_cntBr_completed,Instr_cntFP_instr_cnt,Instr_cntDC_miss,Instr_cntIC_miss,Instr_cntL2_imiss,,Instr_cntL2_imiss_ld,Instr_cntITLB_miss,Instr_cntDTLB_miss,Instr_cntUltraSPARC T1mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f $< CڃWfS~ ̒UST1$|< CڃWfS~ ̒UST1*$P< CڃWfS~ ̒const UST1*$lVJ=@... UM[f'< CڃWfS~ ̒Instr_cnt,Instr_FGU_arithmeticL2_imiss,L2_dmiss_ldInstr_cnt,Instr_FGU_arithmeticL2_imiss,L2_dmiss_ldInstr_cnt,DC_missInstr_cnt,IC_missInstr_cnt,L2_imissInstr_cnt,L2_dmiss_ldInstr_cnt,ITLB_missInstr_cnt,DTLB_missInstr_cnt,Br_takenInstr_cnt,Br_completedInstr_cnt,Instr_FGU_arithmeticL2_imiss,L2_dmiss_ldDC_miss,IC_missL2_imiss,L2_imiss_ldITLB_miss,DTLB_missBr_taken,Br_completedUltraSPARC T2mips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f $#.@6qo 4UST2$|#.@6qo 4UST2*$P#.@6qo 4const UST2*$lVJ=@... UM[f'#.@6qo 4instruction_counts,cycle_counts,floating_instructions,impdep2_instructions,sx_read_count_pf,sx_read_count_dminstruction_counts,cycle_counts,sx_miss_count_pf,sx_miss_count_dm,op_r_iu_req_mi_go,if_r_iu_req_mi_go,trap_DMMU_miss,trap_IMMU_missinstruction_counts,cycle_counts,flush_rs,branch_instructions,fl_comp_waitinstruction_counts,cycle_counts,floating_instructions,impdep2_instructions,sx_read_count_pf,sx_read_count_dminstruction_counts,cycle_counts,sx_miss_count_pf,sx_miss_count_dm,op_r_iu_req_mi_go,if_r_iu_req_mi_go,trap_DMMU_miss,trap_IMMU_missinstruction_counts,cycle_counts,sx_miss_count_pf,sx_miss_count_dm,sx_read_count_pf,sx_read_count_dm,instruction_counts,cycle_counts,flush_rs,branch_instructions,fl_comp_wait,floating_instructions,impdep2_instructionsinstruction_counts,cycle_counts,floating_instructions,impdep2_instructions,sx_read_count_pf,sx_read_count_dminstruction_counts,cycle_counts,sx_miss_count_pf,sx_miss_count_dm,op_r_iu_req_mi_go,if_r_iu_req_mi_go,trap_DMMU_miss,trap_IMMU_missinstruction_counts,cycle_counts,flush_rs,branch_instructions,fl_comp_waitMC_reads_0,MC_writes_0MC_reads_1,MC_writes_1MC_reads_2,MC_writes_2MC_reads_3,MC_writes_3SPARC64 VI & VIImips bus mflops cpi dcm icm ecm itlb dtlb brr bmr dsr isr fsr bsr %4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %9s %9s %9s bwrdwr%4d %9.2f %9.2f %9.2f %9.2f %9.2f %9.2f $i@pl |Sparc64$i@pl |Sparc64*$Ti@pl |const Sparc64*$lVJ=@... UM[f'i@pl |inst_retired,cpu_clk_unhalteddata_mem_refs,dcu_lines_inl2_ifetch,ifu_ifetchl2_lines_in,l2_rqstsbr_inst_retired,inst_retiredbr_miss_pred_retired,br_inst_retireditlb_miss,ifu_ifetchdcu_miss_outstanding,cpu_clk_unhaltedifu_mem_stall,cpu_clk_unhaltedcycles_div_busy,cpu_clk_unhaltedflops,cpu_clk_unhaltedinst_retired,cpu_clk_unhaltedinst_retired,dcu_lines_ininst_retired,l2_ifetchinst_retired,l2_lines_inbr_inst_retired,inst_retiredinst_retired,br_miss_pred_retiredinst_retired,itlb_missinst_retired,dcu_miss_outstandinginst_retired,ifu_mem_stallcycles_div_busy,inst_retiredflops,cpu_clk_unhaltedinst_retired,cpu_clk_unhalteddcu_lines_in,l2_lines_inl2_ifetch,itlb_missbr_inst_retired,br_miss_pred_retireddcu_miss_outstanding,ifu_mem_stallcycles_div_busy,cpu_clk_unhaltedflops,cpu_clk_unhaltedPentium Pro with MMX, Pentium IImips bus mflops cpi dcm icm ecm itlb brr bmr dsr isr fsr%4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f $+CfLL|/uAgP6$x+CfLL|/uAgP6*$P+CfLL|/uAgconst P6*$lVJ=@... UM[f'+CfLL|/uAgFR_retired_x86_instr_w_excp_intr,BU_cpu_clk_unhaltedDC_access,DC_refill_from_L2,DC_refill_from_systemIC_fetch,IC_refill_from_L2,IC_refill_from_systemBU_fill_req_missed_L2,BU_internal_L2_reqFR_retired_branches_w_excp_intr,FR_retired_x86_instr_w_excp_intr FR_retired_branches_mispred,FR_retired_branches_w_excp_intrIC_itlb_L1_miss_L2_miss,IC_fetchFR_dispatch_stall_segment_load,BU_cpu_clk_unhaltedIC_instr_fetch_stall,BU_cpu_clk_unhaltedFR_dispatch_stall_fpu_full,BU_cpu_clk_unhaltedpic0=FP_dispatched_fpu_ops,cmask0=0,umask0=0x7,pic1=BU_cpu_clk_unhaltedFR_retired_x86_instr_w_excp_intr,BU_cpu_clk_unhaltedFR_retired_x86_instr_w_excp_intr,DC_refill_from_L2,DC_refill_from_systemFR_retired_x86_instr_w_excp_intr,IC_refill_from_L2,IC_refill_from_systemFR_retired_x86_instr_w_excp_intr,BU_fill_req_missed_L2FR_retired_branches_w_excp_intr,FR_retired_x86_instr_w_excp_intrFR_retired_x86_instr_w_excp_intr,FR_retired_branches_mispredFR_retired_x86_instr_w_excp_intr,IC_itlb_L1_miss_L2_missFR_retired_x86_instr_w_excp_intr,FR_dispatch_stall_segment_loadFR_retired_x86_instr_w_excp_intr,IC_instr_fetch_stallFR_dispatch_stall_fpu_full,FR_retired_x86_instr_w_excp_intrpic0=FP_dispatched_fpu_ops,cmask0=0,umask0=0x7,pic1=BU_cpu_clk_unhaltedFR_retired_x86_instr_w_excp_intr,BU_cpu_clk_unhaltedDC_refill_from_L2,DC_refill_from_systemIC_refill_from_L2,IC_refill_from_system,IC_itlb_L1_miss_L2_missFR_retired_branches_w_excp_intr,FR_retired_branches_mispred,BU_fill_req_missed_L2FR_dispatch_stall_segment_load,IC_instr_fetch_stallFR_dispatch_stall_fpu_full,BU_cpu_clk_unhaltedpic0=FP_dispatched_fpu_ops,cmask0=0,umask0=0x7,pic1=BU_cpu_clk_unhaltedAMD Opteron & Athlon64mips bus mflops cpi dcm icm ecm itlb brr bmr dsr isr fsr%4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f $|͔h4i)?Opteron$|͔h4i)?Opteron*$T|͔h4i)?const Opteron*$lVJ=@... UM[f'|͔h4i)?inst_retired,cpu_clk_unhalteddata_mem_refs,dcu_lines_inl2_ifetch,ifu_ifetchl2_lines_in,l2_rqstsbr_inst_retired,inst_retiredbr_miss_pred_retired,br_inst_retireditlb_miss,ifu_ifetchdcu_miss_outstanding,cpu_clk_unhaltedifu_mem_stall,cpu_clk_unhaltedcycles_div_busy,cpu_clk_unhaltedflops,cpu_clk_unhaltedinst_retired,cpu_clk_unhaltedinst_retired,dcu_lines_ininst_retired,l2_ifetchinst_retired,l2_lines_inbr_inst_retired,inst_retiredinst_retired,br_miss_pred_retiredinst_retired,itlb_missinst_retired,dcu_miss_outstandinginst_retired,ifu_mem_stallcycles_div_busy,inst_retiredflops,cpu_clk_unhaltedinst_retired,cpu_clk_unhalteddcu_lines_in,l2_lines_inl2_ifetch,itlb_missbr_inst_retired,br_miss_pred_retireddcu_miss_outstanding,ifu_mem_stallcycles_div_busy,cpu_clk_unhaltedflops,cpu_clk_unhaltedPentium 4 with HyperThreadingmips bus mflops cpi dcm icm ecm itlb brr bmr dsr isr fsr%4d %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %4.0f %3.1f %4.0f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f %3.1f $6.oʰ%s:F}Xeon$|6.oʰ%s:F}Xeon*$P6.oʰ%s:F}const Xeon*$lVJ=@... UM[f'6.oʰ%s:F},sys,sys,nouserh00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t0000000000---+-D-^-v-- Cx Dx--'H . o &oVoWW oox٨CC(4}0ec@L(`eXXXXhH`Ȅȸ8հ܄܌ܸHDph  @  X  `8", 6:>;<??dIIR[hdhi4liXjlm$x xX@dX0(`Pt@4`0`ƈPt@ҬԤ4,@0x x8<(@    `H|8h(!&&'(xH؈/0/`5;@,@4@xAH 'HVWWW\ Cx Dx E  `txhhߠ߰ U[ C, *߈6ߤEC, ]E h\ ry (H$ a| DK DPp ` X @ <I|HNxY_`enxXtp` @@ 8  $  @P °\ &@ G, j0 h4 0( `Ȑ(   ՘  !P  8H  O  f  }!( 8"  O,  f5  h!I  8R  O[H  fdH  !x0( 8  O  fx      @  0  p@    h  0      X           xH   !  /@  5 ;  %-ߘ9 DCx Nc8` ը( x۔ X H 4 ab x  @ < ^  |$ 0 #+/  <Ө$ Rw edh ", i4 t  \x  cD 8(  Dx $  ;Cx A$ U$ g08 w   X ! x  (x )ݼ y ڀ 0 | 8(T i$ pj   (| $ ` ^ (, S p c܄ (( ڼ 8 &( 7 < F& p < ,$ ۈ Ԥ    x  Ҭ D <( pxX  4t E\ ~  0( `  `xzI 4t h\ $ x  ,"h <`$ MR\ r@, ܄|  8"ژ1d$ B@ h`$ xPX 8  8,$ =*  N  b uݤ$ڰ  m   -A Qˌ$ cd4 u   h 'հ F  `       P$ $  ڌ 8!` , JhHL XD  s_ }_ H 5  X ۬9$ K8\P l ۠T| Tq ƈ$ 1; X0 u( 6 mt 0  x ) `t S q۸xȄ  ?  @44 @l   vt~d . /0  xX >\GSը( g0@  :  ܨ X$ D7("Dx ٨  X x  H +ܜ8;l X<$ gx X /` (88  a4 D   6: QH  {( (   ` al  0$$ A( ], x    ܸ !  !(x8!: !A!KD !} !H ! ` !!I !!"" [h ",?t "W"\] "d "u "h"| #[݌#e$ #y,  #X#ݘ#`h #@"$ $+I  !$<$ $NP $u_ $}$$@l $o $݀$@!$$ $(h %*  %$@xX %KL"%i %8% %`D %0 & &1&9$! &C" < &h>  & p &ch &p8&&H &$ &&m  '  ''Z|$ 'n@ ' X 'l( , ($X  (F$ (Vh ((&4 (@(iX (4)+x ))  *h  *( *+t *V *q( *\ *ܴ*'` *h*PP * *D+߰+I  +3t  +U`D +_$ +rH+d$ +(+@l +4"+ƈ ,8t ,5h,>4 ,@ p ,$ ,t,$ ,0( -   --" -H؈$ -Y @  -z  - ..<ݰ.LL.U  .u@ p .8...d.$ .X.(  .t  /PP /!`/0\  /7ش$ /J  /[( /~  / /H`/ /ȸd 0$ 0!0)( 0Z"0r 0|P 08$ 0l  0 1d$ 1 1^P1n1{܌ 1X 1  11p 1  282.|%ٴ2<82Iڤ2RP$@ 9ܐhar2crti.sCCrti.s__cplus_fini_at_exit_ex_shared0_cpp_finidata0__ex_deregister_at_exit_ex_range0_ex_text0crt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatahar.cc__optionscpcnb_countersopts__1cNcpustat_errfn6Fpkci1pv_v___1cDstdbH__REF_TO__RTTI__1nDstdJbad_alloc__bus.cc__1cbCinspect_node_clock_frequency6FpnHdi_node_pv_i_Cpu.ccsetgrp.cc__1cHemalloc6FI_pv___1cRcpc_setgrp_walker6FpvipkcXIipknKcpc_attr_t__v___1cUcpc_setgrp_picwalker6FpvipkcXIipknKcpc_attr_t__v___1cRcpc_setgrp_delset6FpnM__cpc_setgrp__v_strtoset.ccnreqsncountersnattrsntokstok_infotok_funcsattrlistfound__1cMstrtoset_err6FpkcE_v___1cMevent_walker6FpvIpkc_v___1cLevent_valid6Fipc_i___1cKfind_event6Fpc_i___1cDpic6Fipc_i___1cEflag6Fipc_i___1cGdoattr6Fipc_i___1cRattr_count_walker6Fpvpkc_v___1cPcpc_count_attrs6FpnF__cpc__i___1cLattr_walker6Fpvpkc_v___1cLsmt_special6Fi_v___1cQstrtoset_cleanup6F_v_us2.cc___const_seg_900000806___const_seg_900000901___const_seg_900001001___const_seg_900001701us3.cc___const_seg_900001106___const_seg_900001201___const_seg_900001301___const_seg_900001401us3p.ccus3i.ccus4p.ccust1.cc___const_seg_900000706___const_seg_900000801ust2.ccsparc64.cc___const_seg_900000606___const_seg_900000701p6.ccopteron.ccxeon.ccCCrtn.s_ex_shared1_ex_range1_ex_text1crtn.s_END__START___1cDUS2Pper_instruction6MippXdd_v___1cHSparc642t5B6M_v___1c2k6Fpv0_v_thr_create__1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___Hreplace6MIIIc_r1_pset_assigncpc_npic__1cPcpc_setgrp_free6FpnM__cpc_setgrp__v___1cCP6Lprint_title6M_v___1cKsum_metric6Fii_d___1cHSparc64Tprint_memory_percpu6MipnGtstate__v___1cEUS4pRper_second_memory6MippXdd_v___1cEUS4pPper_instruction6MippXdd_v_.ld_llong__RTTI__1CpknEUS4p___1cDUS22t6M_v___div64__1cEXeon2T6M_v___RTTI__1CpnHOpteron___1cEUS4p2T5B6M_v___1cEUS3iRper_second_memory6MippXdd_v___1cH__CimplKcplus_fini6F_v_cpc_set_sample__1cEUST1Lprint_title6M_v___1cEUS3iLprint_title6M_v_vfprintffree_GLOBAL_OFFSET_TABLE___1cDCpuLgetPiEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E______cpc_walk_events_pic__mul64__1cEUS3p2t5B6M_v___1cKavg_metric6Fii_d__Q_qtoucpc_buf_createcpc_version__1cCP62T6M_v_di_fini__RTTI__1nDCpu___1cDUS3Kper_second6MippXdd_v_di_init__RTTI__1CpknEUS3i___RTTI__1CpnDUS2___1cCP6G__vtbl___1cG__CrunMex_rethrow_q6F_v_snprintf__1cMcpc_strtoset6FpnF__cpc_pkci_pnJ__cpc_set____1cHOpteronKper_second6MippXdd_v___1cEUS3p2t6M_v___1cHOpteronNprint_metrics6MipFii_d_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2t6Mpkcrkn0C__v__Q_utoqsysconf__1cG__CrunIex_throw6Fpvpkn0AQstatic_type_info_pF1_v_v___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t5B6Mpkn0D_4rkn0E__v___1cRcpc_setgrp_newset6FpnM__cpc_setgrp_pkcpi_1_optind__1cEUS3iNprint_metrics6MipFii_d_v___1cHSparc64Rper_second_memory6MippXdd_v___1cHOpteronPper_instruction6MippXdd_v___RTTI__1CpknHOpteron___1cDCpuMcalc_metrics6MippXdd_v_.ld_float__1cQcpc_setgrp_reset6FpnM__cpc_setgrp__v___1cDUS32t6M_v___1cDUS2Rper_second_memory6MippXdd_v___1cDCpuLgetPrEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E______pset_bind__1cDstdJbad_allocG__vtbl___1cEUST12t6M_v__endtargetCpu__1cHOpteronRper_second_memory6MippXdd_v___1cDCpuOsetMetricsType6Mi_v___1cG__CrunHex_skip6F_b___RTTI__1nHSparc64_cpc_cpuref__1cEUST2Tprint_memory_percpu6MipnGtstate__v___1cEUS3pKgetCpuType6kM_pc___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2T6M_v___1cCP6KgetCpuType6kM_pc___1cEUST2Nprint_metrics6MipFii_d_v___1cEUST22t6M_v___1cEUS3pNprint_metrics6MipFii_d_v_cpc_cciname__1cEUS4pNper_reference6MippXdd_v___1cEUST1Uprint_memory_metrics6MipFii_d_v___1cScpc_setgrp_nextset6FpnM__cpc_setgrp__pnJ__cpc_set____1cDstdEendl4Ccn0ALchar_traits4Cc___6Frn0ANbasic_ostream3CTACTB___4___1cEUS4pNprint_metrics6MipFii_d_v___1cDCpuLgetPsEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E_______PROCEDURE_LINKAGE_TABLE___1cEUS3iNper_reference6MippXdd_v___1cEUST2Uprint_memory_metrics6MipFii_d_v___1cDUS3Pper_instruction6MippXdd_v___RTTI__1CpnEUS3i___1cEUS4pKgetCpuType6kM_pc_strdup__1cDCpuLprint_title6M_v___RTTI__1nEUST2___1cEUS3iPper_instruction6MippXdd_v___1cEXeonRper_second_memory6MippXdd_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2G6Mrk1_r1__Q_mul__1cEUST2Pper_instruction6MippXdd_v___1cEUS3pG__vtbl_processor_info__RTTI__1nEUS3i___1cHSparc64Nper_reference6MippXdd_v___RTTI__1nDUS2___1cG__CrunKvector_des6FpvIIpF1_v_v___1cDstdEcopy4Cpkn0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____Cp1_6FTA5TB_6___1cEUS4pG__vtbl__lib_version__1cHOpteronG__vtbl___RTTI__1nEUST1___1cEXeon2t6M_v___1cHOpteron2T6M_v___1cEUST22T5B6M_v_cpc_set_add_requeststrcmp__1cHOpteron2T5B6M_v___1cEUS4pMprint_percpu6MipnGtstate__v___1cEUS4p2t5B6M_v___1cDstdNbasic_ostream4Ccn0ALchar_traits4Cc___Dput6Mc_r1___1cEUST12T5B6M_v___1cEXeonNprint_metrics6MipFii_d_v___RTTI__1CpknCP6___1cFgtick6Fpv_0___1cNget_bus_clock6F_d__environ__1cDstd2l6Frn0ANbasic_ostream4Ccn0ALchar_traits4Cc____pkc_2___1cDCpuXsetMemoryMetricsCapable6Mb_v_errno__1cHOpteronNper_reference6MippXdd_v___1cDUS2Kper_second6MippXdd_v___1cDUS3Lprint_title6M_v___1cEUS3pNper_reference6MippXdd_v___1cEUST1Nprint_metrics6MipFii_d_v___1cEUST1KgetCpuType6kM_pc___1cHSparc64KgetCpuType6kM_pc___RTTI__1CpnEUS4p___RTTI__1CpknEXeon_calloc__1cDCpuG__vtbl_.st_double__1cDCpuOgetMetricsType6kM_i___1cDhar6F_i___1cDUS3KgetCpuType6kM_pc_.st_llong.ld_double__1cScpc_setgrp_getname6FpnM__cpc_setgrp__pkc___1cEXeonPper_instruction6MippXdd_v___1cDCpu2T5B6M_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2G6Mpkc_r1___RTTI__1CpnDUS3___1cDUS3G__vtbl___1cQcpc_setgrp_clone6FpnM__cpc_setgrp__1___1cEUS3iTprint_memory_percpu6MipnGtstate__v_getopt__1cG__CrunIex_clean6F_v_strrchr__1cCP62T5B6M_v____Argvstrtoset_errfn_etextcpc_bind_cpu__RTTI__1CpknHSparc64___1cEUS3pMprint_percpu6MipnGtstate__v___1cDCpuNgetNbCounters6kM_i___1cDUS2Nprint_metrics6MipFii_d_v___1cEUS3pRper_second_memory6MippXdd_v___1cEUS3iUprint_memory_metrics6MipFii_d_v___1cEUST2KgetCpuType6kM_pc___1cHSparc64Kper_second6MippXdd_v___1cDUS3Uprint_memory_metrics6MipFii_d_v___1cHSparc64Lprint_title6M_v_strcpy__1cDUS2KgetCpuType6kM_pc___1cEUS3pTprint_memory_percpu6MipnGtstate__v__edata__1cEXeonLprint_title6M_v___1cEUST1Mprint_percpu6MipnGtstate__v___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2G6Mrk1_r1_strtoll__1cEUS4pLprint_title6M_v___1cEXeon2T5B6M_v___1cEXeonKgetCpuType6kM_pc___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____J__destroy6Mpn0D_3_v_strerror__cg92_used__1cHSparc642t6M_v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___J__nullref___1cDUS22T5B6M_v___1cDCpuJgetEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E________1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2T5B6M_v___1cDUS32T5B6M_v_di_walk_node__1cEUS4pTprint_memory_percpu6MipnGtstate__v___RTTI__1CpnHSparc64_cpc_buf_add__1cDstdZ__RTTI__1nDstdJbad_alloc___ex_register__1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t6Mrk1_v_atexit__1cDUS3Mprint_percpu6MipnGtstate__v___1cDCpu2T6M_v___1cEUS4p2T6M_v___1cRcpc_setgrp_gethdr6FpnM__cpc_setgrp__pkc_di_prom_init__1cEXeonKper_second6MippXdd_v___RTTI__1nCP6___fsr_init_value__1cDUS3Nprint_metrics6MipFii_d_v___1cEXeonNper_reference6MippXdd_v___1cEUST1G__vtbl___1cHOpteronKgetCpuType6kM_pc_.st_float_foreff__1cEUST22t5B6M_v___1cDCpuNprint_metrics6MipFii_d_v___1cEUS3pLprint_title6M_v___1cDCpuUprint_memory_metrics6MipFii_d_v___1cHOpteron2t5B6M_v___1cEUST12t5B6M_v___1cDstdJexception2T5B6M_v___1cEUST1Kper_second6MippXdd_v_.st_double_foreff__1cScpc_setgrp_getbufs6FpnM__cpc_setgrp_pppnJ__cpc_buf_55_i___RTTI__1nEUS4p___1cDstdJbad_alloc2T5B6M_v___1cScpc_setgrp_sysonly6FpnM__cpc_setgrp__i___1cHSparc64Sprint_memory_title6M_v___1cDCpuMprint_percpu6MipnGtstate__v___1cDUS2Mprint_percpu6MipnGtstate__v_strncat__1cCP6Rper_second_memory6MippXdd_v___1cEUS3iG__vtbl_strlenuk_string__1cOcpc_setgrp_new6FpnF__cpc_i_pnM__cpc_setgrp____1cCP62t6M_v___1cDCpu2t5B6M_v___1cCP6Nprint_metrics6MipFii_d_v_cpc_walk_requests__1cEUS3i2T5B6M_v_di_prom_prop_lookup_bytesatof__rem64__1cEUS3iKper_second6MippXdd_v___1cEUS3pUprint_memory_metrics6MipFii_d_v_atoi.ld_int__1cCP62t5B6M_v___1cDstdSuninitialized_copy4Cpkn0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____Cp1_6FTA5TB_6_strncpy__1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t6Mpkn0D_4rkn0E__v_getsubopt__RTTI__1CpknEUS3p___1cEUS3pKper_second6MippXdd_v___1cG__CrunKpure_error6F_v_cpc_set_create__1cEUST2Nper_reference6MippXdd_v___1cG__CrunVdo_exit_code_in_range6Fpv1_v___1cDstdJexception2T6M_v___1cEUS3i2T6M_v___RTTI__1CpnDCpu___1cEUST1Rper_second_memory6MippXdd_v_.st_int__1cG__CrunIex_alloc6FI_pv___1cEUST2Mprint_percpu6MipnGtstate__v_maincpc_walk_attrs__iob__RTTI__1CpknEUST2___1cEUST1Nper_reference6MippXdd_v___1cEXeon2t5B6M_v___1cEXeonMprint_percpu6MipnGtstate__v___1cG__CrunMdo_exit_code6F_v___1cDCpuWisMemoryMetricsCapable6kM_b___1cEXeonG__vtbl___1cEUST1Pper_instruction6MippXdd_v___1cRcpc_setgrp_getset6FpnM__cpc_setgrp__pnJ__cpc_set____1cDUS22t5B6M_v___1cDCpuSprint_memory_title6M_v___xargv__RTTI_____1cEUS3pPper_instruction6MippXdd_v___1cEUS3pSprint_memory_title6M_v___1cDUS32t5B6M_v___1cKmax_metric6Fii_d___1cDUS2G__vtbl_setvbuf__1cDCpu2t6M_v___RTTI__1CpknEUST1_strncmp__1cEUS4p2t6M_v___1cHSparc642T5B6M_v___1cDstdNbasic_ostream4Ccn0ALchar_traits4Cc___Fflush6M_r1___RTTI__1nHOpteron___1cQcpc_setgrp_accum6FpnM__cpc_setgrp_1_v___1cCP6Mprint_percpu6MipnGtstate__v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2t6Mrk1_v___1cDCpuKgetCpuType6kM_pc___1cEUS4pSprint_memory_title6M_v___RTTI__1nDUS3___1cScpc_setgrp_numsets6FpnM__cpc_setgrp__i___dtou__1cHOpteronLprint_title6M_v___1c2k6Fpv_v___1cEUS3iMprint_percpu6MipnGtstate__v___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___I__unLink6M_v___1cDstdGvector4n0AMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc____n0AJallocator4n0D____2t5B6Mrk1_v___1cDstdNbasic_ostream4Ccn0ALchar_traits4Cc___2l6MpFr1_2_2___1cDUS3Tprint_memory_percpu6MipnGtstate__v___1cDUS22T6M_v___1cDstdJbad_alloc2T6M_v___1cEUS4pUprint_memory_metrics6MipFii_d_v___1cEUST2Lprint_title6M_v___1cHOpteron2t6M_v___1cEUS3p2T5B6M_v_di_prom_fini__1cHOpteronMprint_percpu6MipnGtstate__v_gettext__1cDstdJbad_alloc2t5B6M_v___xargccpc_buf_copy__environ_lock__1cEUS3iKgetCpuType6kM_pc___1cEUST2Sprint_memory_title6M_v_.st_float__RTTI__1CpnEUST2___1cG__CrunKex_rethrow6F_v___RTTI__1CpnCP6___1cDstdJexceptionG__vtbl___1cCP6Kper_second6MippXdd_v__ex_deregister__1cEUST2Kper_second6MippXdd_v___1cHSparc64Uprint_memory_metrics6MipFii_d_v__DYNAMIC__1cH__rwstdJ__destroy4CpnDstdMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc_____6FTA4_v___1cEUS3i2t5B6M_v___RTTI__1CpnEUST1_cpc_unbind__RTTI__1CpknDUS3___1cHSparc64Pper_instruction6MippXdd_v___1cEUS3p2T6M_v_malloc__1cDUS3Rper_second_memory6MippXdd_v___RTTI__1nEXeon___1cDUS3Sprint_memory_title6M_v___1cDCpuRgetPsMemoryEvents6kM_nDstdGvector4n0BMbasic_string4Ccn0BLchar_traits4Cc__n0BJallocator4Cc____n0BJallocator4n0E________1cHSparc64Nprint_metrics6MipFii_d_v___1cH__CimplKcplus_init6F_v_cpc_set_destroycpc_open__1cEUS4pKper_second6MippXdd_v___1cEUS3i2t6M_v___1cEUST2G__vtbl_reallocpriocntlcpc_seterrhndlr__RTTI__1CpknDUS2_cpc_caps__1cDUS32T6M_v___1cEUST1Sprint_memory_title6M_v___1cDstdJbad_alloc2t6M_v___1c2n6FIpv_0__start__RTTI__1CpnEXeon___1cEUST12T6M_v___1cCP6Pper_instruction6MippXdd_v___1cHSparc642T6M_v___1cCP6Nper_reference6MippXdd_v___1cDstdEcout___1cHSparc64Mprint_percpu6MipnGtstate__v___1cDUS2Nper_reference6MippXdd_v___RTTI__1CpknDCpu_metrics__1cWcpc_setgrp_has_sysonly6FpnM__cpc_setgrp__i__get_exit_frame_monitornanosleep__1cEUST2Rper_second_memory6MippXdd_v___RTTI__1nEUS3p___1cEUS3iSprint_memory_title6M_v___1cEUST1Tprint_memory_percpu6MipnGtstate__v___RTTI__1CpnEUS3p___1cDstdMbasic_string4Ccn0ALchar_traits4Cc__n0AJallocator4Cc___2T6M_v_cpc_buf_destroykonly_string__1cDUS2Lprint_title6M_v___1cDCpuNsetNbCounters6Mi_v___1cEUST22T6M_v_perror__1cDUS3Nper_reference6MippXdd_v___1cDCpuTprint_memory_percpu6MipnGtstate__v___1cHSparc64G__vtbl___1c2n6FI_pv_cpc_buf_tickp_onlinecpc_buf_get@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)pset.h 1.5 04/08/13 SMI@(#)priocntl.h 1.20 07/02/07 SMI@(#)rtpriocntl.h 1.13 01/01/31 SMI@(#)thread.h 1.153 08/06/04 SMI@(#)klwp.h 1.51 07/01/14 SMI@(#)pcb.h 1.36 02/03/01 SMI@(#)msacct.h 1.10 04/08/11 SMI@(#)lwp.h 1.34 04/09/28 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)contract.h 1.2 04/09/28 SMI@(#)kcpc.h 1.7 07/10/12 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)libdevinfo.h 1.32 08/01/04 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)sunddi.h 1.173 08/01/21 SMI@(#)dditypes.h 1.40 07/07/18 SMI@(#)ddipropdefs.h 1.22 04/09/20 SMI@(#)devops.h 1.50 05/06/14 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.32 04/03/23 SMI@(#)buf.h 1.55 04/06/22 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)as.h 1.91 08/02/05 SMI@(#)watchpoint.h 1.9 04/06/25 SMI@(#)seg_enum.h 1.8 05/05/17 SMI@(#)copyops.h 1.5 04/06/25 SMI@(#)thread.h 1.153 08/06/04 SMI@(#)klwp.h 1.51 07/01/14 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)pcb.h 1.36 02/03/01 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)msacct.h 1.10 04/08/11 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)lwp.h 1.34 04/09/28 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)contract.h 1.2 04/09/28 SMI@(#)kcpc.h 1.7 07/10/12 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)aio_req.h 1.7 00/05/22 SMI@(#)avl.h 1.11 06/03/10 SMI@(#)avl_impl.h 1.8 04/07/15 SMI@(#)seg.h 1.74 07/02/27 SMI@(#)vnode.h 1.128 07/01/23 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)kmem.h 1.37 06/03/10 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.108 07/09/20 SMI@(#)page.h 1.176 07/09/20 SMI@(#)proc.h 1.208 08/06/04 SMI@(#)user.h 1.75 07/03/05 SMI@(#)timer.h 1.23 08/06/12 SMI@(#)utrap.h 1.6 03/04/21 SMI@(#)model.h 1.24 04/09/28 SMI@(#)refstr.h 1.1 99/03/31 SMI@(#)rctl.h 1.15 07/11/26 SMI@(#)list.h 1.4 06/03/10 SMI@(#)list_impl.h 1.1 03/02/05 SMI@(#)door_impl.h 1.1 04/05/15 SMI@(#)ddidmareq.h 1.29 06/06/08 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.46 07/09/20 SMI@(#)ddidevmap.h 1.22 07/02/07 SMI@(#)ddifm.h 1.6 07/01/10 SMI@(#)nexusdefs.h 1.20 07/07/18 SMI@(#)ddi_intr.h 1.3 07/07/18 SMI@(#)ddi_intr_impl.h 1.10 07/10/19 SMI@(#)cmn_err.h 1.33 04/09/28 SMI@(#)ddi_impldefs.h 1.114 07/12/01 SMI@(#)autoconf.h 1.56 08/01/04 SMI@(#)obpdefs.h 1.36 07/04/10 SMI@(#)systm.h 1.141 07/01/29 SMI@(#)dacf_impl.h 1.3 03/12/09 SMI@(#)dacf.h 1.2 02/06/17 SMI@(#)ndifm.h 1.3 07/01/10 SMI@(#)ddifm_impl.h 1.7 07/01/10 SMI@(#)errorq.h 1.2 04/03/17 SMI@(#)nvpair.h 1.13 04/02/08 SMI@(#)epm.h 1.48 07/01/28 SMI@(#)pm.h 1.23 07/01/28 SMI@(#)taskq.h 1.4 04/05/21 SMI@(#)ddi_isa.h 1.10 04/03/17 SMI@(#)ddi_implfuncs.h 1.53 07/07/18 SMI@(#)task.h 1.10 08/06/04 SMI@(#)project.h 1.14 07/09/26 SMI@(#)ipc_rctl.h 1.1 07/02/07 SMI@(#)zone.h 1.19 07/09/26 SMI@(#)pset.h 1.5 04/08/13 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)label.h 1.2 07/11/19 SMI@(#)netstack.h 1.2 07/05/22 SMI@(#)uadmin.h 1.31 07/01/14 SMI@(#)devctl.h 1.16 04/06/24 SMI@(#)sunpm.h 1.10 07/11/15 SMI@(#)sysevent.h 1.15 04/06/03 SMI@(#)stream.h 1.115 08/07/15 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)sunmdi.h 1.16 06/08/08 SMI@(#)note.h 1.2 95/03/21 SMI@(#)esunddi.h 1.25 06/03/10 SMI@(#)openpromio.h 1.20 03/05/06 SMI@(#)devinfo_impl.h 1.22 06/06/11 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)setgrp.c 1.2 04/03/15 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)strtoset.c 1.1 04/02/04 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI@(#)cpucmds.h 1.4 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.28 07/02/01 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)libcpc_impl.h 1.3 04/09/28 SMI@(#)libcpc.h 1.4 04/09/28 SMI@(#)cpc_impl.h 1.13 07/10/12 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.22 08/04/16 SMI@(#)rwlock.h 1.10 08/04/16 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)libpctx.h 1.3 04/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMI@(#)privregs.h 1.8 03/05/22 SMI@(#)psr.h 1.4 03/04/21 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)processor.h 1.12 04/08/13 SMI@(#)thread.h 1.49 04/09/28 SMI@(#)synch.h 1.55 08/02/19 SMI@(#)synch.h 1.41 08/02/19 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)float.h 1.22 04/09/28 SMI<x4*<x4<x4 <{4 <}4<z4<z4 <{4 <{4 <{4 <{4 <{4 <~4<y4 <~4 <{4.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.dynamic.ex_shared.cpp_finidata.symtab.strtab.comment.stab.index.shstrtab.stab.indexstrhar.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -R/usr/lib/lwp har.ccmainbus.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -R/usr/lib/lwp bus.ccCpu.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -R/usr/lib/lwp Cpu.ccsetgrp.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -R/usr/lib/lwp setgrp.ccstrtoset.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -R/usr/lib/lwp strtoset.ccus2.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign us2.ccus3.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign us3.ccus3p.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign us3p.ccus3i.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign us3i.ccus4p.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign us4p.ccust1.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign ust1.ccust2.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign ust2.ccsparc64.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign sparc64.ccp6.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign p6.ccopteron.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign opteron.ccxeon.ccV=9.0;DBG_GEN=5.0.8;dm;cd;backend;raw;ptf;ptx;ptk;s;;O;R=5.8<>;A=2/SOFT/HAR/har2/; /ssc/software/compilers/SS11.latest/sparc/SUNWspro/prod/bin/CC -c -xO2 -dalign xeon.cc    "'H'H.oVV-BWW 8BWWT BBWW L\\RCxCxXDxDx^EE<|pWx``ttGxx hhhh8ߠߠ 2߰߰p=   #0 P2^9LL  ~@0707010000777e000081ed00000000000000000000000149fde5a700000094000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/harSTAT.sh#!/bin/sh LANG=C PATH=/etc/STATsrv/bin:$PATH export PATH LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.harSTAT -Timeout $1 0707010000777f000081ed00000000000000000000000149fde5b400000097000000200000001d00000000000000000000002300000000root/etc/STATsrv/bin/harSTATus3.sh#!/bin/sh LANG=C PATH=/etc/STATsrv/bin:$PATH export PATH LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.harSTATus3 -Timeout $1 07070100007780000081ed0000000000000000000000014a2fb6a400000076000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/harSTATv2.sh#!/bin/sh PATH=/etc/STATsrv/bin:$PATH export PATH exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.harSTATv2 -Timeout $1 07070100007782000081ed0000000000000000000000014a94004f0000018c000000200000001d00000000000000000000002500000000root/etc/STATsrv/bin/innodbIOSTAT.sh#!/bin/sh LANG=C export LANG if [ X$1 = X ] then echo "" echo "Usage:" echo " $0 Timeout" echo "" exit 2 fi #=================================================================== # MySQL/InnoDB I/O stats via DTrace #=================================================================== cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.innodbIOSTAT -Timeout $1 2>/dev/null 07070100007783000081ed0000000000000000000000014ba204e70000022e000000200000001d00000000000000000000002300000000root/etc/STATsrv/bin/innodbSTAT.sh#!/bin/sh LANG=C export LANG if [ X$1 = X ] then echo "" echo "Usage:" echo " $0 Timeout" echo "" echo "NOTE: edit $0 file to set connection params, etc." echo "" exit 2 fi #=================================================================== # InnoDB stats directly via WebX.mySQL5 #=================================================================== # Set connection params: User=username Passwd=password Host=server:port export User Passwd Host cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX.mySQL5 /etc/STATsrv/bin/x.innodbSTAT -Timeout $1 07070100007788000081ed0000000000000000000000013717328e0000a33c000000200000001d00000000000000000000001c00000000root/etc/STATsrv/bin/ioSTATELF 4,4 (44o`o`o`o` olol/usr/lib/ld.so.1C\:K<M7WE3'BH?T/PC*,6$F1I-VL9[ARNZ@);Y+0S !%&45"8#.>2(J=DQGUOXl ,   ff f0 o` ol p rs8s@sHp t_hp#q@,v5z:x@!?qGpZpco` yv ppDpPqLqdpqfc@qpol qpx@Mtqp\v!dz r'q-qX2z9qBzIqpPqVphcsHjp qqd<qz Nqo` f0 pv !p4qq(q| MT pt%f +q43pgetopt_startlookup_ks_nameatoivfprintf_environ_end_iobreaddirkstat_chain_update__flsbuf_GLOBAL_OFFSET_TABLE___ctypesignalatexitexitstrerrormallocsprintfopendir_init__cmpdi2fclosestrncpy_DYNAMICstrncmpprintf__iobtimesubstrrchr_exitenviron__floatdisferrnostrchrlstatfreeoptindclosediroptargstrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset__floatdidfkstat_readkcbuild_disk_liststrcpy_etext_lib_versionfflush_ctypenanosleepmainreadlinkmemcpystrlenlookup_nfs_namekstat_open_finifprintfsysconflibkstat.so.1libw.so.1libintl.so.1libposix4.so.1libc.so.1vv&z?zAx5pD(pP)p\8phDptXppp,p[p1p'p4p#p$pPpRq3qJqHq(Uq4Zq@qL*qX>qd+qpBq|Vq-q"qMq=qTq@q7qGqCq0r< @D# @XY"@X@ , @ "@(@X@X㿈@/X< `'` `'㿐('D'H?''''b @Xe@Xf"b b  Yh@ {DHY@XW'耢? 9*`Cx $444444444444D4444444444444444444444444h4 444`444c  "# nc"#gc"#`c"#Yc "#Pc "#Gc "#>c  "# 5c$ "#$,c( "#(#c"#c"#b@W"c,#,`@ @`'8 @ 2# `#`#`  "c "#  "## `  # ` c "## `  # ` c "##,` # `  "#,#` i s/#(` M k/# `   Y@W+/# `     g #bړ* :`ۓ* :`ۓ* :`aYb@WSۓ* :`ۓ* :`aY"@VE#$` ۓ* :`ۓ* :`ړ* :`ۓ* :`ړ* :`#\ۓ* :`#`#daY@Vۓ* :`ۓ* :`ړ* :`ۓ* :`ړ* :`#\ۓ* :`#`#daY8@V#`#$` aY@V aY@V @V'@X#`Cc4'"D@b*`H  @* :`  `   $ @ ` *H@ @ @Vc'b """@ "D@$b*`H @@V;'  Y@ K*"@*`*'b """D@b*`H @@V'䀢  Y@ #b """D@@# `  I@U@!  @ ; "Yc@Ub @U@#`@ # ` @K @""""Z ?'쀢 !*` *#T  " ' Z DB?`'Z Z Z ?#H ?Z D?Z DZ ?#`Z ?#$`e# ` _# `YcY@UX#`YcY@UM# ` #```В "  @U7   В@@ "@ *# `Z`@U#`Z`@U# ` #```В "  @T   В@@ "@ *# `2!c" ' Z D‰" ?! cȐ" ' Z D‰" ?Z`     @T#`S cX" ' Z DD? c\" ' Z DD? c`" ' Z DD? cT# ' Z DD;`#\Z`0  @Tb# ` #```В "  @TL   В@@ "@ *@"'Ԁ * ` @``В "  @T   В@@ "@ *'"# ` @rc "# @#$` # ` b@8# `2!c" ' Z D‰" ?! cȐ" ' Z D‰" ?Z`     @S# ` "'Ԁ  `@'#`S cX" ' Z DD? c\" ' Z DD? c`" ' Z DD? cT# ' Z DD;`#\Z`0  @S9``В "  @S/   В@@ "@ *# ` 4b'Ԁ * ` @^``В "  @R   В@@ "@ *'#`ڗ* :ۙ* ; څ* 8ۅ* 8#\ZPb"@R`@R# ` "'Ԁ  `  `@''䀢`` \䀢 ?'"`  "@"" "@ ⌘ + " * +  "`"b @RYb"" "@  *" * *"b@ b @Rab ""b"" "@ b"G @R!㿈'D# `YcY@R0# ` )"'쀢   ` ` Z`@R  4Z@R'#`YcY@Q``В "  @Q   В@@ "@ *# `Z`@Q# ` "'쀢  `a@Q'#`Z`@Q``В "  @Q   В@@ "@ * "#㿐# ` #$`Z`Z@Q|Z`Z@Qv# ` # `  #$`YcZ@Q_Z`@Q[#$`D``В "  @QL   В@@ "@ *# ` a@Q1``В "  @Q'   В@@ "@ *j# `YcY@Q #`YcY@P``В "  @P   В@@ "@ *# ` a@P# `Z`@P#`Z`@P``В "  @P   В@@ "@ *㾰'DDD 0` b  @ {?ppZ!DZ!?ppZ!腠?xDD `h" ' Z!Dx?DD `l" ' Z!Dx?D?#(`Z!?Z"?DD `X b  @   @ %?X `, 4` 4    @ ?XXXH?XxX?DD `` b  @   @ ?P `, 4` 4    @ ?PPPH?PxP?ȅD?DD (`x b  @  !p?DD @` b  @  !p?Z! ؅Z"DZ!?Z! ؅Z"DZ!?Z! D؅Z"DZ!?DD `p b  @ z !pZ"D?DD 8` b  @ h !pZ"D?#`xD?xD?xD?xD?xD?xD?# ` D `D 'lD `4'l#$`Zal@OH# `    Z U#\Za@O*H#\Za @O;#$`;`;h;p;x;;#\Za8@N;`;h;p;x;;;#\Zap@N# ` s# ` Za@ND ``'`D `t'h'dd Md*@*`h  `  4d*@*`h Z` @Nd*@*`h ` @'`d*@*`h Z`$@Nd*@*`h ` $@'`d`'dZa`@NqZa@Nk# `  #$`Zal@N[bЅDB""bȅDB""㿈"#Hb  '쀢  4 Z @NC  cH "#H '#H *  @Y"#Hb  '쀢 % 4 Z @N b  @N? #H`"#H*` " '#H` Z(@` !X@M(#L`!X@M` !X@M'#H@R *@ " @@M? C`' ''耢  '`'@ " 'a'!''耢 W '`'@ " '`' 㿐`ZH@M`Zh@M}`Z@Mw`Z@Mq`Z@Mk`Z(@Me`Z`@M_`Z@MY`Z@MS`Z@MM`[ @MG`[X@MA`[@M;`[@M5`[@M/`[ @M)`[X@M#`[@M`[@M @L㿈'L'P'T'X'D'HLL'`[@M`H@LD  b@L`[@L`[ @L @L㿐'D'H'LL  D`D@@LH@LD"@@  [(D@ H@L㿈'D'HDH `" '쀢 AD `H`@L'쀢 1D`H` 00" '쀢 "D `H ` DH `@L D `4H`4@L|x#$`b<@"b<b@'#`bc"b  '  S ` 'ܒ*` `Tܔ *@ @L4 ܐ`'ܒ*` # ` T YX@L #`# ` T YH@K '`'   '""     P@K`: 0`: H#$`$"<` T Y8@K   4 @"` `4b<@="`" " ܔ *@ `" b@'@ '䀢 @"@""' '""@"#"b@"""` [8:@ # ` @㿈"#0"'쀢 -" #4'耢  `4@K/  " c0 "#0''"'쀢 & `#,` #0c,  " c0 "#0'㿈"'쀢 B `8`: X`: ``: h` : p`(: x`0: `8: `@: `H: `P: " `@J?  `" ` @J?  ' 㿈b  '쀢  S `  T [P @Ja @  '`'D'D 4' *`: , @*Đ`'`'*"'쀢  ` `4@J; D" 'x'DD `D 'D `4'#$` [b`@IZa@I'D `t''D `x *@*`  @I@'*@*`  ` 2    ?*@*` **  [p@I*@*`   @I@'*@*` ** [ @Iv 'q*@*`  [@I J*@*` *@*` `   @ ` @I'`  `` * `$2 `  0   @6'܍''܅&["?+ @*` [b @I'*@*` ** [$@I '䀢 =耢 [b @H'`'䀢 [b @H[b @H㿐'D["㿐'D'HDH ` DD沔@ " DDD@ "DDH@"@ "DDH`"@ " p'DD' / )@@H`@H'܀ ܔ *@ @Hܐ`'' ,'@H@5'@ @H'䀢 "@'耢 ` @H~' '쀢 @Hq''䀢 䀢   [b@H_' [b@HX''耢 @HN' | *`: .䀢 P @H8` P@  @ P` [@GP` [@GP @T 䀢  P` [@G P` [@GPX@G?$l< ( P@$@G @'L'LP'LL PL@Y~@G`'Q㿈'D'H'H H@D@G H 'H`'㿐'D'HD *`: s D *`: p H 'HD`'D @*H*㿀'D'H'L'P @Gd'쀢 ]D@\'@G^'`'@GP"`  `D` @GSH@GG'`'@G9"@`$@H@G<?" " " P" L` L@" L"L" ` @G @G@G㿈'D[c'D @*`: * :@ `'D`'DD :@F'쀢 *D㻈'D[c[0@F'쀢  $@F * :` # D@ @Fp'D'H'D *`: D *`: /D`'DD *`: D"@F'쀢 "@F'쀢 *DH@'䀢 '`''܀ 4 *`: ' *`:  *`:  ` `'ܐ`'ܐ`'ܐ`' *`: ''Ԁ  *`:  Ԑ`'ؐ`'*'؀ e@E"`D  *`: @'D C?'*'D  *`: / 'ؐ`'D `'ؐ`'@E"` ` `@E`'㿐'D'HH HD` @E H 'HH㿐'D'HD DDDD`H@ D 'Dx'D'H'L'P'TL T'쀢 D`@E?  ,'쀢  0@E)' H" D" L"D@E ''耢 2P "@E * "`  *@ ` *@ [8D@D *@" `'T`iT'쀢 @@D'܀  ' ,'܀ $쀢 @@D H @ ' ,'܀ T@ " ,T" `," ," ," ," ,T"" ,h'D'H'ؒ''D *`:  D *`: , Ԓ 'D`'D @**D *`: ,D`'DD *`:?'̀ ̀ ?'?'H''' *`:  *`:  `  А`'`' @C@*; *`: W@C'܀ @@C'Ȁ  ,'Ȁ 6܀  耢@ ,' 耢@̀?̔ *@ ` ̔ *@ ' '㿈'D''D@C쀢@D *`:  ` `'`'D@Cp耢@   &  @   @      ` : #dd[@B[H B#dd B`[@BD#  ` gh: #dd[PB[X B#dd B`[PBD#㿈@/B ' '㿐㿠㿠nfstapepartitiondiskioSTATkstat_open(): can't open /dev/kstattdDxcIpPnMeEl:s/w h/w trn tot %cp%c tp%c serv rp%c wp%c util device r/%c w/%c %cr/%c %cw/%c wait actv svc_t %%%%w %%%%b %s r/%c w/%c %cr/%c %cw/%c wait actv wsvc_t asvc_t %%%%w %%%%b %sdevicedevice %s %snegative intervalnegative count<> %9stty%12scpu tin tout us sy wt id %3.0f %4.0f %2.0f %2.0f %2.0f %2.0f<> Read: %d %c/%c Write: %d %c/%c A@Y? %12.8s %1s %56sextended device statistics ---- errors --- %-8.8s %3.0f %3.0f %4.0f %3.0f %3.0f %4.1f %4.1f %4.1f %6.1f %6.1f %4.1f %4.1f %6.1f %3.0f %3.0f %4.1f %4.1f %6.1f %6.1f %4.1f %4.1f %6.1f %6.1f %3.0f %3.0f %3d 0 0 0 0 %sAeA@A0@@@Ycpu_statcan't find any cpu statisticsUsage: iostat [-tdDxcIpPeEnM] [-l n] [disk ...] [interval [count]] -t: display chars read/written to terminals -d: display disk Kb/sec, transfers/sec, avg. service time in milliseconds -D: display disk reads/sec, writes/sec, percentage disk utilization -x: display extended disk statistics -c: report percentage of time system has spent in user/system/wait/idle mode -I: report the counts in each interval, instead of rates, where applicable -p: report per-partition disk statistics -P: report per-partition disk statistics only, no per-device disk statistics -e: report device error summary statistics -E: report extended device error statistics -n: convert device names to cXdYtZ format -M: Display data throughput in MB/sec instead of Kb/sec %s: : %s malloc failedNo disks to measuredevice_error%-16.16s%s: %-.16s %s: %d Size%s: %2.2fGB <%lld bytes> AeNFS/dev/dsk/dev/rmtrmt/%s/dev/dsk/%s/dev/rmt/%s../../devices/etc/path_to_instr%ss%dA@A@ols@s<;IS`o f f , yl p   00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t00000000000fXfHf@f8f`l ,   ff f0 o` ol p rs8s@sH&s84s@B X grur(s,sLXH'.( s(vG rvsG E@#r<&;,>XD2A*KsY9dg7urs0ss =?<vvvrs$susr@s #s43s?vHDDUtXbsHhsmsUdxSVpOR[l\c$NS0V[,|  *5e|Ke|Zs8hessDs<p t_hpq@vzx@!qppo`  v ppD"pP'qL0qd7p?qGfMc@Vq]peol nqvp}x@Mtqp\v!dzrqqXzqzqpqphsHp qq$d<0q;z >NNqUo` \f0 ippv !wp4qq(q|MT ptf q4pioSTATcrti.svalues-Xa.ccrtstuff.c__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.force_to_datafini_dummyioSTAT.cio_classlimitold_cpu_statshow_disk_errorsprinthdrshow_diskdo_megabytestimeSLEEPfind_diskfirstdisktimeofdaytohdrinit_disk_errorsdiskinfo_loaddlusagekscmpgcc2_compiled.printxhdrdo_partitionscpu_stat_loadcpu_stat_initcpu_stat_listndrivesdo_cpudo_ttysafe_zallocinit_disksfailtotal_kwpstotal_krpstimeNOWlastdiskdo_conversionscmdnamedisk_headerdo_diskzerodiskdo_partitions_onlydisk_selectionsdo_intervaltimeNEXTselect_disksnew_cpu_statncpussnipdsr.ctrimmake_an_entryplinerummage_dev_dsklook_up_namemk_list_of_disksinsert_dlist_entstr_is_digitgcc2_compiled.do_snmrummage_path_to_instfind_strlibgcc2.clibgcc2.clibgcc2.ccrtstuff.c__do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.sgetopt_startlookup_ks_nameatoivfprintf_environ_end_iobreaddirkstat_chain_update__flsbuf_GLOBAL_OFFSET_TABLE___ctypesignalatexitexitstrerrormallocsprintfopendir_init__cmpdi2fclosestrncpy_DYNAMICstrncmpprintf__iobtimesubstrrchr_exitenviron__floatdisferrnostrchrlstatfreeoptindclosediroptargstrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset__floatdidfkstat_readkcbuild_disk_liststrcpy_etext_lib_versionfflush_ctypenanosleepmainreadlinkmemcpystrlenlookup_nfs_namekstat_open_finifprintfsysconf <@(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning),( dc1dc=<Lnހ"fÀ߀Jeڀ+>tKU`BlCvDEFHIORĀu$c@"@ 'dd<+' dd<1dd<=<Lnހ"fÀ߀Jeڀ+>tKU`BlCvDEFHIORĀu$d<!@&dd+' dd1dd=<Lnހ"fÀ߀Jeڀ+>tKU`BlCvDEFHIORĀu$d!@&de|.interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.symtab.strtab.stab.index.comment.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; V=2.0libgcc2.c/solaris1/SOURCES/NEWGCC/gcc-2.7.2.1/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19arch_type:T20=eARCH_32BIT:0,ARCH_64BIT:1,;reg_class:T21=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T22=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T23=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T24=s8high:1,0,32;low:1,32,32;;DIunion:t25=u8s:24,0,64;ll:6,0,64;;__cmpdi2:F1a:P6b:P6libgcc2.c/solaris1/SOURCES/NEWGCC/gcc-2.7.2.1/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19arch_type:T20=eARCH_32BIT:0,ARCH_64BIT:1,;reg_class:T21=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T22=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T23=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T24=s8high:1,0,32;low:1,32,32;;DIunion:t25=u8s:24,0,64;ll:6,0,64;;__floatdidf:F13u:P6libgcc2.c/solaris1/SOURCES/NEWGCC/gcc-2.7.2.1/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19arch_type:T20=eARCH_32BIT:0,ARCH_64BIT:1,;reg_class:T21=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T22=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T23=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T24=s8high:1,0,32;low:1,32,32;;DIunion:t25=u8s:24,0,64;ll:6,0,64;;__floatdisf:F12u:P6  ll , ,y < )   3 XX9ff?ffEf0f0 0Mo`o` Rolol[pp `rr(fs8s8ms@s@tsHsHysH k~ < v0707010000778a000081ed00000000000000000000000138a027ce0000a33c000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/ioSTAT.25ELF 4,4 (44o`o`o`o` olol/usr/lib/ld.so.1C\:K<M7WE3'BH?T/PC*,6$F1I-VL9[ARNZ@);Y+0S !%&45"8#.>2(J=DQGUOXl ,   ff f0 o` ol p rs8s@sHp t_hp#q@,v5z:x@!?qGpZpco` yv ppDpPqLqdpqfc@qpol qpx@Mtqp\v!dz r'q-qX2z9qBzIqpPqVphcsHjp qqd<qz Nqo` f0 pv !p4qq(q| MT pt%f +q43pgetopt_startlookup_ks_nameatoivfprintf_environ_end_iobreaddirkstat_chain_update__flsbuf_GLOBAL_OFFSET_TABLE___ctypesignalatexitexitstrerrormallocsprintfopendir_init__cmpdi2fclosestrncpy_DYNAMICstrncmpprintf__iobtimesubstrrchr_exitenviron__floatdisferrnostrchrlstatfreeoptindclosediroptargstrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset__floatdidfkstat_readkcbuild_disk_liststrcpy_etext_lib_versionfflush_ctypenanosleepmainreadlinkmemcpystrlenlookup_nfs_namekstat_open_finifprintfsysconflibkstat.so.1libw.so.1libintl.so.1libposix4.so.1libc.so.1vv&z?zAx5pD(pP)p\8phDptXppp,p[p1p'p4p#p$pPpRq3qJqHq(Uq4Zq@qL*qX>qd+qpBq|Vq-q"qMq=qTq@q7qGqCq0r< @D# @XY"@X@ , @ "@(@X@X㿈@/X< `'` `'㿐('D'H?''''b @Xe@Xf"b b  Yh@ {DHY@XW'耢? 9*`Cx $444444444444D4444444444444444444444444h4 444`444c  "# nc"#gc"#`c"#Yc "#Pc "#Gc "#>c  "# 5c$ "#$,c( "#(#c"#c"#b@W"c,#,`@ @`'8 @ 2# `#`#`  "c "#  "## `  # ` c "## `  # ` c "##,` # `  "#,#` i s/#(` M k/# `   Y@W+/# `     g #bړ* :`ۓ* :`ۓ* :`aYb@WSۓ* :`ۓ* :`aY"@VE#$` ۓ* :`ۓ* :`ړ* :`ۓ* :`ړ* :`#\ۓ* :`#`#daY@Vۓ* :`ۓ* :`ړ* :`ۓ* :`ړ* :`#\ۓ* :`#`#daY8@V#`#$` aY@V aY@V @V'@X#`Cc4'"D@b*`H  @* :`  `   $ @ ` *H@ @ @Vc'b """@ "D@$b*`H @@V;'  Y@ K*"@*`*'b """D@b*`H @@V'䀢  Y@ #b """D@@# `  I@U@!  @ ; "Yc@Ub @U@#`@ # ` @K @""""Z ?'쀢 !*` *#T  " ' Z DB?`'Z Z Z ?#H ?Z D?Z DZ ?#`Z ?#$`e# ` _# `YcY@UX#`YcY@UM# ` #```В "  @U7   В@@ "@ *# `Z`@U#`Z`@U# ` #```В "  @T   В@@ "@ *# `2!c" ' Z D‰" ?! cȐ" ' Z D‰" ?Z`     @T#`S cX" ' Z DD? c\" ' Z DD? c`" ' Z DD? cT# ' Z DD;`#\Z`0  @Tb# ` #```В "  @TL   В@@ "@ *@"'Ԁ * ` @``В "  @T   В@@ "@ *'"# ` @rc "# @#$` # ` b@8# `2!c" ' Z D‰" ?! cȐ" ' Z D‰" ?Z`     @S# ` "'Ԁ  `@'#`S cX" ' Z DD? c\" ' Z DD? c`" ' Z DD? cT# ' Z DD;`#\Z`0  @S9``В "  @S/   В@@ "@ *# ` 4b'Ԁ * ` @^``В "  @R   В@@ "@ *'#`ڗ* :ۙ* ; څ* 8ۅ* 8#\ZPb"@R`@R# ` "'Ԁ  `  `@''䀢`` \䀢 ?'"`  "@"" "@ ⌘ + " * +  "`"b @RYb"" "@  *" * *"b@ b @Rab ""b"" "@ b"G @R!㿈'D# `YcY@R0# ` )"'쀢   ` ` Z`@R  4Z@R'#`YcY@Q``В "  @Q   В@@ "@ *# `Z`@Q# ` "'쀢  `a@Q'#`Z`@Q``В "  @Q   В@@ "@ * "#㿐# ` #$`Z`Z@Q|Z`Z@Qv# ` # `  #$`YcZ@Q_Z`@Q[#$`D``В "  @QL   В@@ "@ *# ` a@Q1``В "  @Q'   В@@ "@ *j# `YcY@Q #`YcY@P``В "  @P   В@@ "@ *# ` a@P# `Z`@P#`Z`@P``В "  @P   В@@ "@ *㾰'DDD 0` b  @ {?ppZ!DZ!?ppZ!腠?xDD `h" ' Z!Dx?DD `l" ' Z!Dx?D?#(`Z!?Z"?DD `X b  @   @ %?X `, 4` 4    @ ?XXXH?XxX?DD `` b  @   @ ?P `, 4` 4    @ ?PPPH?PxP?ȅD?DD (`x b  @  !p?DD @` b  @  !p?Z! ؅Z"DZ!?Z! ؅Z"DZ!?Z! D؅Z"DZ!?DD `p b  @ z !pZ"D?DD 8` b  @ h !pZ"D?#`xD?xD?xD?xD?xD?xD?# ` D `D 'lD `4'l#$`Zal@OH# `    Z U#\Za@O*H#\Za @O;#$`;`;h;p;x;;#\Za8@N;`;h;p;x;;;#\Zap@N# ` s# ` Za@ND ``'`D `t'h'dd Md*@*`h  `  4d*@*`h Z` @Nd*@*`h ` @'`d*@*`h Z`$@Nd*@*`h ` $@'`d`'dZa`@NqZa@Nk# `  #$`Zal@N[bЅDB""bȅDB""㿈"#Hb  '쀢  4 Z @NC  cH "#H '#H *  @Y"#Hb  '쀢 % 4 Z @N b  @N? #H`"#H*` " '#H` Z(@` !X@M(#L`!X@M` !X@M'#H@R *@ " @@M? C`' ''耢  '`'@ " 'a'!''耢 W '`'@ " '`' 㿐`ZH@M`Zh@M}`Z@Mw`Z@Mq`Z@Mk`Z(@Me`Z`@M_`Z@MY`Z@MS`Z@MM`[ @MG`[X@MA`[@M;`[@M5`[@M/`[ @M)`[X@M#`[@M`[@M @L㿈'L'P'T'X'D'HLL'`[@M`H@LD  b@L`[@L`[ @L @L㿐'D'H'LL  D`D@@LH@LD"@@  [(D@ H@L㿈'D'HDH `" '쀢 AD `H`@L'쀢 1D`H` 00" '쀢 "D `H ` DH `@L D `4H`4@L|x#$`b<@"b<b@'#`bc"b  '  S ` 'ܒ*` `Tܔ *@ @L4 ܐ`'ܒ*` # ` T YX@L #`# ` T YH@K '`'   '""     P@K`: 0`: H#$`$"<` T Y8@K   4 @"` `4b<@="`" " ܔ *@ `" b@'@ '䀢 @"@""' '""@"#"b@"""` [8:@ # ` @㿈"#0"'쀢 -" #4'耢  `4@K/  " c0 "#0''"'쀢 & `#,` #0c,  " c0 "#0'㿈"'쀢 B `8`: X`: ``: h` : p`(: x`0: `8: `@: `H: `P: " `@J?  `" ` @J?  ' 㿈b  '쀢  S `  T [P @Ja @  '`'D'D 4' *`: , @*Đ`'`'*"'쀢  ` `4@J; D" 'x'DD `D 'D `4'#$` [b`@IZa@I'D `t''D `x *@*`  @I@'*@*`  ` 2    ?*@*` **  [p@I*@*`   @I@'*@*` ** [ @Iv 'q*@*`  [@I J*@*` *@*` `   @ ` @I'`  `` * `$2 `  0   @6'܍''܅&["?+ @*` [b @I'*@*` ** [$@I '䀢 =耢 [b @H'`'䀢 [b @H[b @H㿐'D["㿐'D'HDH ` DD沔@ " DDD@ "DDH@"@ "DDH`"@ " p'DD' / )@@H`@H'܀ ܔ *@ @Hܐ`'' ,'@H@5'@ @H'䀢 "@'耢 ` @H~' '쀢 @Hq''䀢 䀢   [b@H_' [b@HX''耢 @HN' | *`: .䀢 P @H8` P@  @ P` [@GP` [@GP @T 䀢  P` [@G P` [@GPX@G?$l< ( P@$@G @'L'LP'LL PL@Y~@G`'Q㿈'D'H'H H@D@G H 'H`'㿐'D'HD *`: s D *`: p H 'HD`'D @*H*㿀'D'H'L'P @Gd'쀢 ]D@\'@G^'`'@GP"`  `D` @GSH@GG'`'@G9"@`$@H@G<?" " " P" L` L@" L"L" ` @G @G@G㿈'D[c'D @*`: * :@ `'D`'DD :@F'쀢 *D㻈'D[c[0@F'쀢  $@F * :` # D@ @Fp'D'H'D *`: D *`: /D`'DD *`: D"@F'쀢 "@F'쀢 *DH@'䀢 '`''܀ 4 *`: ' *`:  *`:  ` `'ܐ`'ܐ`'ܐ`' *`: ''Ԁ  *`:  Ԑ`'ؐ`'*'؀ e@E"`D  *`: @'D C?'*'D  *`: / 'ؐ`'D `'ؐ`'@E"` ` `@E`'㿐'D'HH HD` @E H 'HH㿐'D'HD DDDD`H@ D 'Dx'D'H'L'P'TL T'쀢 D`@E?  ,'쀢  0@E)' H" D" L"D@E ''耢 2P "@E * "`  *@ ` *@ [8D@D *@" `'T`iT'쀢 @@D'܀  ' ,'܀ $쀢 @@D H @ ' ,'܀ T@ " ,T" `," ," ," ," ,T"" ,h'D'H'ؒ''D *`:  D *`: , Ԓ 'D`'D @**D *`: ,D`'DD *`:?'̀ ̀ ?'?'H''' *`:  *`:  `  А`'`' @C@*; *`: W@C'܀ @@C'Ȁ  ,'Ȁ 6܀  耢@ ,' 耢@̀?̔ *@ ` ̔ *@ ' '㿈'D''D@C쀢@D *`:  ` `'`'D@Cp耢@   &  @   @      ` : #dd[@B[H B#dd B`[@BD#  ` gh: #dd[PB[X B#dd B`[PBD#㿈@/B ' '㿐㿠㿠nfstapepartitiondiskioSTATkstat_open(): can't open /dev/kstattdDxcIpPnMeEl:s/w h/w trn tot %cp%c tp%c serv rp%c wp%c util device r/%c w/%c %cr/%c %cw/%c wait actv svc_t %%%%w %%%%b %s r/%c w/%c %cr/%c %cw/%c wait actv wsvc_t asvc_t %%%%w %%%%b %sdevicedevice %s %snegative intervalnegative count<> %9stty%12scpu tin tout us sy wt id %3.0f %4.0f %2.0f %2.0f %2.0f %2.0f<> Read: %d %c/%c Write: %d %c/%c A@Y? %12.8s %1s %56sextended device statistics ---- errors --- %-8.8s %3.0f %3.0f %4.0f %3.0f %3.0f %4.1f %4.1f %4.1f %6.1f %6.1f %4.1f %4.1f %6.1f %3.0f %3.0f %4.1f %4.1f %6.1f %6.1f %4.1f %4.1f %6.1f %6.1f %3.0f %3.0f %3d 0 0 0 0 %sAeA@A0@@@Ycpu_statcan't find any cpu statisticsUsage: iostat [-tdDxcIpPeEnM] [-l n] [disk ...] [interval [count]] -t: display chars read/written to terminals -d: display disk Kb/sec, transfers/sec, avg. service time in milliseconds -D: display disk reads/sec, writes/sec, percentage disk utilization -x: display extended disk statistics -c: report percentage of time system has spent in user/system/wait/idle mode -I: report the counts in each interval, instead of rates, where applicable -p: report per-partition disk statistics -P: report per-partition disk statistics only, no per-device disk statistics -e: report device error summary statistics -E: report extended device error statistics -n: convert device names to cXdYtZ format -M: Display data throughput in MB/sec instead of Kb/sec %s: : %s malloc failedNo disks to measuredevice_error%-16.16s%s: %-.16s %s: %d Size%s: %2.2fGB <%lld bytes> AeNFS/dev/dsk/dev/rmtrmt/%s/dev/dsk/%s/dev/rmt/%s../../devices/etc/path_to_instr%ss%dA@A@ols@s<;IS`o f f , yl p   00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t00000000000fXfHf@f8f`l ,   ff f0 o` ol p rs8s@sH&s84s@B X grur(s,sLXH'.( s(vG rvsG E@#r<&;,>XD2A*KsY9dg7urs0ss =?<vvvrs$susr@s #s43s?vHDDUtXbsHhsmsUdxSVpOR[l\c$NS0V[,|  *5e|Ke|Zs8hessDs<p t_hpq@vzx@!qppo`  v ppD"pP'qL0qd7p?qGfMc@Vq]peol nqvp}x@Mtqp\v!dzrqqXzqzqpqphsHp qq$d<0q;z >NNqUo` \f0 ippv !wp4qq(q|MT ptf q4pioSTATcrti.svalues-Xa.ccrtstuff.c__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.force_to_datafini_dummyioSTAT.cio_classlimitold_cpu_statshow_disk_errorsprinthdrshow_diskdo_megabytestimeSLEEPfind_diskfirstdisktimeofdaytohdrinit_disk_errorsdiskinfo_loaddlusagekscmpgcc2_compiled.printxhdrdo_partitionscpu_stat_loadcpu_stat_initcpu_stat_listndrivesdo_cpudo_ttysafe_zallocinit_disksfailtotal_kwpstotal_krpstimeNOWlastdiskdo_conversionscmdnamedisk_headerdo_diskzerodiskdo_partitions_onlydisk_selectionsdo_intervaltimeNEXTselect_disksnew_cpu_statncpussnipdsr.ctrimmake_an_entryplinerummage_dev_dsklook_up_namemk_list_of_disksinsert_dlist_entstr_is_digitgcc2_compiled.do_snmrummage_path_to_instfind_strlibgcc2.clibgcc2.clibgcc2.ccrtstuff.c__do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.sgetopt_startlookup_ks_nameatoivfprintf_environ_end_iobreaddirkstat_chain_update__flsbuf_GLOBAL_OFFSET_TABLE___ctypesignalatexitexitstrerrormallocsprintfopendir_init__cmpdi2fclosestrncpy_DYNAMICstrncmpprintf__iobtimesubstrrchr_exitenviron__floatdisferrnostrchrlstatfreeoptindclosediroptargstrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset__floatdidfkstat_readkcbuild_disk_liststrcpy_etext_lib_versionfflush_ctypenanosleepmainreadlinkmemcpystrlenlookup_nfs_namekstat_open_finifprintfsysconf <@(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2.1ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning),( dc1dc=<Lnހ"fÀ߀Jeڀ+>tKU`BlCvDEFHIORĀu$c@"@ 'dd<+' dd<1dd<=<Lnހ"fÀ߀Jeڀ+>tKU`BlCvDEFHIORĀu$d<!@&dd+' dd1dd=<Lnހ"fÀ߀Jeڀ+>tKU`BlCvDEFHIORĀu$d!@&de|.interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.symtab.strtab.stab.index.comment.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; V=2.0libgcc2.c/solaris1/SOURCES/NEWGCC/gcc-2.7.2.1/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19arch_type:T20=eARCH_32BIT:0,ARCH_64BIT:1,;reg_class:T21=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T22=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T23=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T24=s8high:1,0,32;low:1,32,32;;DIunion:t25=u8s:24,0,64;ll:6,0,64;;__cmpdi2:F1a:P6b:P6libgcc2.c/solaris1/SOURCES/NEWGCC/gcc-2.7.2.1/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19arch_type:T20=eARCH_32BIT:0,ARCH_64BIT:1,;reg_class:T21=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T22=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T23=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T24=s8high:1,0,32;low:1,32,32;;DIunion:t25=u8s:24,0,64;ll:6,0,64;;__floatdidf:F13u:P6libgcc2.c/solaris1/SOURCES/NEWGCC/gcc-2.7.2.1/./libgcc2.cgcc2_compiled.int:t1=r1;-2147483648;2147483647;char:t2=r2;0;127;long int:t3=r1;-2147483648;2147483647;unsigned int:t4=r1;0;-1;long unsigned int:t5=r1;0;-1;long long int:t6=r1;01000000000000000000000;0777777777777777777777;long long unsigned int:t7=r1;0000000000000;01777777777777777777777;short int:t8=r1;-32768;32767;short unsigned int:t9=r1;0;65535;signed char:t10=r1;-128;127;unsigned char:t11=r1;0;255;float:t12=r1;4;0;double:t13=r1;8;0;long double:t14=r1;16;0;complex int:t15=s8real:1,0,32;imag:1,32,32;;complex float:t16=r16;4;0;complex double:t17=r17;8;0;complex long double:t18=r18;16;0;void:t19=19arch_type:T20=eARCH_32BIT:0,ARCH_64BIT:1,;reg_class:T21=eNO_REGS:0,GENERAL_REGS:1,FP_REGS:2,ALL_REGS:3,LIM_REG_CLASSES:4,;machine_mode:T22=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,SCmode:16,DCmode:17,XCmode:18,TCmode:19,CQImode:20,CHImode:21,CSImode:22,CDImode:23,CTImode:24,COImode:25,BLKmode:26,CCmode:27,CCXmode:28,CC_NOOVmode:29,CCX_NOOVmode:30,CCFPmode:31,CCFPEmode:32,MAX_MACHINE_MODE:33,;mode_class:T23=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;ptrdiff_t:t1size_t:t4wchar_t:t3UQItype:t11SItype:t1USItype:t4DItype:t6UDItype:t7SFtype:t12DFtype:t13TFtype:t14word_type:t1DIstruct:T24=s8high:1,0,32;low:1,32,32;;DIunion:t25=u8s:24,0,64;ll:6,0,64;;__floatdisf:F12u:P6  ll , ,y < )   3 XX9ff?ffEf0f0 0Mo`o` Rolol[pp `rr(fs8s8ms@s@tsHsHysH k~ < v0707010000778c000081ed00000000000000000000000138a027ce0001033c000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/ioSTAT.7ELFH44 (44$ T/usr/lib/ld.so.1Sd@Z8a`3"?R1LJYT9F'cAK^+HV<BM=2]X>0,:WS[P7!Eb\)$%5.6D/G# *OICQN;&U4-_( ,hHvH vd vx   PHte`\#,5:@!?sHUd]py   4hXvH sHi8!(@.S6>t(P,V!^jpjpw|}(t@@8 itT$#p* 1vx >E !LVP[dkLrSh Dvd tgetopt_startlookup_ks_nameatoivfprintf_environ_end_iob__register_frame_inforeaddirkstat_chain_update__flsbuf_GLOBAL_OFFSET_TABLE___ctypeabortsignalatexitexitstrerrormallocsprintfopendir_init.umul__register_frame_info_table__cmpdi2fclosestrncpy_DYNAMICstrncmpprintf__iobtimesubstrrchr__frame_state_for_exitenviron__floatdisferrnostrchrlstatfreeoptindclosediroptarg__deregister_frame_infostrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset__floatdidfkstat_readkcbuild_disk_liststrcpy_etext_lib_versionfflush_ctypenanosleepmainreadlinkmemcpystrlenlookup_nfs_namekstat_open_finifprintfsysconflibkstat.so.1SUNW_0.7librt.so.1SUNW_0.7libc.so.1SISCD_2.3libkstat.so.1libw.so.1libintl.so.1librt.so.1libc.so.1 =( =(zt!;F)H, -,?8LD`P\h0tc7+:&'XZ9RP]b .(E4/@JL^X1d%pU|D\G=OK6C3* @D# @[l]"d@[h@, @ "@9@[]@[^㿐@/[ @   $? 2 @F㿐㿐@/[l ` @ 㿐('D'H?''''ax @[!@[""aa  ]@ DH]@['耢? 9*`EX |T`t4@cĒ"#gcȒ"#`cȒ"#YcȒ"#Rc̒"#JcВ"#BcԒ"#:cؒ"#2cܒ"#*c"#"cȒ"#cȒ"#a@Zj"c#䀢`@  '@ @ #Ā`#Ȁ`#̀`  "c̒ "# "##Ȑ `  #Ȑ ` cȒ "##Ȑ `  #Ȑ ` cȒ "##䀢` #Ȑ `  "##Ѐ` i s/#` M k/#Ȑ `   ]@Y/#Ȑ `     g #bړ* :`ۓ* :`ۓ* :``]c@YSۓ* :`ۓ* :``]#@YE#܀` ۓ* :`ۓ* :`ړ* :`ۓ* :`ړ* :`#\ۓ* :`#`#d`]0@Yۓ* :`ۓ* :`ړ* :`ۓ* :`ړ* :`#\ۓ* :`#`#d`]@Y{#Ȁ`#܀` `]@Yf `]@Y] @Y]'@#Ȁ`Bc' D@`*`H  @* :`  `  $ @ ` *H@ @ @Y''`" "@ g D@#`*`H @@Y'  ]@ *"@*`*'`"  D@`*`H @@X'䀢  ^@ z`"  D@@#Ȑ `  K@X@t  @  "^`@Xa@X@#Ȁ`@ #Ȑ ` @ @"!p"!t^ ?'쀢 " *#p@  *a  `" ' ^ ЅDB? '^ ȁ^ ^ ?! ?^ ȁD?^ ȁD^ ?#Ѐ`^ ?#܀`#Ȑ ` #Ā`^`(^0@X#̀`^`8^@@X#Ā` #̀`ccȒ "  @W  #Ȑ@  *@`"#Ā`^`H@W#̀`^`X@W#Ā` #̀`ccȒ "  @W  #Ȑ@  *@`"#Ā`> t#p@  ta @" ' ^ ЅD‰" ? |#p@  |a @" ' ^ ЅD‰" ?^`h    @Wr#̀`k #p@  a @" ' ^ ЅDD? #p@  a @" ' ^ ЅDD? #p@  a @" ' ^ ЅDD? #p@ a@# ' ^ ЅDD;`#\^`x  @W#Ā` #̀`ccȒ "  @V  #Ȑ@  *@`"@#'Ԁ * ` @ccȒ "  @V  #Ȑ@  *@`"'F#Ȑ ` @c "# @#܀` #Ȑ ` c@e#Ā`> t#p@  ta @" ' ^ ЅD‰" ? |#p@  |a @" ' ^ ЅD‰" ?^`h    @VA#Ȑ ` #'Ԁ  `@ '#̀`k #p@  a @" ' ^ ЅDD? #p@  a @" ' ^ ЅDD? #p@  a @" ' ^ ЅDD? #p@ a@# ' ^ ЅDD;`#\^`x  @UccȒ "  @U  #Ȑ@  *@`"#Ȑ ` 4c'Ԁ * ` @gccȒ "  @Uz  #Ȑ@  *@`"'#Ȁ`ڗ* :ۙ* ; څ* 8ۅ* 8#\^ap!t@UJc@UO#Ȑ ` #'Ԁ  `  `@''䀢`i e䀢 ?'!` x  "@"! !@  x  + " * +  "`"ax @Tax"! !@  ax  *" * *"a@ a @Ta "!a"! !@  a @" @T㿈'D#Ā`^`(^0@T#Ȑ ` )#'쀢   ` ` ^`@T  4^@T}'#̀`^`8^@@TmccȒ "  @Tc  #Ȑ@  *@`"#Ā`^`H@TI#Ȑ ` #'쀢  ``@T1'#̀`^`X@T#ccȒ "  @T  #Ȑ@  *@`" "#㿐#Ȑ ` #܀`^`^@S^a^@S#Ȑ ` #Ȑ `  #܀`^`(^@S^a0@S#܀`DccȒ "  @S  #Ȑ@  *@`"#Ȑ ` `@SccȒ "  @S  #Ȑ@  *@`"j#Ā`^`(^0@S~#̀`^`8^@@SsccȒ "  @Si  #Ȑ@  *@`"#Ȑ ` `@SN#Ā`^`H@SE#̀`^`X@S<ccȒ "  @S2  #Ȑ@  *@`"㾰'DDD 0` b  @ l?pp^"(D^"0?pp^"0?xDD `h" ' ^"8Dx?DD `l" ' ^"8Dx?D?#`^"@?^"H?DD `X b  @   @ ?X ` , 4` 4    @ ?XXXH?XxX?DD `` b  @   @ ?P ` , 4` 4    @ ?PPPH?PxP?ȅD?DD (`x b  @  !p?DD @` b  @  !p?^"( ؅^"PD^"(?^"( ؅^"PD^"(?^"( D؅^"PD^"(?DD `p b  @ k !p^"XD?DD 8` b  @ Y !p^"XD?#Ѐ`xD?xD?xD?xD?xD?xD?#Ȑ ` D `D 'lD `4'l#܀`^aHl@Q#Ȑ `    Z U#\^aP@QH#\^ah@Q;#܀`;`;h;p;x;;#\^a@Qt;`;h;p;x;;;#\^a@QY#Ȑ ` r#Ȑ ` ^a@QGD `_'`D `t'h'dd Ld*@*`h  `  4d*@*`h ^` @Qd*@*`h ` @'`d*@*`h ^`$@Qd*@*`h ` $@'`d 'd^b`@P^b@P#Ȑ `  #܀`^b l@PapЅDB"!patȅDB"!t㿈"!a '쀢  4 ^` @P a"! '! * Ȕ @a"!a '쀢 ( 4 ^` @P a @P?a  *"Ȕ "`" '!` ^p@cp !|@Pf!cp!|@P_cp !|@PV'!@W *Ȓ@ h!@@P>? Hcx'dh '`'耢 d ` $"`" '`p'dh!'`'耢 {d `@ $@"`" ' ' 㿐c^@Oc^@Oc^@Oc^@Oc^H@Oc^p@Oc^@Oc^@Oc_@Oc_@@Oc_h@Oc_@Oc_@Oc_@Oc_@@Oc_h@Oc_@Oc_@Oc_@O @OJ㿈'L'P'T'X'D'HLL'c_X@OocH@OlD  `@Ogc_`@OZc_h@OT @O㿐'D'H'LL  D`D@@OGH@OGD"@@  _pD@ H@O$㿈'D'HDH `" '쀢 CD `H`@O'쀢 2D`H` 00" '쀢 "D `H ` DH `@N D `4H`4@Nx#܀`b@"bb'#`cc"a '  S ` 'ܔ *"̐@ ``Tܖ *b̒ @@N ܒ 'ܔ *"̐@ `#؀` T ]@N| #Ԁ`#؀` T ]@Nf '`'   '""     P@N,`: 0`: H#܀`$"` T ]@N&   4 @"` `4b@)"`" " ܖ *b̒ `" b'@ '䀢 @"@""' '"#@"#"b"##` _5@ #Ȑ ` @㿈"##'쀢 ," #'耢  `4@M   " c"#''#'쀢 % `#䀢` #c䀢  " c"#'㿈#'쀢 B `8`: X`: ``: h` : p`(: x`0: `8: `@: `H: `P: !`@M ?  `!` @L?  ' 㿈a '쀢  S `  T _ @L @  '`'D'D 4' *`: , @*Ē ' '*#'쀢  ` `4@L D" 'x'DD `D 'D `4'#܀` _b@LV^aH@LO'D `t''D `x *@*`  @Lc@'*@*`  ` 2    ?*@*` **  _@L*@*`   @L)@'*@*` ** _ @K 'q*@*`  _@K J*@*` *@*` `   @ ` @-'` ` ` * `$2 `  0   @'܍''܅&_"?+ @*` _bؒ @K'*@*` ** _$@Ku '䀢 =耢 _bh@Kb' '䀢 _bh@KT_bh@KP㿐'D_#㿐'D'HDH ` DD沔@ " DDD@"DDH@"@ "DDH`"@ " x'DD' . (@@K1`@K-'܀ ܔ *  @Kܒ '' ,'@K@6'@ @K '䀢 "@'耢 ` @J' '쀢 @J ''䀢 䀢   _c@J' _c@J''耢 @J' | *`: .䀢 P @J` P@  @} P` _(@JNP` _(@JGP @T 䀢  P` _0@J2 P` _@@J)PX@Jj?$l< ( P@$@J^ @'L'LP'LL PL@Z~@JF 'R㿈'D'H'H H@D@J H 'H '㿐'D'HD *`: s D *`: p HD *@'D`"H*㿀'D'H'L'P @I'쀢 [D@Z'@I' '@I"`  `C` @IH@I' '@I"@`$@H@I?" " " P" L` L@" L"L" ` @Iz@Iw@Ir㿈'D_cP'D @*`: * :@  'D 'DD :@Ip'쀢 *D㻈'D_c`_x@I^'쀢  $@IV * :` # D@ @IDp'D'H'D *`: D *`: /D 'DD *`: D"@I'쀢 "@I'쀢 *DH@'䀢 ' ''܀ 0 *`: $ *`:  *`:  `  'ܒ 'ܒ 'ܒ ' *`: ''Ԁ  *`:  Ԓ 'ؒ '*'؀ `@H:"`D  *`: @?'D ?*@"'D  *`: / ?'ؒ 'D  'ؒ '@H$"` ` `@H' '㿐'D'HH HD` @H H 'HH㿐'D'HD DDDD`H@ D 'Dx'D'H'L'P'TL T'쀢 D`@G  ,'쀢  0@G' H" D" L"D@G ''耢 1P "@G *@ "`  *  ` *  _D@G7 * "  'T`iT'쀢 @@GL'܀  ' ,'܀ $쀢 @@G, H @ ' ,'܀ T@ " ,T" `," ," ," ," ,T"" ,h'D'H'ؒ''D *`:  D *`: , D *@'D`"*D *`: ,D 'DD *`:?'̀ ̀ ?'?'H''' *`:  *`:  `  В ' ' @FJ*@ *`: W@F4'܀ @@Fa'Ȁ  ,'Ȁ 6܀  耢@ ,' 耢@̀?̔ *  ` ̔ *  ' '㿈'D''D@F쀢@D *`:  `  ' 'D@E耢@   &  @      㿈@/E> '쁠ᴮ  B'쁠 B` BD㿈@/E@? g`g#gh > '쁠  B'쁠 B` BD   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @D* ?''' `      & && 㿐@/DἮ (  @@*  @    2      2 *@ @ :  @@   㿈@/DԮ  "  @D&@ @`$@D @J z- @D@@`$  @Dt 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @Dp ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @C ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@C"@Cz"$&b""@Cs@C}0 ' @*!*@ * "`'0 &` @C㿐@/C&`&`&@ (&` @&`&`"@㿐@/B㸮&`&` &` (&@@&`&`"@㿐@/Bp ( ` `"@  @C$` 0 `@CNXL ؠ =  @B"7j'?$   ؐ  J zo  '  @Bɔ"㿐@/BȮ ,? ???㿐㿠>㿠nfstapepartitiondiskioSTATkstat_open(): can't open /dev/kstattdDxcIpPnMeEl:s/w h/w trn tot %cp%c tp%c serv rp%c wp%c util device r/%c w/%c %cr/%c %cw/%c wait actv svc_t %%%%w %%%%b %s r/%c w/%c %cr/%c %cw/%c wait actv wsvc_t asvc_t %%%%w %%%%b %sdevicedevice %s %snegative intervalnegative count<> %9stty%12scpu tin tout us sy wt id %3.0f %4.0f %2.0f %2.0f %2.0f %2.0f<> Read: %d %c/%c Write: %d %c/%c A@Y? %12.8s %1s %56sextended device statistics ---- errors --- %-8.8s %3.0f %3.0f %4.0f %3.0f %3.0f %4.1f %4.1f %4.1f %6.1f %6.1f %4.1f %4.1f %6.1f %3.0f %3.0f %4.1f %4.1f %6.1f %6.1f %4.1f %4.1f %6.1f %6.1f %3.0f %3.0f %3d 0 0 0 0 %sAeA@A0@@@Ycpu_statcan't find any cpu statisticsUsage: iostat [-tdDxcIpPeEnM] [-l n] [disk ...] [interval [count]] -t: display chars read/written to terminals -d: display disk Kb/sec, transfers/sec, avg. service time in milliseconds -D: display disk reads/sec, writes/sec, percentage disk utilization -x: display extended disk statistics -c: report percentage of time system has spent in user/system/wait/idle mode -I: report the counts in each interval, instead of rates, where applicable -p: report per-partition disk statistics -P: report per-partition disk statistics only, no per-device disk statistics -e: report device error summary statistics -E: report extended device error statistics -n: convert device names to cXdYtZ format -M: Display data throughput in MB/sec instead of Kb/sec %s: : %s malloc failedNo disks to measuredevice_error%-16.16s%s: %-.16s %s: %d Size%s: %2.2fGB <%lld bytes> AeNFS/dev/dsk/dev/rmtrmt/%s/dev/dsk/%s/dev/rmt/%s../../devices/etc/path_to_instr%ss%d@A@Aeh00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~ vH vd  o}ooh, ovvvvv|e  e i8|e  eit - e|e  ejp - e|e  e k,4 (k`L 8kH HkTXlH - etl - em - en( - ep - esH - esH - et@ - e8t( - e ,hHvH vd vx   &*8F\k~8|D4$ |x=?dE(5>EJN[jM@{-JlA(DlPCL@t )5;0EUc(lCqM{pp|Y@X\[pT$YUa\@a%h2alCM]g m s$  T  kHk`Lk,4pn( kT+l6lH?mHSauwuv<PHte`\@!sHd$7@ V ^dkr w4hXvH sHi8@S t(,#!+jp7=D|J(OV_ft@~@8 itT$p vx   !#P(18L?Sh ODZvd `htioSTATcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummyioSTAT.cdo_conversionsshow_diskfirstdiskold_cpu_stattimeofdaydo_ttycpu_stat_initcpu_stat_loadinit_disksdo_megabyteszerodiskdo_cpusnipshow_disk_errorsgcc2_compiled.init_disk_errorsprinthdrdo_partitionscmdnamencpusdltohdrselect_disksusagedisk_headerkscmpndrivessafe_zallocdiskinfo_loadtotal_kwpsdo_partitions_onlydo_disktimeSLEEPtimeNEXTdo_intervallimitprintxhdrdisk_selectionscpu_stat_listio_classfailfind_disktotal_krpstimeNOWnew_cpu_statlastdiskdsr.cdo_snmlook_up_namerummage_path_to_insttrimgcc2_compiled.make_an_entryrummage_dev_dskinsert_dlist_entplinefind_strstr_is_digitmk_list_of_diskslibgcc2.c__FRAME_BEGIN__libgcc2.c.LLC0.LLC1__FRAME_BEGIN__libgcc2.c.LLC0.LLC1__FRAME_BEGIN__frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.sgetopt_startlookup_ks_name_START_atoivfprintf_environ_end_iob__register_frame_inforeaddirkstat_chain_update__flsbuf_GLOBAL_OFFSET_TABLE___ctypeabortsignalatexitexitstrerrormallocsprintfopendir_init.umul__register_frame_info_table__cmpdi2fclose_END_strncpy_DYNAMICstrncmpprintf__iobtimesubstrrchr__frame_state_for_exitenviron__floatdisferrnostrchrlstatfreeoptindclosediroptarg__deregister_frame_infostrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset__floatdidfkstat_readkcbuild_disk_liststrcpy_etext_lib_versionfflush_ctypenanosleepmainreadlinkmemcpystrlenlookup_nfs_namekstat_open_finifprintfsysconfas: SC4.2 dev 30 Nov 1995 as: SC4.2 dev 30 Nov 1995 @(#)SunOS 5.7 Generic October 1998as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.8.1as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.8.1as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.8.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.8.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.8.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.8.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.8.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.8.1as: SC4.2 dev 30 Nov 1995 ld: Software Generation Utilities - Solaris/ELF (3.0)q <I4O di'di3<BlրH /Id/CMd|‚׀# 5΀k  v 1 F \ qI J K L ȀM ހO P V Y 8 o| $i @ @ $8 diN di'di3<BlրH /Id/CMd|‚׀# 5΀k  v 1 F \ qI J K L ȀM ހO P V Y 8 o| $i @ $t djpN djp'djp3<BlրH /Id/CMd|‚׀# 5΀k  v 1 F \ qI J K L ȀM ހO P V Y 8 o| $jp @ $ dk,, dk,%dk,/<>hҀD+E`݀+?I`x}Ӏ1ƀ 1 0}Ā?Bq /!"!#t$e$% v%#%8%N %c%k&m&'@2'T3'h4'|5'6'(#(L()))$ik,)@h)@h )$4)$~k`)@})@} )$L)*?$k*R@*p@ *z@ *$H*$k*@*$T*$lH*@*@*@*@+@+$+ $l+3@+?$+@$'m+Q@&+\$+]$Rn+v@Q+@Q+$(+$p+@}+@}+@~+@~+$+$s+@, @,$H,$ s,:@ ,H@ ,T$H,U$t@,u@,$,$4t,@3,@3,$(,(P,du.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/builds3/s998_21a/usr/src/lib/libc/sparc; /opt/SUNWspro.40/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -D_REENTRANT -Dsparc -Iinc -I../inc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/builds3/s998_21a/proto/root_sparc/usr/include -c -o values-Xa.o ../port/gen/values-Xa.c -W0,-xplibgcc2.c/ext1/SOURCES2.5/gcc-2.8.1/./libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hmachmode.hgansidecl.hmachmode.defmachine_mode:T(11,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,QCmode:16,HCmode:17,SCmode:18,DCmode:19,XCmode:20,TCmode:21,CQImode:22,CHImode:23,CSImode:24,CDImode:25,CTImode:26,COImode:27,BLKmode:28,CCmode:29,CCXmode:30,CC_NOOVmode:31,CCX_NOOVmode:32,CCFPmode:33,CCFPEmode:34,MAX_MACHINE_MODE:35,;mode_class:T(11,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;defaults.hinclude/stddef.hptrdiff_t:t(15,1)=(0,1)size_t:t(15,2)=(0,4)wchar_t:t(15,3)=(0,3)wint_t:t(15,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;__cmpdi2:F(0,28)a:P(0,23)b:P(0,23)libgcc2.c/ext1/SOURCES2.5/gcc-2.8.1/./libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hmachmode.hgansidecl.hmachmode.defmachine_mode:T(11,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,QCmode:16,HCmode:17,SCmode:18,DCmode:19,XCmode:20,TCmode:21,CQImode:22,CHImode:23,CSImode:24,CDImode:25,CTImode:26,COImode:27,BLKmode:28,CCmode:29,CCXmode:30,CC_NOOVmode:31,CCX_NOOVmode:32,CCFPmode:33,CCFPEmode:34,MAX_MACHINE_MODE:35,;mode_class:T(11,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;defaults.hinclude/stddef.hptrdiff_t:t(15,1)=(0,1)size_t:t(15,2)=(0,4)wchar_t:t(15,3)=(0,3)wint_t:t(15,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;__floatdidf:F(0,26)u:P(0,23)libgcc2.c/ext1/SOURCES2.5/gcc-2.8.1/./libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hmachmode.hgansidecl.hmachmode.defmachine_mode:T(11,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,QCmode:16,HCmode:17,SCmode:18,DCmode:19,XCmode:20,TCmode:21,CQImode:22,CHImode:23,CSImode:24,CDImode:25,CTImode:26,COImode:27,BLKmode:28,CCmode:29,CCXmode:30,CC_NOOVmode:31,CCX_NOOVmode:32,CCFPmode:33,CCFPEmode:34,MAX_MACHINE_MODE:35,;mode_class:T(11,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;defaults.hinclude/stddef.hptrdiff_t:t(15,1)=(0,1)size_t:t(15,2)=(0,4)wchar_t:t(15,3)=(0,3)wint_t:t(15,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;__floatdisf:F(0,25)u:P(0,23)frame.c/ext1/SOURCES2.5/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  @ o`-,,< 7hh  AHHdGvHvHMvdvdSvxvx ;[0` en0t{0 phB$  T2qM80707010000778e000081ed00000000000000000000000149fde5c400000168000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/ioSTAT.sh#!/bin/ksh LANG=C export LANG sol=`uname -r` if [ "$sol" = "5.5" ]; then exec /etc/STATsrv/bin/ioSTAT.25 $* ; fi if [ "$sol" = "5.5.1" ]; then exec /etc/STATsrv/bin/ioSTAT.25 $* ; fi if [ "$sol" = "5.6" ]; then exec /etc/STATsrv/bin/ioSTAT.25 $* ; fi if [ "$sol" = "5.7" ]; then exec /etc/STATsrv/bin/ioSTAT.7 $* ; fi exec /etc/STATsrv/bin/ioSTAT.7 $* 07070100007795000081ed000000000000000000000001479f64a200001aa6000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/iopattern#!/usr/bin/ksh # # iopattern - print disk I/O pattern. # Written using DTrace (Solaris 10 3/05). # # This prints details on the I/O access pattern for the disks, such as # percentage of events that were of a random or sequential nature. # By default totals for all disks are printed. # # $Id: iopattern 65 2007-10-04 11:09:40Z brendan $ # # USAGE: iopattern [-v] [-d device] [-f filename] [-m mount_point] # [interval [count]] # # -v # print timestamp, string # -d device # instance name to snoop (eg, dad0) # -f filename # full pathname of file to snoop # -m mount_point # this FS only (will skip raw events) # eg, # iopattern # default output, 1 second intervals # iopattern 10 # 10 second samples # iopattern 5 12 # print 12 x 5 second samples # iopattern -m / # snoop events on filesystem / only # # FIELDS: # %RAN percentage of events of a random nature # %SEQ percentage of events of a sequential nature # COUNT number of I/O events # MIN minimum I/O event size # MAX maximum I/O event size # AVG average I/O event size # KR total kilobytes read during sample # KW total kilobytes written during sample # DEVICE device name # MOUNT mount point # FILE filename # TIME timestamp, string # # NOTES: # # An event is considered random when the heads seek. This program prints # the percentage of events that are random. The size of the seek is not # measured - it's either random or not. # # SEE ALSO: iosnoop, iotop # # IDEA: Ryan Matteson # # COPYRIGHT: Copyright (c) 2005 Brendan Gregg. # # CDDL HEADER START # # The contents of this file are subject to the terms of the # Common Development and Distribution License, Version 1.0 only # (the "License"). You may not use this file except in compliance # with the License. # # You can obtain a copy of the license at Docs/cddl1.txt # or http://www.opensolaris.org/os/licensing. # See the License for the specific language governing permissions # and limitations under the License. # # CDDL HEADER END # # Author: Brendan Gregg [Sydney, Australia] # # 25-Jul-2005 Brendan Gregg Created this. # 25-Jul-2005 " " Last update. # 25-Jan-2008 Dimitri KRAVTCHUK - light changes on output... ############################## # --- Process Arguments --- # ### default variables opt_device=0; opt_file=0; opt_mount=0; opt_time=0 filter=0; device=.; filename=.; mount=.; interval=1; count=-1 ### process options while getopts d:f:hm:v name do case $name in d) opt_device=1; device=$OPTARG ;; f) opt_file=1; filename=$OPTARG ;; m) opt_mount=1; mount=$OPTARG ;; v) opt_time=1 ;; h|?) cat <<-END >&2 USAGE: iopattern [-v] [-d device] [-f filename] [-m mount_point] [interval [count]] -v # print timestamp -d device # instance name to snoop -f filename # snoop this file only -m mount_point # this FS only eg, iopattern # default output, 1 second samples iopattern 10 # 10 second samples iopattern 5 12 # print 12 x 5 second samples iopattern -m / # snoop events on filesystem / only END exit 1 esac done shift $(( $OPTIND - 1 )) ### option logic if [[ "$1" > 0 ]]; then interval=$1; shift fi if [[ "$1" > 0 ]]; then count=$1; shift fi if (( opt_device || opt_mount || opt_file )); then filter=1 fi ################################# # --- Main Program, DTrace --- # /usr/sbin/dtrace -n ' /* * Command line arguments */ inline int OPT_time = '$opt_time'; inline int OPT_device = '$opt_device'; inline int OPT_mount = '$opt_mount'; inline int OPT_file = '$opt_file'; inline int INTERVAL = '$interval'; inline int COUNTER = '$count'; inline int FILTER = '$filter'; inline string DEVICE = "'$device'"; inline string FILENAME = "'$filename'"; inline string MOUNT = "'$mount'"; #pragma D option quiet int last_loc[string]; /* * Program start */ dtrace:::BEGIN { /* starting values */ diskcnt = 0; diskmin = 0; diskmax = 0; diskran = 0; diskr = 0; diskw = 0; counts = COUNTER; secs = INTERVAL; LINES = 20; line = 0; last_event[""] = 0; } /* * Print header */ profile:::tick-1sec /line <= 0 / { /* print header */ printf("%4s %4s %6s %6s %6s %6s %6s %6s", "%RND", "%SEQ", "Op/s", "MIN", "MAX", "AVG", "KR/s", "KW/s"); /* print optional headers */ OPT_time ? printf(" %-20s", "TIME") : 1; OPT_device ? printf(" %-9s", "DEVICE") : 1; OPT_mount ? printf(" %-12s", "MOUNT") : 1; OPT_file ? printf(" %-12s", "FILE") : 1; printf("\n"); line = LINES; } /* * Check event is being traced */ io:genunix::done { /* default is to trace unless filtering */ self->ok = FILTER ? 0 : 1; /* check each filter */ (OPT_device == 1 && DEVICE == args[1]->dev_statname)? self->ok = 1 : 1; (OPT_file == 1 && FILENAME == args[2]->fi_pathname) ? self->ok = 1 : 1; (OPT_mount == 1 && MOUNT == args[2]->fi_mount) ? self->ok = 1 : 1; } /* * Process and Print completion */ io:genunix::done /self->ok/ { /* * Save details */ this->loc = args[0]->b_blkno * 512; this->pre = last_loc[args[1]->dev_statname]; diskr += args[0]->b_flags & B_READ ? args[0]->b_bcount : 0; diskw += args[0]->b_flags & B_READ ? 0 : args[0]->b_bcount; diskran += this->pre == this->loc ? 0 : 1; diskcnt++; diskmin = diskmin == 0 ? args[0]->b_bcount : (diskmin > args[0]->b_bcount ? args[0]->b_bcount : diskmin); diskmax = diskmax < args[0]->b_bcount ? args[0]->b_bcount : diskmax; /* save disk location */ last_loc[args[1]->dev_statname] = this->loc + args[0]->b_bcount; /* cleanup */ self->ok = 0; } /* * Timer */ profile:::tick-1sec { secs--; } /* * Print Output */ profile:::tick-1sec /secs == 0/ { /* calculate diskavg */ diskavg = diskcnt > 0 ? (diskr + diskw) / diskcnt : 0; /* convert counters to Kbytes */ diskr /= 1024; diskw /= 1024; /* convert to percentages */ diskran = diskcnt == 0 ? 0 : (diskran * 100) / diskcnt; diskseq = diskcnt == 0 ? 0 : 100 - diskran; /* print data */ printf("%4d %4d %6d %6d %6d %6d %6d %6d", diskran, diskseq, diskcnt / INTERVAL, diskmin, diskmax, diskavg, diskr / INTERVAL, diskw / INTERVAL ); /* print optional fields */ OPT_time ? printf(" %-20Y", walltimestamp) : 1; OPT_device ? printf(" %-9s", DEVICE) : 1; OPT_mount ? printf(" %-12s", MOUNT) : 1; OPT_file ? printf(" %-12s", FILENAME) : 1; printf("\n"); /* clear data */ diskmin = 0; diskmax = 0; diskcnt = 0; diskran = 0; diskr = 0; diskw = 0; secs = INTERVAL; counts--; line--; } /* * End of program */ profile:::tick-1sec /counts == 0/ { exit(0); } ' 07070100007799000081ed00000000000000000000000149fde5e8000002e5000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/jvmGC.sh#!/bin/ksh # # jvmGC (dim) v.1.0 # # Permanent or on-demand JVM GC/MEM usage monitoring # dim_STAT Plug-in # # Usage: # 1.) jvmGC using $LOG file for data input (you may change name & permissions # according your needs) # # 2.) $ jvmGC.sh TimeInterval # # 3.) add "-verbose:gc" option to java in your starting application script # and redirect output into application log file (for ex. app.log) # # 4.) once you want to monitor your JVM: # $ tail -f app.log | /etc/STATsrv/bin/grepX GC >> $LOG # # 5.) observe jvmGC output & have fun! :)) # # Rgds, # -Dimitri # LANG=C export LANG LOG=/var/tmp/jvm.log touch $LOG; chmod 0666 $LOG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.jvmGC -logGC $LOG -Timeout $1 0707010000779b000081ed00000000000000000000000145b0909d00000403000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/jvmSTAT.sh#!/bin/sh #================================================================= # dim_STAT (dim) Wrapper to jvmstat 3.0 (JDK5.0) #================================================================= # # Path to JDK 5.0 # JAVA_HOME=/usr/java PATH=$JAVA_HOME/bin:$PATH export JAVA_HOME PATH # # STAT-service params # PATH=/etc/STATsrv/bin:$PATH LANG=C export PATH LANG #----------------------------- # NAME selection mask #----------------------------- NAME_MASK="*" export NAME_MASK #-------------------------------------------------------------- # NAME: Replace long strings... # syntax: REPLACE_STRn="OldWord [NewWord]" #-------------------------------------------------------------- REPLACE_STR1=".jar " ; export REPLACE_STR1 REPLACE_STR2="com.france. " ; export REPLACE_STR2 REPLACE_STR3=".server.ServerMain " ; export REPLACE_STR3 REPLACE_STR4="Message Msg" ; export REPLACE_STR4 cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.jvmSTAT -Timeout $1 0707010000779c000081ed0000000000000000000000014a93fff400000230000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/mysqlLOAD.sh#!/bin/sh LANG=C export LANG if [ X$1 = X ] then echo "" echo "Usage:" echo " $0 Timeout" echo "" echo "NOTE: edit $0 file to set connection params, etc." echo "" exit 2 fi #=================================================================== # MySQL Load stats directly via WebX.mySQL5 #=================================================================== # Set connection params: User=username Passwd=password Host=server:port export User Passwd Host cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX.mySQL5 /etc/STATsrv/bin/x.mysqlLOAD -Timeout $1 0707010000779d000081ed0000000000000000000000014a9400130000022b000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/mysqlSTAT.sh#!/bin/sh LANG=C export LANG if [ X$1 = X ] then echo "" echo "Usage:" echo " $0 Timeout" echo "" echo "NOTE: edit $0 file to set connection params, etc." echo "" exit 2 fi #=================================================================== # MySQL stats directly via WebX.mySQL5 #=================================================================== # Set connection params: User=username Passwd=password Host=server:port export User Passwd Host cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX.mySQL5 /etc/STATsrv/bin/x.mysqlSTAT -Timeout $1 0707010000779e000081fd000000000000000000000001455a43a50000fc08000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/netLOADELF44 (44,>,/usr/lib/ld.so.1C[&L>FU;H<E9G"J7B'P0$/I5K@T?)OD3VMZ4 YX-=Q%,2.:8#!(61AC*RSN+Wh  L|6 6 7 ,>>>>@=<t@L"='@)@27@@!<44HRt<{<@=(l=,6 ==84|H)p=>,P =t|=@@= 5D(<$@!,= 3>8A?=EAL=\Y4q=x@< >+<t=h>=6 =&<socketgetopt_startDeltaUsageatoiT_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepabortatexitexitOflagmallocpbannerputs_init.umultime__register_frame_info_tableIFnamesstrncpy_DYNAMICIFprintstrncmpIFupdateprintf__iobioctl__frame_state_for_exitenvironperrorfreeoptindcloseoptargkstat_lookup__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memset__floatdidfkstat_read_etext_lib_versionIFcopyfflushmainIFlistmemcpystrlenIFnumbintervalkstat_open_finikstat_data_lookupfprintflibkstat.so.1SUNW_0.7libsocket.so.1SISCD_2.3libc.so.1SYSVABI_1.3libkstat.so.1libsocket.so.1libnsl.so.1libc.so.1. =(<E ztT^7̳h@#ABAD@;<*<+<><Z<=!=W= @=,/=82=D(=PS=\E=hL=t8=Y=:=P==<=C=-=5=G=T=1>A>)>J @D# @K6M"@K2@ , @ "@L@K'@K(㿐@/K$ @   $? 2 @ 㿐㿐@/J㜮 ` @ 㿐㿈'DD#\`MDDDD@J @J8'D'H " H''DHM@J'쀢? .*`D $ "  "  " | " w " r!''' *`: [ *`:   *`: ,@" +` + @   *`"䀢 ?' *`:  *`: ,  *`:  'b"" '*!D@a  *H `"@I"b"䀢`!D@a  *H `"@I'@I'؀  Mc@I @I"`@"` Mc@I`@I`@ " @Y@2 '`@I `"  @I`@ " @f@=@@   ܒ '㿈'"@*@*`X  * *@  @@Ih '㿀'D'"@*@*` D ?@IL'耢 , * *!@  +  *a  +` +   (@ +` ?"(?" ?"`,?" $D @I*@*`a  N @I  N@I N@I' * *!@ 䀢` ?" N @H' * *!@ 䀢` ?" $*@*`a  N @H  N0@HN@@H' * *!@ 䀢` ?" (NH@H' * *!@ 䀢` ?" ,*@*`a  N @H|  NX@HwNh@Ho' * *!@ 䀢`` ??: 0Nx@HU' * *!@ 䀢`` ??: 8*@*`a  N @H0  N@H+N@H#' * *!@ 䀢`` ??: @N@H ' * *!@ 䀢`` ??: HN@G' * *!@ 䀢` ?" XN@G' * *!@ 䀢` ?" \N@G' * *!@ 䀢` ?" PN@G' * *!@ 䀢` ?" T '('"@4 * *!@  +  *a  $`d" '? * *!@  +  *a  ,`l" ' ? * *!@  +  *a  ``" '? * *!@  +  *a  (`h" ' ? * *!@  +  *a  8`x b  @~? * *!@  +  *a  H` b  @e? * *!@  +  *a  0`p b  @L? * *!@  +  *a  @` b  @3?؁?ȁ??Ё?  W*`H` ##x$$ #$hN!8?N!8?>N!@?N!@?2N!HDN!8?N!HDN!8? N!HDN!@?N!HDN!@?N!HD?N!HD?*@*`a  +  *!   "䅠 ?N!P (@ +`!  (? "䅠Б ?N!P+(! $ "䅠؅ #\#`N!P#\#`+(! , "䅠ȅ #d#hN!P#d#h+(!, + P"' "䉠#l#p+(!, + T"'"䉠#t#x+(!, + X"' "䉠#|#ЅD"䉠##ȅD"䉠##+(!, + \"#N@EY 'Na0@E8`@EO㿐"耢`7NX""  -*`J (()X)())@N""NH""N""N8""N""b@D@   @E 'W@E  O`(@D@D @D*`'@D'  O`8@D@D @D''0@D  O`H@D@D @D'2`' b * *! `"  @D?' '@D 㿈@/D> '쁠4  B'쁠 B` BD   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @C* ?''' `      & && 㿐@/C   @@*  @    2      2 *@ @ :  @@   㿈@/C  "  @C&@ @`@C @J z- @C@@`  @C{ 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @CV ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @Bܐ ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@B"@Bo"$&b""@Bh@B0 ' @*!*@ * "`'0 &` @B{㿐@/B<&`&`&@ &` @&`&`"@㿐@/A&`&` &` &@@&`&`"@㿐@/A㬮  ` `"@  @B:` 0 `@B7XL ؠ =  @B("7j'?$   ؐ  J zo  '  @A"㿐@/A $? ???㿐㿠㿠X%s (dim) v.4.0 Usage: %s [-K|-k|-M|-m|-b] [-I interfaces] interval [numb] Example: %s 5 %s -I "ce0 ce1 ce4 lo0" 5 %s -I ce0,ce1,ce4,lo0 5 h?KkMmbI:can't open kstat control structure!! No network interfaces found...scidin_bytesrbytesipacketsout_bytesobytesopacketsin_bytes64rbytes64ipackets64out_bytes64obytes64opackets64collisionsnocanputierrorsoerrors%-10s %14.1f %14.1f %8.1f %8.1f %6.1f %6.1f %6.1f %14.1f %8.1f %8d @A0@ Name IBytes/s OBytes/s Ipack/s Opack/s Ierr/s Oerr/s Col/s Bytes/s Pack/s NocanputName IKB/s OKB/s Ipack/s Opack/s Ierr/s Oerr/s Col/s KB/s Pack/s NocanputName IMB/s OMB/s Ipack/s Opack/s Ierr/s Oerr/s Col/s MB/s Pack/s NocanputName IKbit/s OKbit/s Ipack/s Opack/s Ierr/s Oerr/s Col/s Kbit/s Pack/s NocanputName IMbit/s OMbit/s Ipack/s Opack/s Ierr/s Oerr/s Col/s Mbit/s Pack/s NocanputName IBit/s OBit/s Ipack/s Opack/s Ierr/s Oerr/s Col/s Bits/s Pack/s NocanputSIOCGIFNUMno memorySIOCGIFCONF@Aeh>,>>@00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t00t 6 6o o  h <\|L >|e  e+<t - e|e  e +4 (+L 8,0H H,xTX, - et-h - e.x - e/`( - e0 - e44H - e4|H - e4 - e85D( - eh  L|6 6 7 ,>>>>@& (>,>:>HL^Lm>> @>6>> =<t @.L4=9@;@DI@@!N44Hd<<@=(l=,6 ==84|H)p=>,P =t|=@@=$5D(6<<@!D= K>PAW=]Ad=\q4=@< >+<t=h>=&6 ,=><netLOAD4crti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummynetLOAD4.cbanner.12libgcc2.c.LLC0.LLC1__FRAME_BEGIN__frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.ssocketgetopt_startDelta_START_UsageatoiT_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepabortatexitexitOflagmallocpbannerputs_init.umultime__register_frame_info_table_END_IFnamesstrncpy_DYNAMICIFprintstrncmpIFupdateprintf__iobioctl__frame_state_for_exitenvironperrorfreeoptindcloseoptargkstat_lookup__deregister_frame_infostrcmp_edata_PROCEDURE_LINKAGE_TABLE_memset__floatdidfkstat_read_etext_lib_versionIFcopyfflushmainIFlistmemcpystrlenIFnumbintervalkstat_open_finikstat_data_lookupfprintfas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4XG# dd&<5_yɀ;׀"<WxԀ"6Kl,",Ԁ:?EJ& %"+\5oBր !)^#s'>D΀EJNO$P:UP^f_~nowȀ}~9Vs-.€>؀?@ A C 3D HE \G rH I J a ƀb ݀c d l %m >n Yo t u À ڀ  7   2 H ^ r ̀  $ 9 M c w   :ۀ.%L-5 S<qEKPUʀZ`a bc2I_uҀS3Mhʀӂ+/Jbz:T^'΀Z/v"$C &=w*р1;F !#!u3!!ʀ""̀#"#h###$$$5$P$h$$$$$Ҁ%%&%h!%%%%Ԁ&E)&\&#&Հ)&+''e((0(€4(߀)E)/)I)!))&)*2,*K*h*&**Հ**++0&+J+p++,6,S,,--.J../\/ƀ/080t00ʀ1\3345 5S5678i:F3:a;B;6;P<<)<>YH>p?o??̀?@AA.BBfB6C=D AD GD&$LD3KDDLDMDS8DTDDB$LDC$XdDOWDD[WHDXDY Dd DeDf$Dh(Dj\DmHDnTDp\DqpDrDsDtDuDvDxDyXDzD{D}4DvPDdDlDxDDDDDDXDtDDDDDDDDDDD$D4DTDpDxDDDDDDDDhYDpYDxYDYDYDZD[Dр\D]E^E_E-_E8`EFaETb $E`$Ea$@DDDDDEoEw$Ex$EDDDDD,DtDDD0DDDDXDD D8DDDLDdDD0D|DDDD@DXDDDDD`DtDtEEEtE$|E$PDDDD,DDD@DDDdDD,DXDDDD(D<DPDXDlDDDDD D D DD,D@DHDD$D% D& D& EʀEҀE܀EEEF FF$ F2$ F3$*(lD*D+D-D/D1(D4tD5D7D8D:D;D=D>D@DADEDFDFFB&+>FP$FQ$J)pDJDKDSDTDU@DVPDW\DZhD[xD\D]D^D_DbDcDdDeDfDgDjDk$Dm0DoHDmDrDsDtDtF`KFmKF{LFLFMFMFNFOFPFȀQF$F @F FG HG HG"d+<N d+<$d+<0<?iӀE,Faހ,@Jay~Ԁ 2ˀh  v . C Y nI J K L ŀM ۀO P V Y 5 l| $+< @ $t d+, d+"d+,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$i+)@h)@h )$4)$~+)@})@} )$L)*<$,0*O@*m@ *w@ *$H*$,x*@*$T*$,*@*@*@*@+ @+$+$-h+0@+<$+=$'.x+N@&+Y$+Z$R/`+s@Q+}@Q+$(+$0+@}+@}+@~+@~+$+$44+@,@,$H,$ 4|,7@ ,E@ ,Q$H,R$4,r@,$,$45D,@3,@3,$(,(P@,d6l.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpnetLOAD4.c/SOFT/netLOAD/netLOAD4.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/sys/feature_tests.h/usr/include/sys/va_list.h__va_list:t(3,1)=(3,2)=*(0,19)size_t:t(1,1)=(0,4)__longlong_t:t(1,2)=(0,6)off_t:t(1,3)=(0,3)off64_t:t(1,4)=(1,2)fpos_t:t(1,5)=(0,3)fpos64_t:t(1,6)=(1,2)FILE:t(1,7)=(1,8)=s16_cnt:(0,1),0,32;_ptr:(1,9)=*(0,11),32,32;_base:(1,9),64,32;_flag:(0,11),96,8;_file:(0,11),104,8;;/usr/include/stdlib.hdiv_t:t(4,1)=(4,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(4,3)=(4,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;lldiv_t:t(4,5)=(4,6)=s16quot:(0,6),0,64;rem:(0,6),64,64;;uid_t:t(4,7)=(0,3)wchar_t:t(4,8)=(0,3)/usr/include/sys/types.h/usr/include/sys/isa_defs.h/usr/include/sys/machtypes.h_physadr_t:T(7,1)=s4r:(7,2)=ar(0,0);0;0;(0,1),0,32;;physadr_t:t(7,3)=(7,4)=*(7,1)_label_t:T(7,5)=s8val:(7,6)=ar(0,0);0;1;(0,1),0,64;;label_t:t(7,7)=(7,5)lock_t:t(7,8)=(0,11)/usr/include/sys/int_types.hint8_t:t(8,1)=(0,2)int16_t:t(8,2)=(0,8)int32_t:t(8,3)=(0,1)int64_t:t(8,4)=(0,6)uint8_t:t(8,5)=(0,11)uint16_t:t(8,6)=(0,9)uint32_t:t(8,7)=(0,4)uint64_t:t(8,8)=(0,7)intmax_t:t(8,9)=(8,4)uintmax_t:t(8,10)=(8,8)intptr_t:t(8,11)=(0,1)uintptr_t:t(8,12)=(0,4)int_least8_t:t(8,13)=(0,2)int_least16_t:t(8,14)=(0,8)int_least32_t:t(8,15)=(0,1)int_least64_t:t(8,16)=(0,6)uint_least8_t:t(8,17)=(0,11)uint_least16_t:t(8,18)=(0,9)uint_least32_t:t(8,19)=(0,4)uint_least64_t:t(8,20)=(0,7)longlong_t:t(5,1)=(0,6)u_longlong_t:t(5,2)=(0,7)uchar_t:t(5,3)=(0,11)ushort_t:t(5,4)=(0,9)uint_t:t(5,5)=(0,4)ulong_t:t(5,6)=(0,5)caddr_t:t(5,7)=(5,8)=*(0,2)daddr_t:t(5,9)=(0,3)cnt_t:t(5,10)=(0,8)paddr_t:t(5,11)=(5,6)use_t:t(5,12)=(5,3)sysid_t:t(5,13)=(0,8)index_t:t(5,14)=(0,8)ino_t:t(5,15)=(5,6)blkcnt_t:t(5,16)=(0,3)fsblkcnt_t:t(5,17)=(5,6)fsfilcnt_t:t(5,18)=(5,6)ino64_t:t(5,19)=(5,2)blkcnt64_t:t(5,20)=(5,1)fsblkcnt64_t:t(5,21)=(5,2)fsfilcnt64_t:t(5,22)=(5,2) :T(5,23)=eB_FALSE:0,B_TRUE:1,;boolean_t:t(5,24)=(5,23)pad64_t:t(5,25)=(8,4)upad64_t:t(5,26)=(8,8)offset_t:t(5,27)=(5,1)u_offset_t:t(5,28)=(5,2)len_t:t(5,29)=(5,2)diskaddr_t:t(5,30)=(5,1)lloff_t:t(5,31)=(5,32)=u8_f:(5,27),0,64;_p:(5,33)=s8_u:(0,3),0,32;_l:(1,3),32,32;;,0,64;;lldaddr_t:t(5,34)=(5,35)=u8_f:(5,30),0,64;_p:(5,36)=s8_u:(0,3),0,32;_l:(5,9),32,32;;,0,64;;k_fltset_t:t(5,37)=(5,6)id_t:t(5,38)=(0,3)useconds_t:t(5,39)=(5,5)major_t:t(5,40)=(5,6)minor_t:t(5,41)=(5,6)pri_t:t(5,42)=(0,8)o_mode_t:t(5,43)=(5,4)o_dev_t:t(5,44)=(0,8)o_uid_t:t(5,45)=(5,4)o_gid_t:t(5,46)=(5,45)o_nlink_t:t(5,47)=(0,8)o_pid_t:t(5,48)=(0,8)o_ino_t:t(5,49)=(5,4)key_t:t(5,50)=(0,1)mode_t:t(5,51)=(5,6)gid_t:t(5,52)=(4,7)nlink_t:t(5,53)=(5,6)dev_t:t(5,54)=(5,6)pid_t:t(5,55)=(0,3)pthread_t:t(5,56)=(0,4)pthread_key_t:t(5,57)=(0,4)_pthread_mutex:T(5,58)=s24__pthread_mutex_flags:(5,59)=s8__pthread_mutex_flag:(5,60)=ar(0,0);0;3;(8,5),0,32;__pthread_mutex_type:(8,7),32,32;;,0,64;__pthread_mutex_lock:(5,61)=u8__pthread_mutex_lock64:(5,62)=s8__pthread_mutex_pad:(5,63)=ar(0,0);0;7;(8,5),0,64;;,0,64;__pthread_mutex_owner64:(5,26),0,64;;,64,64;__pthread_mutex_data:(5,26),128,64;;pthread_mutex_t:t(5,64)=(5,58)_pthread_cond:T(5,65)=s16__pthread_cond_flags:(5,66)=s8__pthread_cond_flag:(5,60),0,32;__pthread_cond_type:(8,7),32,32;;,0,64;__pthread_cond_data:(5,26),64,64;;pthread_cond_t:t(5,67)=(5,65)_pthread_attr:T(5,68)=s4__pthread_attrp:(3,2),0,32;;pthread_attr_t:t(5,69)=(5,68)_pthread_mutexattr:T(5,70)=s4__pthread_mutexattrp:(3,2),0,32;;pthread_mutexattr_t:t(5,71)=(5,70)_pthread_condattr:T(5,72)=s4__pthread_condattrp:(3,2),0,32;;pthread_condattr_t:t(5,73)=(5,72)_once:T(5,74)=s32__pthread_once_pad:(5,75)=ar(0,0);0;3;(5,26),0,256;;pthread_once_t:t(5,76)=(5,74)ssize_t:t(5,77)=(0,1)time_t:t(5,78)=(0,3)clock_t:t(5,79)=(0,3)clockid_t:t(5,80)=(0,1)timer_t:t(5,81)=(0,1)unchar:t(5,82)=(0,11)ushort:t(5,83)=(0,9)uint:t(5,84)=(0,4)ulong:t(5,85)=(0,5)hostid_t:t(5,86)=(0,3)u_char:t(5,87)=(0,11)u_short:t(5,88)=(0,9)u_int:t(5,89)=(0,4)u_long:t(5,90)=(0,5)_quad:T(5,91)=s8val:(5,92)=ar(0,0);0;1;(0,3),0,64;;quad:t(5,93)=(5,91)/usr/include/sys/select.h/usr/include/sys/time.htimeval:T(10,1)=s8tv_sec:(5,78),0,32;tv_usec:(0,3),32,32;;timezone:T(10,2)=s8tz_minuteswest:(0,1),0,32;tz_dsttime:(0,1),32,32;;/usr/include/sys/types.hitimerval:T(10,3)=s16it_interval:(10,1),0,64;it_value:(10,1),64,64;;timespec:T(10,4)=s8tv_sec:(5,78),0,32;tv_nsec:(0,3),32,32;;timespec_t:t(10,5)=(10,4)timestruc_t:t(10,6)=(10,4)itimerspec:T(10,7)=s16it_interval:(10,4),0,64;it_value:(10,4),64,64;;itimerspec_t:t(10,8)=(10,7)hrtime_t:t(10,9)=(5,1)/usr/include/time.htm:T(12,1)=s36tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;;/usr/include/sys/time.h/usr/include/sys/siginfo.hsigval:T(14,1)=u4sival_int:(0,1),0,32;sival_ptr:(3,2),0,32;;sigevent:T(14,2)=s24sigev_notify:(0,1),0,32;_sigev_un:(14,3)=u4_sigev_signo:(0,1),0,32;_sigev_notify_function:(14,4)=*(14,5)=f(0,19),0,32;;,32,32;sigev_value:(14,1),64,32;_sigev_pad1:(0,1),96,32;_sigev_notify_attributes:(3,2),128,32;_sigev_pad2:(0,1),160,32;;/usr/include/sys/machsig.h/usr/include/sys/time.hsiginfo:T(14,6)=s128si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(14,7)=u116__pad:(14,8)=ar(0,0);0;28;(0,1),0,928;__proc:(14,9)=s16__pid:(5,55),0,32;__pdata:(14,10)=u12__kill:(14,11)=s8__uid:(4,7),0,32;__value:(14,1),32,32;;,0,64;__cld:(14,12)=s12__utime:(5,79),0,32;__status:(0,1),32,32;__stime:(5,79),64,32;;,0,96;;,32,96;;,0,128;__fault:(14,13)=s12__addr:(3,2),0,32;__trapno:(0,1),32,32;__pc:(5,7),64,32;;,0,96;__file:(14,14)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(14,15)=s116__faddr:(5,7),0,32;\__tstamp:(10,6),32,64;__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;__sysarg:(14,16)=ar(0,0);0;7;(0,3),128,256;__mstate:(14,17)=ar(0,0);0;16;(0,3),384,544;;,0,928;;,96,928;;siginfo_t:t(14,18)=(14,6)k_siginfo:T(14,19)=s28si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(14,20)=u16__proc:(14,21)=s16__pid:(5,55),0,32;__pdata:(14,22)=u12__kill:(14,23)=s8__uid:(4,7),0,32;__value:(14,1),32,32;;,0,64;__cld:(14,24)=s12__utime:(5,79),0,32;__status:(0,1),32,32;__stime:(5,79),64,32;;,0,96;;,32,96;;,0,128;__fault:(14,25)=s12__addr:(3,2),0,32;__trapno:(0,1),32,32;__pc:(5,7),64,32;;,0,96;__file:(14,26)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(14,27)=s16__faddr:(5,7),0,32;__tstamp:(10,6),32,64;\__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;;,0,128;;,96,128;;k_siginfo_t:t(14,28)=(14,19)sigqueue:T(14,29)=s40sq_next:(14,30)=*(14,29),0,32;sq_info:(14,28),32,224;sq_func:(14,31)=*(14,32)=f(0,19),256,32;sq_backptr:(3,2),288,32;;sigqueue_t:t(14,33)=(14,29)/usr/include/sys/select.hfd_mask:t(9,1)=(0,3)fds_mask:t(9,2)=(0,3)fd_set:T(9,3)=s128fds_bits:(9,4)=ar(0,0);0;31;(0,3),0,1024;;fd_set:t(9,5)=(9,3)/usr/include/sys/socket.h/usr/include/sys/uio.hiovec:T(19,1)=s8iov_base:(5,7),0,32;iov_len:(0,1),32,32;;iovec_t:t(19,2)=(19,1)uio_seg:T(19,3)=eUIO_USERSPACE:0,UIO_SYSSPACE:1,UIO_USERISPACE:2,;uio_seg_t:t(19,4)=(19,3)uio:T(19,5)=s40uio_iov:(19,6)=*(19,2),0,32;uio_iovcnt:(0,1),32,32;_uio_offset:(5,31),64,64;uio_segflg:(19,4),128,32;uio_fmode:(0,8),160,16;_uio_limit:(5,34),192,64;uio_resid:(0,1),256,32;;uio_t:t(19,7)=(19,5)uio_rw:T(19,8)=eUIO_READ:0,UIO_WRITE:1,;uio_rw_t:t(19,9)=(19,8)/usr/include/sys/netconfig.hnetconfig:T(20,1)=s64nc_netid:(5,8),0,32;nc_semantics:(0,5),32,32;nc_flag:(0,5),64,32;nc_protofmly:(5,8),96,32;nc_proto:(5,8),128,32;nc_device:(5,8),160,32;nc_nlookups:(0,5),192,32;nc_lookups:(20,2)=*(5,8),224,32;nc_unused:(20,3)=ar(0,0);0;7;(0,5),256,256;;NCONF_HANDLE:t(20,4)=(20,5)=s8nc_head:(20,6)=*(20,7)=*(20,1),0,32;nc_curr:(20,6),32,32;;sa_family_t:t(18,1)=(0,9)linger:T(18,2)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr:T(18,3)=s16sa_family:(18,1),0,16;sa_data:(18,4)=ar(0,0);0;13;(0,2),16,112;;msghdr:T(18,5)=s24msg_name:(5,7),0,32;msg_namelen:(0,1),32,32;msg_iov:(18,6)=*(19,1),64,32;msg_iovlen:(0,1),96,32;msg_accrights:(5,7),128,32;msg_accrightslen:(0,1),160,32;;cmsghdr:T(18,7)=s12cmsg_len:(1,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;;opthdr:T(18,8)=s12level:(0,3),0,32;name:(0,3),32,32;len:(0,3),64,32;;/usr/include/sys/sockio.h/usr/include/sys/ioccom.hbsd_compat_ioctltab:T(22,1)=s12cmd:(0,1),0,32;flag:(0,1),32,32;size:(0,4),64,32;;/usr/include/unistd.h/usr/include/sys/unistd.h/usr/include/stropts.h/usr/include/sys/stropts.h/usr/include/sys/conf.h/usr/include/sys/t_lock.h/usr/include/sys/machlock.hdisp_lock_t:t(29,1)=(7,8)/usr/include/sys/sleepq.hsleepq:T(30,1)=s4sq_first:(30,2)=*(30,3)=xs_kthread:,0,32;;sleepq_t:t(30,4)=(30,1)_sleepq_head:T(30,5)=s8sq_queue:(30,4),0,32;sq_lock:(29,1),32,8;;sleepq_head_t:t(30,6)=(30,5)/usr/include/sys/turnstile.h/usr/include/sys/param.h/usr/include/sys/pirec.hpirec:T(33,1)=s16pi_forw:(33,2)=*(33,1),0,32;pi_back:(33,2),32,32;pi_benef:(30,2),64,32;pi_epri_hi:(5,5),96,32;;pirec_t:t(33,3)=(33,1) :T(31,1)=eQOBJ_UND:-1,QOBJ_DEF:0,QOBJ_READER:0,QOBJ_WRITER:1,QOBJ_CV:0,QOBJ_MUTEX:0,QOBJ_SEMA:0,;qobj_t:t(31,2)=(31,1)turnstile_t:t(31,3)=(31,4)=xsturnstile:turnstile_id_t:t(31,5)=(5,4)tstile_un:T(31,6)=u16ts_forw:(31,7)=*(31,3),0,32;ts_prioinv:(33,3),0,128;;turnstile:T(31,4)=s32tsun:(31,6),0,128;ts_sleepq:(31,8)=ar(0,0);0;1;(30,4),128,64;ts_id:(31,5),192,16;ts_flags:(5,3),208,8;ts_wlock:(29,1),216,8;ts_sobj_priv_data:(3,2),224,32;;/usr/include/sys/mutex.h :T(34,1)=eMUTEX_ADAPTIVE:0,MUTEX_SPIN:1,MUTEX_ADAPTIVE_STAT:2,MUTEX_SPIN_STAT:3,MUTEX_DRIVER_NOSTAT:4,MUTEX_DRIVER_STAT:5,MUTEX_ADAPTIVE_DEF:6,;kmutex_type_t:t(34,2)=(34,1)mutex:T(34,3)=s8_opaque:(34,4)=ar(0,0);0;1;(3,2),0,64;;kmutex_t:t(34,5)=(34,3)/usr/include/sys/rwlock.h :T(35,1)=eRW_SLEEP:0,RW_SLEEP_STAT:1,RW_DRIVER_NOSTAT:2,RW_DRIVER_STAT:3,RW_DEFAULT:4,;krw_type_t:t(35,2)=(35,1) :T(35,3)=eRW_WRITER:0,RW_READER:1,;krw_t:t(35,4)=(35,3)_krwlock:T(35,5)=s12_opaque:(35,6)=ar(0,0);0;2;(3,2),0,96;;krwlock_t:t(35,7)=(35,5)/usr/include/sys/semaphore.h :T(36,1)=eSEMA_DEFAULT:0,SEMA_DRIVER:1,;ksema_type_t:t(36,2)=(36,1)_ksema:T(36,3)=s8_opaque:(34,4),0,64;;ksema_t:t(36,4)=(36,3)/usr/include/sys/condvar.h_kcondvar:T(37,1)=s2_opaque:(5,4),0,16;;kcondvar_t:t(37,2)=(37,1) :T(37,3)=eCV_DEFAULT:0,CV_DRIVER:1,;kcv_type_t:t(37,4)=(37,3)fmodsw_impl:T(27,1)=s28f_name:(27,2)=ar(0,0);0;8;(0,2),0,72;f_str:(27,3)=*(27,4)=xsstreamtab:,96,32;f_flag:(0,1),128,32;f_lock:(27,5)=*(34,5),160,32;f_count:(5,5),192,32;;fmodsw_impl_t:t(27,6)=(27,1)fmodsw:T(27,7)=s20f_name:(27,2),0,72;f_str:(27,3),96,32;f_flag:(0,1),128,32;;fmodsw_t:t(27,8)=(27,7)linesw:T(27,9)=s32l_open:(27,10)=*(27,11)=f(0,1),0,32;l_close:(27,10),32,32;l_read:(27,10),64,32;l_write:(27,10),96,32;l_ioctl:(27,10),128,32;l_input:(27,10),160,32;l_output:(27,10),192,32;l_mdmint:(27,10),224,32;;termsw:T(27,12)=s12t_input:(27,10),0,32;t_output:(27,10),32,32;t_ioctl:(27,10),64,32;;strioctl:T(26,1)=s16ic_cmd:(0,1),0,32;ic_timout:(0,1),32,32;ic_len:(0,1),64,32;ic_dp:(5,8),96,32;;strbuf:T(26,2)=s12maxlen:(0,1),0,32;len:(0,1),32,32;buf:(5,8),64,32;;strpeek:T(26,3)=s28ctlbuf:(26,2),0,96;databuf:(26,2),96,96;flags:(0,3),192,32;;strfdinsert:T(26,4)=s36ctlbuf:(26,2),0,96;databuf:(26,2),96,96;flags:(0,3),192,32;fildes:(0,1),224,32;offset:(0,1),256,32;;strrecvfd:T(26,5)=s20fd:(0,1),0,32;uid:(4,7),32,32;gid:(5,52),64,32;fill:(26,6)=ar(0,0);0;7;(0,2),96,64;;str_mlist:T(26,7)=s9l_name:(27,2),0,72;;str_list:T(26,8)=s8sl_nmods:(0,1),0,32;sl_modlist:(26,9)=*(26,7),32,32;;bandinfo:T(26,10)=s8bi_pri:(0,11),0,8;bi_flag:(0,1),32,32;;strsigset:T(26,11)=s8ss_pid:(5,55),0,32;ss_events:(0,3),32,32;;/usr/include/net/if.hifqueue:T(38,1)=s20ifq_head:(38,2)=*(38,3)=xsmbuf:,0,32;ifq_tail:(38,2),32,32;ifq_len:(0,1),64,32;ifq_maxlen:(0,1),96,32;ifq_drops:(0,1),128,32;;ifnet:T(38,4)=s112if_name:(5,8),0,32;if_unit:(0,8),32,16;if_mtu:(0,8),48,16;if_flags:(0,8),64,16;if_timer:(0,8),80,16;if_promisc:(5,88),96,16;if_metric:(0,1),128,32;if_addrlist:(38,5)=*(38,6)=xsifaddr:,160,32;if_snd:(38,1),192,160;if_init:(27,10),352,32;if_output:(27,10),384,32;if_ioctl:(27,10),416,32;if_reset:(27,10),448,32;if_watchdog:(27,10),480,32;if_ipackets:(0,1),512,32;if_ierrors:(0,1),544,32;if_opackets:(0,1),576,32;if_oerrors:(0,1),608,32;if_collisions:(0,1),640,32;if_next:(38,7)=*(38,4),672,32;if_upper:(38,7),704,32;if_lower:(38,7),736,32;if_input:(27,10),768,32;if_ctlin:(27,10),800,32;\if_ctlout:(27,10),832,32;if_memmap:(38,8)=*(38,9)=xsmap:,864,32;;ifaddr:T(38,6)=s40ifa_addr:(18,3),0,128;ifa_ifu:(38,10)=u16ifu_broadaddr:(18,3),0,128;ifu_dstaddr:(18,3),0,128;;,128,128;ifa_ifp:(38,7),256,32;ifa_next:(38,5),288,32;;ifr_dnld_reqs:T(38,11)=s16v_addr:(5,7),0,32;m_addr:(5,7),32,32;ex_addr:(5,7),64,32;size:(5,89),96,32;;ifr_fddi_stats:T(38,12)=s8stat_size:(5,89),0,32;fddi_stats:(5,7),32,32;;ifr_netmapents:T(38,13)=s12map_ent_size:(5,89),0,32;entry_number:(5,89),32,32;fddi_map_ent:(5,7),64,32;;ifr_fddi_gen_struct:T(38,14)=s8ifru_fddi_gioctl:(0,1),0,32;ifru_fddi_gaddr:(5,7),32,32;;ifreq:T(38,15)=s32ifr_name:(38,16)=ar(0,0);0;15;(0,2),0,128;ifr_ifru:(38,17)=u16ifru_addr:(18,3),0,128;ifru_dstaddr:(18,3),0,128;ifru_oname:(38,16),0,128;ifru_broadaddr:(18,3),0,128;ifru_index:(0,1),0,32;ifru_flags:(0,8),0,16;ifru_metric:(0,1),0,32;ifru_data:(38,18)=ar(0,0);0;0;(0,2),0,8;ifru_enaddr:(38,19)=ar(0,0);0;5;(0,2),0,48;if_muxid:(7,6),0,64;ifru_dnld_req:(38,11),0,128;ifru_fddi_stat:(38,12),0,64;ifru_netmapent:(38,13),0,96;ifru_fddi_gstruct:(38,14),0,64;;,128,128;;ifconf:T(38,20)=s8ifc_len:(0,1),0,32;ifc_ifcu:(38,21)=u4ifcu_buf:(5,7),0,32;ifcu_req:(38,22)=*(38,15),0,32;;,32,32;;if_data:T(38,23)=s68ifi_type:(5,87),0,8;ifi_addrlen:(5,87),8,8;ifi_hdrlen:(5,87),16,8;ifi_mtu:(5,90),32,32;ifi_metric:(5,90),64,32;ifi_baudrate:(5,90),96,32;ifi_ipackets:(5,90),128,32;ifi_ierrors:(5,90),160,32;ifi_opackets:(5,90),192,32;ifi_oerrors:(5,90),224,32;ifi_collisions:(5,90),256,32;ifi_ibytes:(5,90),288,32;ifi_obytes:(5,90),320,32;ifi_imcasts:(5,90),352,32;ifi_omcasts:(5,90),384,32;ifi_iqdrops:(5,90),416,32;ifi_noproto:(5,90),448,32;ifi_lastchange:(10,1),480,64;;if_data_t:t(38,24)=(38,23)if_msghdr:T(38,25)=s84ifm_msglen:(5,88),0,16;ifm_version:(5,87),16,8;ifm_type:(5,87),24,8;ifm_addrs:(0,1),32,32;ifm_flags:(0,1),64,32;ifm_index:(5,88),96,16;ifm_data:(38,23),128,544;;if_msghdr_t:t(38,26)=(38,25)ifa_msghdr:T(38,27)=s20ifam_msglen:(5,88),0,16;ifam_version:(5,87),16,8;ifam_type:(5,87),24,8;ifam_addrs:(0,1),32,32;ifam_flags:(0,1),64,32;ifam_index:(5,88),96,16;ifam_metric:(0,1),128,32;;ifa_msghdr_t:t(38,28)=(38,27)/usr/include/string.h/usr/include/kstat.h/usr/include/sys/kstat.hkid_t:t(41,1)=(0,1)kstat:T(41,2)=s152ks_crtime:(10,9),0,64;ks_next:(41,3)=*(41,2),64,32;ks_kid:(41,1),96,32;ks_module:(41,4)=ar(0,0);0;30;(0,2),128,248;ks_resv:(5,3),376,8;ks_instance:(0,1),384,32;ks_name:(41,4),416,248;ks_type:(5,3),664,8;ks_class:(41,4),672,248;ks_flags:(5,3),920,8;ks_data:(3,2),928,32;ks_ndata:(5,89),960,32;ks_data_size:(1,1),992,32;ks_snaptime:(10,9),1024,64;ks_update:(41,5)=*(41,6)=f(0,1),1088,32;ks_private:(3,2),1120,32;ks_snapshot:(41,7)=*(41,8)=f(0,1),1152,32;ks_lock:(3,2),1184,32;;kstat_t:t(41,9)=(41,2)kstat_named:T(41,10)=s48name:(41,4),0,248;data_type:(5,3),248,8;value:(41,11)=u16c:(38,16),0,128;i32:(8,3),0,32;ui32:(8,7),0,32;i64:(8,4),0,64;ui64:(8,8),0,64;l:(8,3),0,32;ul:(8,7),0,32;ll:(8,4),0,64;ull:(8,8),0,64;f:(0,12),0,32;d:(0,13),0,64;;,256,128;;kstat_named_t:t(41,12)=(41,10)kstat_intr:T(41,13)=s20intrs:(41,14)=ar(0,0);0;4;(5,5),0,160;;kstat_intr_t:t(41,15)=(41,13)kstat_io:T(41,16)=s80nread:(5,2),0,64;nwritten:(5,2),64,64;reads:(5,5),128,32;writes:(5,5),160,32;wtime:(10,9),192,64;wlentime:(10,9),256,64;wlastupdate:(10,9),320,64;rtime:(10,9),384,64;rlentime:(10,9),448,64;rlastupdate:(10,9),512,64;wcnt:(5,5),576,32;rcnt:(5,5),608,32;;kstat_io_t:t(41,17)=(41,16)kstat_timer:T(41,18)=s80name:(41,4),0,248;resv:(5,3),248,8;num_events:(5,2),256,64;elapsed_time:(10,9),320,64;min_time:(10,9),384,64;max_time:(10,9),448,64;start_time:(10,9),512,64;stop_time:(10,9),576,64;;kstat_timer_t:t(41,19)=(41,18)kstat_ctl:T(40,1)=s12kc_chain_id:(41,1),0,32;kc_chain:(40,2)=*(41,9),32,32;kc_kd:(0,1),64,32;;kstat_ctl_t:t(40,3)=(40,1)IFdata:t(0,20)=(0,21)=s64rbytes:(0,3),0,32;ipackets:(0,3),32,32;obytes:(0,3),64,32;opackets:(0,3),96,32;rbytes64:(0,6),128,64;ipackets64:(0,6),192,64;obytes64:(0,6),256,64;opackets64:(0,6),320,64;ierrors:(0,3),384,32;oerrors:(0,3),416,32;collisions:(0,3),448,32;nocanput:(0,3),480,32;;IFinfo:t(0,22)=(0,23)=s160name:(0,24)=ar(0,0);0;31;(0,2),0,256;curr:(0,20),256,512;prev:(0,20),768,512;;IFnumb:G(0,1)interval:G(0,1)Usage:F(0,1)cmdname:p(5,8)main:F(0,1)argc:p(0,1)argv:p(20,2)c:(0,1)i:(0,1)n:(0,1)iters:(0,1)counter:(0,1)kc:(0,25)=*(40,3)ifinfoptr:(0,26)=*(0,27)=xsifinfo_t:iptr:(0,28)=*(0,29)=xsifinfo_v:fromtime:(27,2)totime:(27,2)last:(0,30)=*(0,31)=xsifdata:now:(0,30)idssize:(1,1)cmdname:(5,8)names:(5,8)IFcopy:F(0,1)i:(0,1)IFupdate:F(0,1)kc:p(0,25)i:(0,1)ksp:(40,2)knp:(0,32)=*(41,12)IFprint:F(0,1)i:(0,1)in:(0,13)pin:(0,13)out:(0,13)pout:(0,13)in64:(0,13)pin64:(0,13)out64:(0,13)pout64:(0,13)pbanner:F(0,1)banner:V(5,8)IFnames:F(0,1)numifs:(0,1)numifcs:(0,1)s:(0,1)n:(0,1)ifr:(38,15)ifrp:(38,22)ifc:(38,20)bufsize:(1,1)buf:(5,8)collected:(0,1)IFlist:G(0,33)=ar(0,0);0;511;(0,22)Oflag:G(0,1)T:G(5,78)Delta:G(5,78)libgcc2.c/ext1/SOURCES/gcc-2.8.1/./libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hmachmode.hgansidecl.hmachmode.defmachine_mode:T(11,1)=eVOIDmode:0,QImode:1,HImode:2,PSImode:3,SImode:4,PDImode:5,DImode:6,TImode:7,OImode:8,QFmode:9,HFmode:10,TQFmode:11,SFmode:12,DFmode:13,XFmode:14,TFmode:15,QCmode:16,HCmode:17,SCmode:18,DCmode:19,XCmode:20,TCmode:21,CQImode:22,CHImode:23,CSImode:24,CDImode:25,CTImode:26,COImode:27,BLKmode:28,CCmode:29,CCXmode:30,CC_NOOVmode:31,CCX_NOOVmode:32,CCFPmode:33,CCFPEmode:34,MAX_MACHINE_MODE:35,;mode_class:T(11,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;defaults.hinclude/stddef.hptrdiff_t:t(15,1)=(0,1)size_t:t(15,2)=(0,4)wchar_t:t(15,3)=(0,3)wint_t:t(15,4)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;__floatdidf:F(0,26)u:P(0,23)frame.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)  hh  o `-LL0 7||\  A&G66M66S77s[,>,n>>t>>{>>>>@@Ax@JIFMVOl$ O'< vw;x~070701000077b7000081ed000000000000000000000001362757df0009e238000000200000001d00000000000000000000001a00000000root/etc/STATsrv/bin/perlELF 4 4 (44  /usr/lib/ld.so.1@"k:1w8"4)$Umg$..NF H6*I kV,='}k]?53i'XZlY+  `hF]DiM;* z6p(h!bF~o!MYlWOa^<#Lj qX-LR,|%,h'0GqlKv3oR(0"-&I`?krt.2F3E)$.ZBO8#b  xW055rCq^yy;&<|C=*9e[(Ra}9f[ /4A}6J&E7e:|6jxNPXD?5ZAfTydSv  Sc'\P`l %@2qH];[9B{mj==IuN.bg| -R&0K_^&Hv_.IVO8jE~; UI%){K$)PV*r->T3=emTM7g/?l<>g1C_~#7YVM\uid"',N-,=+9^W81J%/7 a5~s!9>%*( 7!CvDB<tP 0%btu+us4Uhzv\/K*GM#SRi]Cg>!f[r_?(N7wL>E<,H/OV/  6 "ADnp8xdc5`<q;T}+Bw{' 1S\;E U$p$s:Yhy d~obJedjO[}{XnL:3QL]wJ1Q 0 GiyuQ)!4>:frcW@#`m22oB1Aaw9\4D)Hf|{  XZc#Fzn_2n+s&6x3tpT@Z@x8sPeGntQcSo4k^Qa"m@2 J?GWYU-Kp:  + A(zz+     $ (   0    v w( h8(t8 F w,X _ w0jPw|t w4 w8 Ll< p w<dP\\L 08  w@" wD3hDS 8[TTjC|x +<D wHh  , X 'p$' wL/x> C JfW wMd pp wPxGHT wT wXll w\dH w] | P 0 5 FT w^\xiw И2  w_ w``xd'eX\B# `.D= wdH whP wlX de q wpu wt wxT w| w @ HF<x  $4 B K wS<0_ eވlqRx w  | wL w  8   x&#(P3 @ wN|t\b4li 4qÌ<  Lh  x x x\  x t\*=SxP8]n gC| x   x/P $ x P ˠpKzd x'7 @!< <E0 Wc ,m” n/>D( a  l   LQ4  x  ! 1 x 9  HxX U  ^ $ k z@  8 H  8 G  x  yH 6l   H | H , 9Od F yL L yP YdH h ` w  }   ޠ U! yT  TD $  8 yX x  5 " y  *' < I W3t d  n { }  { $8 <( { , ` {  h {  { | " #x\ 4  A N  \\ i4x { |  <  | Th  D   >$   X< <h -T : J  P` ^  d s#t  XX |  1 ?,   < Ɣ | | @ 4L* `1pADN[08k lp |zrl` $ |lD  _h(L  h v '(x7 KC] | t(<  n# @(= $z Xl'h< 4E v'O^lH8h |$p |({LY ^8fDPv LAd `8(HȐ  8  d)45 :(4K0Y$g lnR ||kll  O47 tXL \$B H I X%fD2 ; C U `=o m Xt  4ed  ,0 { & ,h; CO \ i|      ܄ P`Y,`L':t5L8D P Y ^8mɀyP |  `lq\ PPhHl$ $) ; D~8U@e0q `y  T \|R | xh< 0 UTi %6 $M (W drdh 2Hopx  ,  <  \ 0 ͘L(H4P<$A <Nh_ @g&lxxtt cdxd DPH H X L h, 5D$\P<a(<t Py|   t0 P   T (44'6zD XN<^ eH\u } h \V` `3Pj 8$  \P* / 8 0?Md[,h o  @ < d4Hx0*|: hx @  -D<< D@Pap(\S40 l p@ t x0 |   `   ) 5  C S8 b  p \ }g @ X   8 Vp  hp  l! !!9!( !8!Eh!Vl!d}H!q!ɴh!4!h! !.!l!e@! !" """+C"? p"K"W "_ "oxx"~$" "`"~L" "(L" L"x" #T$#0#%-\4#2 #;H#L #R l#^Q0#m#yEd#[# # # D# @# # # # Բ$# 4#\|$@$($) $2 $: $Dj$R $W$f $k h$x $Ѭ$ L$@$ $ ,$ $ $ $l$Hh% 4@,% %$ %1Q%? $%M%[ (%k ,%s%ɨ%X %p%0,%iP%Ϙ% t%P% h% 0& @& & @&Ѩ&- 4&;4 &M-(d&[Nx&h&v`|&$&P& & && 8& (&@&|H&`'5'4tL'! <'/0'8 '>d'R|'`wT'{<0''!L'80'Pp' @'T ' 'Ӱ,' D( (((,D(@ H(Jt(\L(d (u9 (D(l(Ր(|(Ф ( H(?( L( 4( P)|) ) ) T), x)2)?)O X)[,)l)zl) 59) \) `))Ll) d)P))* H*- *.р *=P*M d*T9`*_(*q* 8* h* l*\* * 0* !* p*** d@+!D4+ t+ ,+jx +, x+2 +@f8<+M |+Ur<+b+n+~D+,+ + + + + + + + +R<+,x$,! <,/x,? ,Hh,V`,g* ,s ,,8h, , 8,, , T, , L, X4, ,O-l (-%\-( \-3-Bh-O -^ -d%T-q -zԼ-'-- - -4- - - -$-\..0."p.3 @.<:.L .S܌0.a d.mI.|ܐt. $@.\ .s.. .Dx.<@.h.Մ / / /p/*0/7/D"p/V@/j D/x(h/ / /\p/Dp/ / /PH/ // 0 p04 0% 802Hx0@?0R 0Z 0_0n 0{ 0`0 0 0 00 0t0P0D01 (T1 1 1+1@]x1P 1W 1^T1np`1} 1 1|1Ӭ1k(1 \1 $1r`1 L1l1b( 2 2 (2- ,25 x2;b`2NP2` v2g 022 2 2w(2 222 2 02 (3 43 83 23'yd@35 `3<43Izl3V3d 3u d3{3H333;@3 3 3 %B384 <4x4!41 F4? ,4I 4P -4] @4ptl4 X4yt4 D4P4tX4 H44 45 5 5l5-h 5>,|5J5[H5kX5{5d5 L545|5 P5 T5 `5 X6 d|6 6 \6)67$ 6D \6I `6R 6Y 6` d6kl6w6 h60@60|6L66 l6 p6667+$ |7 t7 x7*7> |7Cd L7Q 7Z *+7k $7} p78h7<78 7 7 7x77Ōd78t8 8 y !8'89G048H8Q 8e8s 8 8 8@88X88 D 8 8d(88th9 9 9!f9/¬\9: 9A 9Sh<9c 9s9xx9<D9 $9t99#x09 99C999:x<:T:,:8 x:> :G :Z T:`<:lB :wD:t,: :v : :u0|: `:: :: ; ; \;;;#;1 ;5 P;=4 ;Nl ;] ,;d ;l ;z;0; ; ; ;;P;P ; ;D<(< <|<' H<-`|<6^@ < < <!8<CP=L= =d=*=70 =HL,h=W|l=fo$=q ,\=|= l= = = = = L"= =h= <= > > > >* >78 >=L>LT>W >g,t>{ 0> >> <> >ut> >@>> >> T? ?sP?!Tx?- ?3A?@h ?N ?Z$?k\?z@? D? ??ќ ? ? ? ? ? ? (@ t@ @)Lp@=L@H @_\`@o?@ |@ @ @ @l@ 8@P(@u@\@'@ H@ݼAhAALA)L A: $AC (AJ APAb<AptA dA\HAA A ,A 0A`PA 4AhA A 8B <BEBn0@B* @B; DBH hBT B`{BnPdB| HB (B Perl_last_lopPerl_oopsCVPerl_pp_i_eqPerl_pp_ftrexecPerl_yysindexPerl_reglastparensocketlocalizingPerl_pp_gvsvPerl_pmtransPerl_pp_fttextPerl_lex_stuffscreamfirstPerl_pp_gtPerl_pp_nextPerl_pp_gvampergvPerl_scalarPerl_scan_numPerl_do_transPerl_pp_i_geno_wrongrefPerl_SvPerl_multi_startPerl_pp_sserventPerl_pp_dividechopsetPerl_die_wherePerl_pp_untie_startPerl_pp_leavesubPerl_mg_setPerl_thisexprPerl_pp_left_shiftPerl_sawparensPerl_no_modifysigemptysetPerl_newAVPerl_av_fillPerl_pp_lengthPerl_linklistPerl_newSVminus_pPerl_pp_padanyreadgmtimePerl_pp_seekPerl_nomemokgetpeernamedebnamePerl_sv_upgradePerl_pop_scopePerl_pp_concatstatusvaluepadPerl_localizeminus_aPerl_ck_globPerl_pp_ftatimeminus_catofatoiPerl_listkidsPerl_pp_getloginPerl_magic_existspackatolPerl_pp_gsockoptPerl_pp_printminus_lPerl_pp_joinPerl_pp_ftttyPerl_newGVOPPerl_pp_postincPerl_do_aexecsemgetminus_nPerl_taintingPerl_newLOOPEXPerl_sv_unrefPerl_pp_substrPerl_pp_eofPerl_ck_execPerl_pp_bit_xorPerl_pp_lslicecxstack_ixPerl_do_ipcctllastspbasedumplvlPerl_anPerl_oopsHVPerl_pp_recvorsPerl_lex_defernice_chunk_sizePerl_sv_reftypePerl_pp_intPerl_newXSPerl_last_unisignalstackfreadPerl_yydgotoPerl_pp_redoPerl_filter_readgconvertPerl_vtbl_amagicelemPerl_pp_definedPerl_pp_rv2svgetpwuidminus_FPerl_gp_refrmdirPerl_pp_andPerl_pp_enterwritePerl_sv_insertstrchopgetprotobynameboot_DynaLoaderPerl_hv_magicdelaymagicPerl_ck_funPerl_regsizePerl_sv_2mortalPerl_vtbl_arylenPerl_pp_gotosetpriorityPerl_ck_subrPerl_cshnamePerl_tokenbufPerl_scan_hexPerl_pp_sendtoupperPerl_pp_refgen_environperl_get_cv_endPerl_pp_aassignendprotoentPerl_rsfp_filterspadix_floorPerl_pp_multiplymemmovePerl_sv_isaPerl_pp_getsocknamePerl_lex_dojoinPerl_op_descPerl_magic_setpackPerl_pp_leavewritePerl_pp_i_nePerl_newASSIGNOPPerl_no_helemPerl_regnparPerl_simpleshmctlPerl_regendpPerl_pregcompsv_rootgetpidforkPerl_pp_execPerl_newUNOPPerl_op_freePerl_do_semopXS_DynaLoader_dl_install_xsubwarnhookPerl_pp_dbstate_iobmaxsysfdPerl_magic_setenvperl_get_avPerl_foldPerl_pp_grepstartPerl_warn_nlPerl_pp_umaskPerl_ck_lfunPerl_rninstrPerl_magic_setmgloblaststype_ex_registerreaddirPerl_vtbl_globPerl_pp_unshiftpreambledPerl_pp_ftrwritePerl_pp_ftctimecxstackPerl_AMG_namesPerl_pp_rand__flsbufPerl_yytablePerl_save_hashPerl_pp_chompPerl_newANONSUBPerl_ck_repeatPerl_pp_i_lePerl_pp_dbmclosestatcache_GLOBAL_OFFSET_TABLE_orslenPerl_pp_diePerl_utilizesetregidPerl_pp_ftpipePerl_do_msgsndPerl_newSVOPPerl_pp_pushfdpidPerl_regxendPerl_pp_renamePerl_ck_deletesleeppipePerl_pp_ftrreadPerl_pp_subtractPerl_no_funcPerl_oldoldbufptrPerl_newAVREFsigactionPerl_pp_i_ltPerl_statbufPerl_pp_eserventPerl_magic_setsigPerl_pp_uc__ctypePerl_pp_grepwhilePerl_sv_freePerl_ck_matchPerl_pp_globgetnetentPerl_curinterpsetpwentPerl_pp_acceptPerl_pp_epwentPerl_pp_forkPerl_profiledataPerl_pp_ftereadperl_get_hvlastscreamPerl_pp_snetentPerl_gidscreamnextPerl_euidPerl_pp_hexPerl_dowantarrayPerl_pp_flopPerl_sv_getsgethostbynamePerl_av_makePerl_pp_eprotoentmain_cvPerl_gv_initPerl_magic_getuvarPerl_vtbl_posfirstgvPerl_pp_ftisPerl_pp_stubmaxscreamPerl_pp_moduloPerl_pp_valuesPerl_hexdigitPerl_magic_setglobPerl_pp_gserventPerl_refkidsPerl_pp_sassignfseekPerl_hv_undefmkdirPerl_newCONDOPPerl_gv_fetchmethodPerl_maxoPerl_cxincforkprocessPerl_pp_ordPerl_pp_existsgeteuidsignalPerl_pp_eachPerl_pp_getpriorityPerl_regprecompErrorPerl_pp_tieacceptPerl_do_shmioatexitPerl_av_unshiftPerl_pp_tiedPerl_newFORMPerl_pp_sprintfexitpidstatusPerl_pp_sockpairtelldirPerl_yyerrflagPerl_sv_isobjectrandstrerrorPerl_cpytillPerl_gv_stashsvPerl_sv_newrefsetnetentPerl_pp_ggrgidPerl_pp_bindalarmperl_destructPerl_ck_svconstPerl_ck_lengthconstPerl_sv_clean_allPerl_amagic_generationPerl_pop_returnPerl_pp_callerPerl_gv_fetchfilePerl_regkindPerl_newRVPerl_save_deletePerl_magic_setdblinePerl_Gv_AMupdatePerl_pp_listenPerl_curcopperl_call_pvPerl_newOPPerl_magic_setsubstrgetloginno_myglobPerl_save_aptrPerl_messPerl_dsPerl_stackPerl_pp_methodPerl_ck_concatPerl_magic_setamagicPerl_pp_atan2Perl_regcodelogPerl_gv_checkPerl_cv_undefPerl_ck_spairPerl_magic_gettaintPerl_pp_iterPerl_ck_ftstdirtytolowerlockfrestartopPerl_pp_alarmPerl_pp_regcmaybePerl_dcPerl_yydefredPerl_push_returnmallocPerl_bufbasetimePerl_pp_dumpDBsinglePerl_pp_padavPerl_pp_complementfchownPerl_diPerl_pp_leavePerl_pp_shmgeteval_startPerl_magic_wipepacksprintfPerl_save_sptrPerl_pp_scopePerl_pp_msgrcvPerl_pp_gnbyaddrPerl_pp_exitPerl_pp_enetentsemctlPerl_pp_sselectPerl_ck_requirePerl_evalseqcddirPerl_leave_scopeperl_destruct_leveleval_rootsymlinkPerl_sv_2cvPerl_pp_utimePerl_xiv_rootpowPerl_pp_flipsocketpairperl_constructPerl_newSVREFPerl_av_undefPerl_start_subparsee_tmpnamePerl_pp_enteriterPerl_hv_deletePerl_pp_chownPerl_naopendirPerl_sub_generationsendPerl_patleavePerl_scopestackPerl_mg_findPerl_pp_indreadincgvPerl_pp_anonlistPerl_do_openPerl_timesbufPerl_pp_deletebindPerl_myPerl_pp_setpgrpPerl_padixPerl_pp_ltPerl_sv_clean_objsPerl_op_seqmaxPerl_pp_gmtimePerl_pp_spwentPerl_magic_setbmPerl_pp_resetPerl_prepend_elemPerl_vtbl_vec_initendnetentPerl_sv_clearPerl_pad_svofmtPerl_pp_leavetryPerl_pp_chdirPerl_calllistfwritePerl_pregexecPerl_ibcmpPerl_savestack_ixPerl_vtbl_uvarPerl_pp_padhvregcppushPerl_pp_lcPerl_vtbl_taintPerl_pp_lemodfPerl_pp_ftsvtxPerl_amagic_callPerl_hoistmustsetsockoptPerl_pp_tellsetgrentPerl_opPerl_retstack_maxPerl_sv_noPerl_pp_filenogetprotobynumberPerl_yyparsedupPerl_pp_postdecumasksv_countPerl_sv_unmagicPerl_fbm_instrPerl_pp_study.umulPerl_ck_selectPerl_freqPerl_save_svrefPerl_repeatcpyendserventfputsPerl_pp_ftsizeh_errnoPerl_pp_xorPerl_nextvalPerl_linestrPerl_pp_i_multiplyPerl_savestack_filbuf.mul.uremPerl_pp_timePerl_pp_predecPerl_pp_wantarraylastfdPerl_regstartpPerl_pp_gpbynumberPerl_hv_itervalPerl_pp_prtfPerl_listPerl_pp_nePerl_pp_aelemPerl_pp_egrentPerl_regboldebdelimtimePerl_pp_ftlinkPerl_pp_tmsPerl_pp_gpwuidPerl_hv_storePerl_pp_i_modulo.remPerl_do_kvPerl_pp_ssockoptPerl_warngetserventPerl_pp_popPerl_pp_ftblkPerl_pp_i_negateformfeedPerl_sv_2ioPerl_pp_posPerl_lex_casemodsrunlevelPerl_pp_shutdownPerl_bind_matchPerl_pp_powsetpgrpgetpwentsetegidPerl_oldbufptrPerl_magic_setPerl_pp_reverseftellmystack_spPerl_pp_orPerl_pp_ncmpPerl_compilingtoptargetPerl_lex_endPerl_sv_setsvPerl_scalarvoidPerl_pp_ftrownedPerl_max_intro_pendingsortstackPerl_ck_evalPerl_cv_clonePerl_pp_waitPerl_pp_ghbynamePerl_pp_chrPerl_pp_socketPerl_hv_fetchPerl_mg_freegetuidparsehooksiglongjmpPerl_newSTATEOPPerl_pp_shmreadPerl_ppaddrPerl_sv_yesPerl_av_storePerl_pp_logPerl_sv_growPerl_sublinePerl_pp_shostentin_evalPerl_pp_entertryPerl_pp_connectPerl_pp_gnetentPerl_vertPerl_fbm_compilePerl_pp_mapwhileXS_DynaLoader_dl_find_symbolPerl_lex_casestackPerl_av_fetchlinearyPerl_av_extendleftgvPerl_jmaybevsprintfPerl_pp_semgetPerl_pp_octPerl_newNULLLISTPerl_magic_setuvarsqrtPerl_sv_newmortalPerl_av_shiftPerl_pp_right_shiftungetcqsortPerl_magic_getarylenPerl_xrv_rootPerl_vtbl_dblinePerl_pp_chrootgetpwnamsawiPerl_gv_stashpvPerl_do_vopPerl_pp_ftsgidPerl_sv_setpvmainstackPerl_pp_waitpidfclosePerl_pp_bit_and___ArgvgetenvPerl_pp_srefgenPerl_pp_sgtPerl_last_lop_opPerl_sv_2ivPerl_instroldlastpmPerl_pp_cryptyydestructgetservbynamePerl_pp_ftbinaryPerl_block_startPerl_pp_scalardup2_sysconfmsgrcvPerl_ck_shiftPerl_gv_HVaddperl_call_svkillpgPerl_do_readlinesyscallwaitmystack_basePerl_pp_systemPerl_pp_enterevalPerl_filter_delPerl_do_printPerl_pp_closeDBsignalPerl_ck_listiobselectPerl_pp_seekdirmktempPerl_watchaddrPerl_sv_catpvnwaitpidPerl_pp_sinPerl_pp_ftewritePerl_save_itemPerl_pp_bit_orPerl_sv_setnvPerl_pp_ucfirstPerl_stack_spPerl_lex_brackstackPerl_pp_seqPerl_xiv_arenarootPerl_origenvironPerl_pp_mkdirDBtracestrncpyPerl_sv_blessgethostbyaddrPerl_sv_incPerl_nexttypePerl_pp_regcompPerl_pp_sgrentPerl_xpv_rootPerl_op_namePerl_pp_truncatePerl_sv_setref_pvPerl_my_unexectaintedPerl_gv_fullnamePerl_pp_unpack_DYNAMICPerl_hv_clearorigfilenamePerl_pp_sgerenameperl_allocPerl_pp_aslicePerl_pp_lineseqPerl_pp_sqrtPerl_pp_orassignPerl_pp_padsvPerl_sv_chopPerl_sv_mortalcopyPerl_pp_schopPerl_save_longPerl_pp_getpeernamePerl_sv_undefPerl_pp_rindexPerl_pp_pushrePerl_yywarnPerl_vtbl_isaPerl_pp_ftsockdowarnPerl_pp_slePerl_save_I32Perl_sv_free_arenasPerl_sv_decPerl_pp_cosstrncmpPerl_lex_startsPerl_my_pclosePerl_io_closePerl_comppad_namePerl_moreswitchesPerl_mg_magicalPerl_XpvPerl_looks_like_numbergetsockoptPerl_mg_copyPerl_vtbl_bmPerl_sv_setref_nvPerl_my_lstatPerl_my_statgetgrentPerl_hv_iterinitchdirgetpriorityPerl_deprecatePerl_pp_sltPerl_pp_anonhashPerl_sv_2nvPerl_do_chopperl_parseprintf__iobexeclchownPerl_scopestack_ixPerl_yycheckPerl_newANONHASHPerl_ck_rvconstPerl_pp_anoncodePerl_pp_getpgrpcurstashstdingvsetlocalePerl_pp_ioctlDBgvPerl_newLOOPOPArgvPerl_sig_numPerl_no_securityPerl_av_clearexecvPerl_hv_iterkeypreambleavgetprotoenterrgvPerl_vtbl_packPerl_vtbl_packelemPerl_magic_getPerl_pp_andassignPerl_pp_warnmain_rootPerl_subnamePerl_sv_setivPerl_lex_replPerl_pp_srandPerl_stack_basebeginavPerl_packagePerl_newLISTOPPerl_ck_rfunPerl_pp_negatePerl_ck_gvconstPerl_screaminstrPerl_pp_rangestrcatPerl_do_chompcryptPerl_lex_inwhatno_symrefioctlstatnamePerl_pp_msgsndPerl_regparsePerl_sv_setref_ivPerl_pp_indexPerl_pp_getcPerl_pp_ftchrPerl_newSUBperl_freePerl_magic_clearenvgetgrnamwritereallocPerl_cshlenstrrchrPerl_magic_getposXS_DynaLoader_dl_errorPerl_ninstrPerl_pp_lcfirstPerl_do_execfreePerl_xnv_rootPerl_refatan2Perl_magic_nextpackPerl_nextargvXS_DynaLoader_dl_load_filePerl_invertPerl_do_vecsetPerl_ck_splitPerl_he_delayfreePerl_pp_constPerl_lex_inpatPerl_pp_localtimePerl_av_lenPerl_av_pushPerl_osnamesendtoPerl_ck_grepPerl_newRANGEPerl_savestack_growsortstashPerl_pp_stringifysave_ivPerl_pp_fteownedPerl_gv_efullnamePerl_pp_snePerl_save_freeopPerl_pp_ghostentPerl_pad_resetPerl_pp_shmctlgetppidPerl_pp_hslicemystrksplitstrdoswitchesPerl_sv_lenfdopensbrkPerl_lex_state_exitPerl_pp_scmpPerl_do_sprintfPerl_regeolPerl_hv_iternextPerl_pp_transPerl_scopePerl_warn_reservedsv_objcountPerl_hintsPerl_save_pptrPerl_save_freepvmultilinePerl_magic_setarylenPerl_sighandlerPerl_pp_ftzeroPerl_stack_growPerl_pp_entersubPerl_pp_msggetPerl_scalarkidsfchmodPerl_applyPerl_pp_rewinddirPerl_assertrefexpPerl_bufptrPerl_regnaughtyPerl_pp_gpwent_ex_deregisterPerl_expectenvironbodytargetPerl_pp_preincPerl_pp_killPerl_yylenPerl_do_pipesawvecsrandPerl_pp_fcntlerrnoPerl_vtbl_sigPerl_yyerroroldnamePerl_regnextPerl_pp_refPerl_pp_requirePerl_pp_dbmopenPerl_pp_telldirmain_startsetserventPerl_YesunlinkPerl_yydebuggetnetbyname__cg89_usedendavPerl_lex_startPerl_pad_allocPerl_sv_setref_pvnPerl_newGVREFPerl_pp_getppidgetgrgidPerl_newLOGOPPerl_save_scalarPerl_pp_vecPerl_vtbl_amagicPerl_pp_expPerl_pp_open__cg92_usedstrchrPerl_pp_i_ncmporigargvgetpgrpgetegidtop_envPerl_newANONLISTPerl_vtbl_envPerl_sv_backoffPerl_savepvnPerl_do_eofsethostentperl_call_argvPerl_newPMOPPerl_stack_maxlstatPerl_keyworddefoutgvPerl_pp_semopPerl_do_seekPerl_newSVpvutime__fnonstd_usedperl_eval_svPerl_yylexPerl_multi_endPerl_pp_formlinePerl_pp_chmodfreePerl_save_clearsvPerl_pp_i_addPerl_pp_pushmarkshutdownPerl_pp_pipe_opmsggetPerl_dounwindgetsocknamePerl_do_msgrcvPerl_pp_gprotoentPerl_yylhsPerl_pp_lstatPerl_my_setenvPerl_pp_repeatclosePerl_pp_ehostentPerl_gp_freePerl_pp_helemPerl_pp_ghbyaddrdlevelmystack_maxPerl_pp_schompPerl_he_freePerl_do_joinPerl_pp_leaveevalPerl_sv_report_usedPerl_newHVREFPerl_ck_truncorigargcPerl_regsawbackPerl_pp_sysopenPerl_newSVnvclosedirPerl_regprevPerl_force_listPerl_variesPerl_pp_shmwritecurstnamePerl_vtbl_svPerl_pp_gpwnamPerl_ck_sortPerl_mg_clearPerl_sv_add_arenasortcopopenPerl_block_endPerl_watchokregflagsPerl_newFOROPPerl_vtbl_envelemPerl_reall_srchlensetreuidPerl_scrgvPerl_pp_av2arylenPerl_pp_shiftPerl_append_elemPerl_pp_ftsuidPerl_peepdoextractPerl_bufendPerl_save_destructorPerl_pp_sysreadstrcmpofslenPerl_sv_replacePerl_pp_returnPerl_markstack_ptrDBsubPerl_mg_lenPerl_pp_semctlPerl_savepvPerl_opargsargvoutgvPerl_taint_nottmps_floorPerl_newSVivPerl_pp_syswritePerl_magic_clearpackPerl_comppadpadnamedlsymperl_init_i18nl14nPerl_magic_setpos_edata_PROCEDURE_LINKAGE_TABLE_Perl_pp_i_subtractfopenftruncatePerl_filter_addPerl_ck_formlinePerl_pp_nextstatePerl_av_popmemsetPerl_regdummyPerl_no_sock_funcdefgvPerl_uidPerl_yyrindexPerl_wait4piddlopenPerl_do_execPerl_pidgonePerl_sv_magicPerl_pp_gsbynamefcntlPerl_append_listPerl_pp_link__fsr_init_valuePerl_pp_prototypePerl_newGVgenPerl_gen_constant_listgetgroupsPerl_no_aelemPerl_pp_rmdirPerl_siggvPerl_magic_lenPerl_pp_syscallPerl_yygindexPerl_rsfpexecvpPerl_no_usymPerl_lex_fakebrackPerl_save_freesvstrcpyXS_DynaLoader_dl_undef_symbolsPerl_nexttokeregcppopPerl_pp_setprioritygensymPerl_pp_unlinkPerl_sig_namePerl_pp_ggrentPerl_NoPerl_newBINOPPerl_pp_enterloopPerl_pp_gpbynamePerl_ck_eofPerl_pp_i_dividePerl_pp_symlinkPerl_newWHILEOPPerl_save_aryPerl_push_scopepad_reset_pendingPerl_hv_iternextsvPerl_free_tmpsPerl_markstack_maxIlocalpatchesPerl_vtbl_mglobPerl_envgvPerl_pp_enter_etextnice_chunkPerl_sv_reset_lib_versionkilltmps_max__dtoufflushPerl_in_myPerl_runopsPerl_newPVOPCmdPerl_sv_pvn_forcePerl_pp_substPerl_ck_indexPerl_pp_fteexecnrspreprocessPerl_pp_substcontPerl_ck_nullPerl_my_exitPerl_gv_fetchpvrightgvPerl_multi_closelockf_emulate_flocke_fpPerl_pp_matchsecondgvPerl_no_dir_funcPerl_vtbl_isaelemmemcmpPerl_pp_rv2cvPerl_pad_leavemyPerl_pp_quotemetachrootlast_in_gvPerl_sv_setpvnPerl_magic_setvecPerl_pp_blessPerl_pp_gelemPerl_pp_open_dirpatchlevel_ctypePerl_pp_cond_exprPerl_pp_spliceperl_runPerl_scopestack_maxPerl_save_intPerl_yylvalendpwentgetgidPerl_pad_allocmyPerl_pp_sortPerl_newSVsvPerl_newCVREFPerl_he_rootPerl_pp_readlinePerl_pp_ftfilePerl_pp_sprotoentdefstashPerl_error_countPerl_sv_2boolPerl_newHVDBlinePerl_gv_fetchmethPerl_newSLICEOPPerl_pp_ftmtimemainPerl_newPROGPerl_pp_readlinkmsgsndPerl_setenv_getixPerl_pp_nullPerl_do_closetmps_stackPerl_pp_rv2avPerl_ingroupPerl_pp_notPerl_newIOPerl_magic_getpackPerl_pp_leaveloopPerl_pp_add.udivreadlinkPerl_lex_formbrackdlmaxperl_get_svPerl_candoPerl_convertPerl_taint_envPerl_curpaddl_add_underscorePerl_yycharPerl_my_bcopy.divPerl_pp_chopPerl_warn_nosemiPerl_sv_dump__filbufchmodcoplinePerl_provide_refPerl_pp_ftdirofsop_maskPerl_pp_rcatlinePerl_pp_ggrnammemcpyinplacePerl_retstackPerl_pad_freePerl_pp_backticklastsizestrlenPerl_savestack_maxPerl_pp_rv2gvPerl_pp_mapstartPerl_pp_readPerl_oopsAVPerl_pp_undefPerl_newSVrvargvgvPerl_dump_mstatsshmatPerl_modPerl_pregfreePerl_whichsigPerl_pp_dofilemsgctlPerl_save_listlinkunsafesigsetjmpsawstudyPerl_pp_rv2hvsv_arenarootlocaltime__environ_lockrsPerl_pp_keysstatPerl_rcsidPerl_pp_absPerl_do_ipcgetperl_require_pvshmgetPerl_gv_AVaddPerl_pp_lastPerl_pp_gsbyportPerl_setdefoutPerl_sv_usepvnPerl_croakPerl_checkPerl_ck_retargetdlerrordo_undumpPerl_multi_openendhostentperldbPerl_regarglensawampersandPerl_sv_catsvseteuidPerl_lex_bracketsPerl_origalenpausePerl_vtbl_substrgetnetbyaddr_finiPerl_pp_selectPerl_sv_eqPerl_lex_expectPerl_markstack_growseekdirrecvfromPerl_pmruntimesemopsinPerl_pp_packPerl_pad_findmyPerl_fold_constantsPerl_pad_swipetruncatePerl_av_fakeshmdtPerl_reginputPerl_taint_properPerl_sv_cmpcurpmPerl_pp_listPerl_pp_splitPerl_compcvPerl_pp_closedirPerl_save_hptrPerl_magic_getglobgetservbyportstatgvperl_call_methodPerl_pp_msgctlgethostentdiehookPerl_lex_opwarn_uninitPerl_vtbl_sigelemlistensetprotoentPerl_min_intro_pendingPerl_magic_settaintPerl_pp_gePerl_comppad_name_fillPerl_pp_readdirPerl_pp_binmodefstatdebstashfprintfdebugPerl_save_nogvPerl_pp_i_gtPerl_pp_sleepPerl_my_popenPerl_hv_existsPerl_do_telltmps_ixPerl_diePerl_pp_statPerl_pp_unstackPerl_pp_eqPerl_pp_gnbynamefilemodedbargstimesPerl_magic_setisaPerl_sv_catpvPerl_pp_aelemfastcxstack_maxPerl_magicnamePerl_mg_getisattyPerl_egidPerl_cop_seqmaxPerl_sv_2pvPerl_regtillPerl_scalarseqcosPerl_markstackformtargetPerl_pmflagPerl_pp_flockPerl_retstack_ixPerl_yynerrslaststatvalPerl_no_memPerl_scan_octPerl_gv_IOaddPerl_yyvalendgrentconnectlibsocket.so.1libnsl.so.1libdl.so.1libm.so.1libc.so.1 c   y `5 l: xG        F a A z  2  , 8 D P \C hd t   X  D S  0 , q   E  ( 4 @~ L X$ d p] |W  n  J     q -   ? $ 0 < H T ` l x E \         "  2 @ ,l 8_ Df PO \ h tT    G  0      !   ? (  43 @ L X d pK |  ,  a     $     $= 0 <z H> T ` l x % r  H H     |     , 8m D P  \ hE t  x     Y    p     (> 4[ @y Lo X d[ p} | "      w   e     $ 0s < H T `  l x @Di"`̥, @'i$+`-` `?-)i -/  % +` `?`5+i`Ȩ %@# @@#@@@@㿠"@P J  s@3&`@7saܔ @@@@@p@l@h bb`@y  c@@@@@㿘 q"#1 Ā M@ P& Ē @( 7 !1@"! @` 5    @> & !0@`1!8!0  !8@)!8&!8",@` "`l`l"@@`"@@ @ "`@"`@rs " s`("(s"0 F;``@di @"`T@"aL@"`@1㿠 }"#@1 T57LH@3@1c\ "c\1# " c\ (  "`@rx#&#c\   @,*`0 T `@N"`LH@ @1 &( c ""0@ c` "L"`@`L?L @"c`?" c` @" "  "  @R  2  "@ @d  c@    D   8        4;8'D'H'L'P'T##'/' " ' `#""i #x$ #L`@"a*?@ ##`LP@T'#c@qT#"#c@    t!# "cT "##`@##T'! @u`0 '`@躔 @ '@3Z@ L# 'LP'P 'PLuP#`J-n J`i `'#||J`' #`" &#`* @* `@  c( "X 8*` " " "@ "@, #@ 㿠@  ` ` 㿠@ `  ` `` ` `@  ` ` ` ` 㿠@n `  ` `` ` `@  ` ` ` ` 㿠@K `  ` `` @漣  @{ @_ @D  ` ` 㿠7!l &`P @,#(':  ` : !"` #ܐ":  ` :  6`@+{ ` @b @8 '` `"!l@㿠 @,㿈5l`  "`#ܐ" :  ` :    @+M @4 @ &@&ll" &l@ ;8'D'H!l#tt' `` '@+~@-#LcH"L@.4 "  @#t#@<` @<t  @+'t `'t"D"`c'H#pp`2'ؐ @/'  `#ll/p "pl /p c@줔 L #`$ %$' ` ` '||@<'||@+'@-$cLH##L`@*!#d%`#``'t"#` 'x@*'pp"`p'x#`*` *` 'l #%l)#($=  `=`l%lcX" a8#<  `<`l$l+c% l!@% l"l+`l##hh@$ %l$$l% (l-X%`,l`" 0%X h#a@Hh!@`h "@#`  @ `" #@ْ   S "  P؀  "$I"cT "LcH @*#@ܔ LcT@ #T#dd`4d 4"d"4* ( t `H  'h?H'ht`'dt# a"3H`@"` `"@* ( t`# :  ; 'hH#`` "H` 2 H#`  @H "EH#\\cЀ 8#`'\"`"#`*` * @ '` `+#c('X`'$X` - -8/%`\"c`"@`'T `'P `'$@`'L` -@)%XT@)"!#@4 LH "h* ( t `'h#LH @* @)h;8'D'H!l#tL#p#H#lt'#c($<` @<` '@)@+pl`p"@,C "  @#t#@<` @<t  @)'t `'t"D"`c'H#hh`2'ܐ @/'  `#dd/h d /c@궔 L#@ꋒ    "   ܀ ; "W4"cT`@K^"` `"@|* ( t`# :  ; 'H#`` R` N#`  @ D "pl` @)N#@[ LcT@( 3#T#\\`4\ 4"\"4* ( t `H   ''t`'t# a"#@' LH`"* ( t `'p l @)@(㿠@@᠒`@. @* 㿠 @   ` `@㌕ 㿠 IN EN :N :"@Ӓ : `p    `p   @ `p ` `&@@ސ@`N 2N`p    `p   @ `p ` `@ @z㿠  h@阒 @镐  @钐  @鏐!( @錐!l @鉐! @醐! @郐"< @逐" @}" @z#, @w#x @t#!@q !@n T!@k !@h !@e!4!@b!`!@_!!@\!!@Y"!@V"8!@S"| h X X X X X X X X h h X X X X X X X X X X X X X X X X X X X X X $ X X X X X X X X X $ X X h X X X X X X X X X X X X X X X X X X X X X X X X X X X X X < X X X X X X X X X X X X X X X X X X  X X X X X X t 㿘N }c wّ*  @ 3@:`l!&`l    @Ւ &`l @/&`l *c@ "c4@脐  *c\  *c]@> Բ N` :" N` =  <!b@R@b`@*`耢  @"`@Ɛ  !N 2  N 2 N _ N 3` @`@6 &``J `"Q*J  a 2I*J J "<*@ِ! N 7N Na 2 N N " `p    `p   @`p ` `&@@ՐN " @!  *#^3cp  "N @}cpN  a @Đ!4&cp"aHN `0  `@cp*` l  "ll    !8@ &cp "Hl   l  "aHl  &cpaH@طl&cp@F!<@C!@ N a#@!DN - !L  @饒 &`aN 2N 2 N _"N :2NN =@`& J mN !P@(Nal@~`&@`ap@u`@q`a@m`@$1#`2#@&&##@`!@N   5*c_  0*cL@̐!  (*cP  #*c`  *`  *`Ԑ  *aN  -2  J p  !@ƒ !"@`!aА"@Ȓ!#@Ē!#0@a!#Da@ٔ!#P@洒!#l@氒!#@欒@敐  #* @捐 n3㿠@@潓 㿠@K!51&&#@ɒ "c @ \  ` @`"@@ "@@ @ "`@` "`  &@r``"`,` @ : @@"`p`p``0 `*`0 @ * "`4` @ $ @"cc``0 `*`0&#"  @   `$`(` `" @   ` `@o 㿐.`>` `o @: / j""@@ ,"d"@@"M``L`#!X#% !<7"`@ :J ` `" J@ /"@@4@@&M`   !@j    @@c    2M`@АM` Đ` @" @k" 8@  !O a  ? @֐i"`N` ` @`" N``N`  2`N` `?i"` ` ",@!$!@!7X"` "`D@! i"0`  `"@壒`H_"c,J p J"4" L@唐  "#`X @C 0"#``@< 0@ޒ 4@ޏ3N`  d t  "`d  d@e x#`#\ <"`d T@ |@.`"c,O  @ސ"!"c,"!@"c,#, @ #xX` `` ``@``8㿠 "@N ? Ĕ 5@^,2N@Ɛ`N #2.N N !2*N `$@ݐ "$N  @,`,@.  5 55P " N @P 6N `4@PN 㿠@5@&83@&`1@&#",8`"  8`@2 #,@  *J#`:@ *#`㿠#d!! $#?@G @ ` `"((``( ? *`( @6 "c ? @0 "`? @* @"` ? @"  ` `"@ @ѹ@? @  ` `"| @ѭ| @   ` `"h @ѡh $#㿠@*!$ ( (?"X (``( *`( @] ( (   "c(c("lc(!"c@T!"a8 a8"a8a@I"P"`l"c" @@""`"` @@8"`"`"a@ " v"dd`*` @(*`"`"@""c`"`"cH"``㿠!##,$b@] b$#,#l@ "c 㿠#@# @  !` `@  @y $##``0 *`0#`` ``"`  @f  `0 *`0#`` `&  `"  ` `"  ` " @K  `0 *`0 ` ``"`  ` ``@O{"`$` @5  `0 *`0c`` `&  `"  ` `"  ` " @  `0 *`0 ` ``"`  ` ` ``"`$ @  `0 *`0` `&  `"  ` `"    @ܫ""c@@`("cD㿠& J#P <` :`J -5`J  0`J  - =' '`@ ` * `` @  ` `@ڗ ' `  @  ' ` `@I  ``J -"`#@^ ! $! @͔!  @! @S ! $#p@͉#p @#p#p"a< *a @ " `  ` `@Wa`` `  @o `@ <` @e "  ` `c@;` А` @U <&    0 ``* 0@          @  ` `@ `         @  ` ` @`@@' ` 4 ` @ 1T& X X  0 ``* 0 X     X   @n X ` `@ii `" ` E" @ X $ =@% =" *  @> $  e@۸$ @,  2 X@ E *!` @  @ ` `@L㿠1N#` "@!""@!#  4 lN#`  (;8'D#llcX#h#dd##`h ,7`@ᮔ LD `D@'@#u @y`   "f D c "D#` '`'#`#`P@ >!l("@ :  :`# o %@  `' ''@y' "D L@T``h"h 3`,!#,D @r @l @ `cD"cT "#\\#`\c##LH @ #@ L`"X#X3`,!#T`#,D @א @Ґ!#T 4`!"@̒aL#H@ $D@D L@``h"h 3`,`@ϒ D `6)D L@`㿠 ?" 2 2   2  ".@ 2@2J#M 2 "!@a &@ ..㿠".  .@ɐ #  @Ð$     " .@&@೑.@ ? .@  ' .@' & "" " `"`a @`(⠈ "? 㿠  &   @2   i @+&  `*  " @ 6" @Z  @@ b ` ` @2``  @?㿠   " @!4    @ ` "`㿠   " @!L    @^ ` "`㿠   " @!`    @  ` "`"Pa@pP @T  ` `@.N /!|@ !@y ` 0 ``* 0 耢  ` `` `  `| ` `@O L㿠@       0 @F 0@H  "`   ` @ؽ"` ` "`cX,  2(cX`   ", * ` "`@Θ " ,@  "`$ "`(  0 ``* 0㿠` !` 1` =          A ` `        ` `        ` `㿠  d@!@    `` "  V    `   `h *   2   "   " ! @Ȗ I a E`   `?`` `  7`@ J! %   ,@!`" @ΐ@̐    ` "`  `h" % 2`#!@? `i`" @ۧ@ۥ    ` "`  `h"  㿠N` N :"N '2N 2N"8&NN :"&!Đ@. ##X   @ ,@a@֮ ` ` "`d`  d@@ْ .@Ӓ .& { ` ,@ݪ  t &"@גà k ! @   a " N`    W N` @.a  @.I  a C    `= ` @ߩ ,@a@C     "`d   d@Ί @) "@@`"@@`@`"@  " ` ,@#! K"!@e B"!@_ ="!@X 7" d . ` ``(` @I ,@b@ @ߔ` 4  @| J#`  ` t 4  @ !0Ȑ,@7$",a@/ܒ,@ 2  ` ``2`@`` "``  ` , @Ȑ`"`,㿠     "`d  ʁ d@đp``ppp`pp````pp```p``p`````````p`<`p pp<pppp`pppp` ``` h``` ````` 8``` ```````pp,p` @ @`````````````````````````p`p㿠N  *   2 NN  a 2 N ! :`&M` '2M`M`  M` :2vM` :2r2  %@ $KM`@ @, , @5,  4 0      0 ``* 0      2 @r ` "` , 2 M`@Ò"`,M` :``M`  b   @  `M` 2~M`%@ 퀤N a 2 NN _ N "YNN I$#NN SY"!@ۙ "!@ۓ "K ""@ی "D "" @ۅ >;  E$NN I5""@u .+  A$NN E%""@e   A""@Y ""$@S     _N " u X @l# j#`$f` c` ``]`Z  ` "",@N N@2 A a "@  ` `` 6``  ` `0``  `  ` `0`  ` ` ( ` `0`@"` `  @ % $"(@        "H@  X  "h@ `" c c    @Ȗ a     ``    0 ``* 0a " @ɒ NN" a, }v*  ""0@r l             ` `  WJ``* WM J  0 ``* 0C""8@;  ;  0 ``* 04""@@3 -         ` `  0 I ` `* 0@ӝ ""D@  ?` @  @ `,@ @֒ `4@ @̒ `@@ @’ `L@ @ ""X@ΐ         А ` `  0 ``* 0  A@8 ""d@٪ 3&`<`<  0 ``* 0`<    `<   `< ` ` S@_`<@]!$##``( *`( @# @ #w t"#< *`4 j"!L *`* `" t *`  V   @c8 J!   ` `X@ >       `@ "    @ҷ * ' `t @Х    "`܀  `x @З     @ç  @Ј 㿠` ,##@t ,@# @ѓ ` $ (@э㿠`  " ,#$#(@N ,@ې#,@m  $ (@g㿠@ @N  &   & #0 H  ` `"@@`"@@ @ "`@ "`㿠  `   [ !   "L  " J :2 "   `"` , "  @",А (J  "" 0 2  (cX2,  ,cX"  0 2   , $@|#@2  ` @$ 㿠  H" H#"bh@ڔ  `" 㿠 2  `-` @L#t`  &``&`@Z`@X`@V`@T```    @H @F` i " 㾠 c@%'D   ` `  h`@D    * > #  @D`` c` ` @``:&` c@iD  !'@"D`  `"D '  h' '!\ @R@ S  O E   "a "= a J 04 a  / a  "- a J 02$ %  @ "    2    !    B#    @Ґ "   '    ' 9!31 e @@: \ X  1 "0 / "/23  "`d  d@ D ' ` `    @'##        D@?  "D    ,#@'  "@@ `@ @ "`@$ `:  c @2D  D @ "  D *@ "   | $ d | $ d P #`    #l #h#h (  %  c  @  `#dh-  ``  . ? `   ,x> aF">Z 8, -"$Q 8=9" J    #l   #`!0?ں    #l Ю  #`!0?ɺ  Ů                @[ @ "  `"@@`"@@`@`"@ " #pp  "#p  䀥  9 ~ @ @~p L ! 2 X @ ! `" J 0J   E      J 0 8  6  @@ "  ` +@ @  ``bHD    @  "ז  @  ``@ "H Đ 9      @o @  2o [ `  ` c  @\   ` . Q   d   ?1 ` -  ) 6$7"45?&"P`  *`@@  "#` #` # - 2       ?" "   $3h `2 ," -"l 3 `  3@ ! 8! 3"`al @m '' B@/@ 1& @&al #ܐ":  ` :  @$`$`` `$` !!0 $` ha* ` @S @)$`&@|&al& @@al  " &al ` n&"`X*`@@ @   @© H  F  @   <2 @˜82  @   @Œ2 +  @   @     @   @o`? @   @b@ !0 f@8  2 @$   "@@ "@@ @ "`@   8       ,` P`  T` l`  `     ,#\ #\ha*   <"@)bx`` 6 @# hH=h!,` h  `!+!* `!* #h`Ķ ``耢 " "#hb@@E @q MT CTaJ 2TTJ _7TJ J 2J 2 J _"J :J 2J#hJ a T" @,T &@@%"#h㿘  @ "* `x   ^`x J {/ / ^/`x @//@Ң "  ' "* :`!$@h Ha`a\@at㿘@ @ @ @@ @ !@ #T@#@@#07#X@ ,@#h@ @ @!T@ @y!p@v!D!\@, "cT"#t "c0!" " @q x$!pn #3$aD@8!p@6aD" aD* " "!c4 5@ϙc4&c4$ @ϒ$ &$ "#@"#0&``  "`@Զ`@&``   `  '`  @``"` " J ;"`` (@ԑ`@&`a @ʢ`` !` 7"``  "#h"`"aT```#h "`@= !@ $ &,㿠3c,!@2 c,c, c, *`  &c, " &c,c,"&c,@ьc,&c,㿠 #X`,#X`2 ,N #{ O " O  " O O " ""@ё    O a YO  " O  O 2 O " O 2 O  O O " O "  @I "N*O  a  2 NN "N& .cX"` !cX"` @5." X2,㿠 ` #``@`N "N `L "L " #X!`97:`L  "``L  2`:`L #2``:`L " ``L 2`*` ;c, #T @Oc,Q3Nc_  J#L a@11N#L !!@$a@ɱ.#L.c_ ``"ch"`"aT ``   @"`J p  !@ @uc,'c,c,!@ !̒ `*!'c,@Ac,'c,"ch""Tch@ &` 耢 "_`#@"Z`@ɶ @ @Ü      @`,G`㿠#| aT@? aJ "    &  J 2  !N` 2`N` 2 `N` _"`N` -`N`@ (ch N`.`!@> .`㿠" X ,\ 6\X ,2\2\"#0"#h "c(2!\ D "N!) (!J `(!!)`Dစ( `D `DcT cT t0 cT㿘|J  ` @ `J `_ J `:  AJ `'=c@7 @- aaKJ `( "c0"#0 ) (@q  @] `Dక*" `D*`@ `` @*`㿠 -N )@P  @] `D*`"@ s!` `$. ғ `@ ͓ `% ȓ  œ 㿘   G #     '   @0  ?1 @@  J` \   K \2   K \2 K  @ :K K  \" K *  *K *` `""`㿠 !""!!  !@ 3@A @> @; @@8 @5!@2#T@ސ#@@,#0!##X@' ,@#h@ @!T@ʐ @!p@!D#4%""#4  "!T" "#h" ``  " @/" " " @펐 x$ap틐 $D@Wap@UD#$` D* "! "cT#F#X2`,"#0 "#@!"c@ "c0 ( "`"!!!#4@\ "`$#4!㿠5 &"#0!@.  @\~ "`!3`  "cT@p1#$ ?c0 "#$c0 !7#$"`"#@`  "!T" "#h" `  " @` " " " @&`!D* &#$    "cT &&#$ "cT&#$ ,@ b ``"   @""#0 )((((((((0tL㿐#@#` @ΐ& ```  !#0 !"(",:q-#0! \9    !;"*L   %#\   !`@:    !@    \ " M M < -  $-4 -2L  @:L `"|L   xL L (2"L ` "L L  ?2L L  #2L :eL L )"aL L - YL )2L TL #2!L ` "L ` 8"L  :DL L "@L L -  7L 2L 2L @2L L  "L L   2-L   2-L  _""@̕L  2-L $2L `  : L "#@̃L  "-L \ :L M  @sM "  - M- 2$ ` 2  M  " M 0" M  2 J!  $M"0@M $, {- !"MM " M"#@9M "Mk-" -a K*   !2MM -RM- M@ -D  @ -:   J -M  "MM@< -M @-' -" - -  -  -  -   - L - * 2 -   %"`  %    ``@    "`   b` "`#h   @Z"`@㼠 "N   -2N N  >2 N N  [N  {2N   {N [ #@ 2N   {3 J a 2J  " JJ 2J ,Ja " JJ 2J }   O` ]EO` ^A @6 ]   @'!O` $2O`? a @O` ]" ?O` @O` ]@?@!O` O` - $ & @ - @ \"KO`@N * @* &O`  'O`  !O` _O` $2N O` "N "#@O` "N "#@O` "&& N N @3 @ʢ   r  "& &dN & N H "#$@ʧO` dN O' 6O" 3"#,@ʗO` (N O`  "O` (O`  `O`  O`  2`oN lN jN gN eN aN d]N O` \"2@Z#8 "#@@SO` HN EN 8 5 `_2 "@;#H , O`  & O` " O`   O`  " *`O`*``O``  2O`*`"@@(g 2& N &N ` @ .    㻘N  $ ` "`` 2 ``   "`    "  @2O N `$#a\`Jc ` @ `"ch "0J `(!! @( J b   ` ``  "  `` 2  ` ``쉒 'p@ˣ  @W `Dక*"  @`D!*`@ `*` "0"#hN (!! 㿠 耢  "@d#L""L"l㿠 @`i"` 5 `@,&`2@²  : @  2@"p" (i    "`d  d@+"@~h @ @^㿠i "@~U` `   `     (@Y`@X@@"́㿠  c# i !  $E @~"'`` `  :`@` `  1@#, #, ? `"` 1@#, 2 `#, ?   .   2 " @}Ւ  2? (   "`d  d@x `,@}㿠  "  r    @Ƨ  8d 4 Dh$ (lt pH,PLHHIILLLLLM8N MN8NPNhNNQ,OQwO RRSP PQROSTQUUTUHTT<VXYHVVZ|YYZ<Z\ZX`VWYVWpX[[\4ZZ[<[p\p]pbDbbd```ba0`aH_^]^x^___<_\_|ahaaab,b\\\\LbcXccdd(d@ddee|ffggefg@gfhXhhhhi i$i<iidijkj,l$kk<nn nPm ml<lhlmnhppnoPqs`t`txtvuhvXs vsHqrqvputHswpxTxzHxxyy(y@z(yyyXypyzyz`zxz{{{4{L{d{|L|d||},|}}D}~,~<$(@Xphh40Ht`0G|G|+?l.,X!P>@L8<<$>,>,>,>,>,>,>,>,>,>, ,#X-<$7BBBBBBBBBBBBBBBBBBBBBBBBBBA XB@BBBBBBBBBBBBBBBBBBBBBBBB,BB%"8#Tc8 5 Q*  D`" "DD*  "D 2D#tT"`"0 "#tDa*  ; ch @ J  E !D"#X @_   "#\@X  "L`L`/ / "#`@8L`  L@3`  U@.`  7 "`" `*  )7 $ `` "@&` &L``*`*  &T5D* `&@Q (L` l wD* %&@L` u vD* &@L` L yD* &@L` U xD*  &@L` Q zD* &@@z#t 'ch"!a  "a @" "0& y! 2 " "aDJaD*   @"#T@ť    &  cT"` )  @  &  cT"`5 h@2 k1�hJ @  "` T"` ! D`* $@ ,#+ $ D* $@ $ D* $@ ( D * $@!! ` "!h @"�&h! #h "F cT"` #h !T`& !&`!x#\M` ~*  M @zjtM #,   "&@7~&   *M"#|"#(!@ J`   ` "9M``,J `#2 MJ `!2M@uŒ 2-`M ="#@ڔ  @Z``  &`& `  ``` ' -`M` 2`&&`&  耢 "`!c@"`@ @M @`cX    cX@`,`  ``` ' #X , * :MM  "M M  2M :M :2!@ M #M !@uC` @u=``J#] `(@u1 z`0#@u) r`J` "#p @:*`J`  2*`` @J`  "`*` `: M  "  M  2 0!# .* #`#l*`@ % :-M  2- M  "-l# # * @͐`pp##ll@ "`8@x`n #hJ#_#tJ#L#xM` "M`M`  2M``M` M`  "`M` 2M``M` "`M` -B`ڿ "ں#| 耢 h HJ#_ J#L 't #x H@ ``  &`& `  ``` ' * |`耢 "@M!;M` "6M``@40M& cT"` # *`@     "`@\ ` `   `@@1 @H @`   6`@`'`J#_ J#L 9@1 J#^ @) J#\ )J#  4J /4J ' 4J ""ct@³4"cd@­4@ @ @    " "!T    `` "` 耢 "M!c@"M@, @d @ cX    cX@`,MM#T !@ #, -" oM   M   M 2 *א` "TM``@4NM& cT"`M hMa "bMM a 2ZMM a 2RMM _"NM&J  "M "M "  "M "M ""#@2  J! !L@wm!   z "0& -`"c| 2!\& A#X9*€!/"  "c0& "` "c0!/& "` "c0!/& "` "c0!/& "` "c0!/& "` "c0!/& "` "c0!/& "` "c0!/& "` "c0!/~& "` "c0!/u& "` "c0!/l& "` "c0!/c& "` "c0!/Z& "` "c0!/Q& "` "c0!/H& "` "c0!/?& "` "c0!/6& "` "c0!/-& "` "c0!/$& "` "c0!/& "` "c0!/&!"` "c0!/ &!"` "c0!/&!"` "c0!/&| ה  "` "c0!/& ʔ  "` "c0!/& 佔  "` "c0!/&@uȒMN`@#0 X ,\ 6\X ,2\2\##0&!8 ##0&!6N` >21ﻐJ  ` @ `!!J `_!J `$ "0&!9#X`,\@ 6\#X`,2\2\"c0&!9   &!9#0   >"` �! O&N`a  aJ  ] �& -MN`@#0 X ,\ 6\X ,2\2\##0&!7 ##0&!51#0   <"` �!  &N`a  aJ   �& +1#0 ( #@(  *�J#  �& *X ,\ 6\X ,2\2\�& *J *  4"` �!4& 5"` �!&9#0 # @( N `v'#0#\ %.?J d /??@ؒ :  #v@t @Kp ! D*`$@ @< D*`@`"` !X ,` 6`X ,6`6`'#0& %@ : '@=" @KC `Dక*" !`D*`@ `"` X ,` 6`X ,6`6`'#0& %KN?X ,` 6`X ,6`6`'#0& % '#0& % 9"` '#0!& Z"` "c0"#h!-, `" M "0 "chM :' "0"ch : c(@  c|@ "c0& &`& (X ,\  X ,2\M"0"chMJ `{ "0&#X`,\@ 6\#X`,2\2\"c0&1 @1n  " & #T  N` [N` {N` - N` > cT"`X ,\ 6\X ,2\2\"#0"#h ]N &  "c0!,e&3c0 .J! ! YN  a  Y   @ Y!#X ,#X" 2`,@s!#X ,#X 2`, Y"` &c0!.4& @'@`Jc` &2&c0("`X ,\ 6\X ,2\2\&c0& & &c0& &J |  "c0"#h!+ ["` "c0"#h!-L =  L"` "c0&! > ~ "c0& ,  "` "c0&!1J!  J   "#@ @sX#0 D  ?    $ J 4!@ '#, # 9"M 8#@  @ʒ  (M*MM  *`M `@L L 2 J``J` J` "`J` "%J` #m% "c0 !p#0` d$`` 5   "`@' `  ,  #(  "`  &`&!"#( @2 `` '`  * '` *@ &`&!$  : L " L 2   :  L " L "  :L`L  a "D`#Ȑ@%   :JJ ` "J ` 2J : JJ "J "J }2 `J! #@KȀ ^ ༒@rE!  R ` '`  *&` '` *@ &`#( @2 `` '`  * '` *@뭐J `} &`&!$`J  ` @ `  :. !J 2 J 2J _2  *J J `'"  J `"   @L  " :JJ a "J! J 2J , L a   J =2 `J >2` &`&!$  &` `  *?&`#X ,"`L a ?L #2&?#2c\& {"  "c0&!*J =  N"` "c0&! ~  ^"` "c0&!1 "c0& !1#0 ,M <" M@ > 2MM <@(&@)ϐX ,\ 6\X ,2\2\�"#hJ <  B"` �"#h聐!0 = DJ >  P"` �"#h! H"` �"#h!"` �"#h!J > C"` "c0"#hP!0 =  J"` "c0"#h! F"` "c0"#h!M #cMa "#@sM W @$6`1#0``  ``@ � ,! Jc` �&!!@C :  @*c@9N#"� @Fג `Dక*" !`D*`@ `"` y�&!!�Jc&!! #0# @#` ``  (``@( y'  ,˒N` "` N` [" N` @K! @I^  "``*`#X`,\@ 6\#X ,2\2\' &! $.J! "' L [2EL`"BL!J 2J 2J 2 J _"J $2JJ ,2L&` :L ]"  `L ]2 $ 0@oL {2F' "@c 2?' @w }"9' @r ="4'  J! ` @`" J!J 2Ja J _2' Ȑ @"Ŕ J `(" ' ̱ "' \@o' #T uL a m #( 2  _!\ Z"#@L  S' "#@L La  L _2L >' L a  4' L . La " &' "#@L  La  ' L <L <L a  ' ' J d !@ :  #v@n @ET ! D*`$@ @6l D*`@`"` !|&@ : r`#( @ L [ @.L { %.@7QN` < N $8 N` b4 N` a0 !@  `   `@  J` "#̐@l   "#А@e  2 t@n ` N " @D `Dక*" !`D*`@ `"`  &N&N& $ @+ᜐ ' & $# 3@!`50`2N !ْN  @.?&0J d "1??@ :  #v@mŒ @D ! D*`$@ @5 D*`@`"` 3!X ,\ 6\X ,2\2\&0"#h @@̒ : 4+ N { %.?@6ϐ$ @DX `Dక*" !`D*`@ `"` X ,\ 6\X ,2\2\&0"#h @#T ' " D "N?`@2   ` ``2` `` "c@C@*J! FN [N {>N "!N!N  2N  2N _" "#@FN "NN 2NN }"N ]!#h$#h#h#h&@ &@ "#h@m#hN?X ,\ 6\X ,2\2\"#0"#h @` @*" &0"#h @3c0 "M@"#X`,\@ 6\#X`,2\2\&c00"ch /  7"` &c0"#h䓐! &c0"#h 1`@1M 1   %J 1" 8"c0#0 " MM a )MN` J  "`"  �"#h!#0  @f @"` �"#h;! @'1#0`"$FX ,\ 6\X ,2\2\�"#h!@%1#0``  ``@ � ,` 䂐  "`X ,\ 6\X ,2\2\�z&@%0``   ``@  "0 ,  O  "`4   4  '4  @4Ȁ J` $ AJ` @ AJ` \ Ȑ" 'Ȓ` 2J` A"`X ,\ 6\X ,2\2\"#0"#h@%O1#0`"<㓒`   @("`X ,\ 6\X ,2\2\�"#hJ! #0 1N` a 1N`"H@kN`1#0  "pW �"#h!3M  0  ;"` "0!%& #Ȕ @&J !`: J `: #@p` @` M "M #` #J "J "#  @E  @`31cX ,#\ 6#\cX ,6#\6#\J! `#Ȃ hc@kh #@+  @D{  @"``*`cX`,#\@ 6#\cX ,6#\6#\"#0"#h! @#0 " M :M :"  ٗ "  `0`   @ @%``*`@@J# L #X# ,#@` #X      @##@ϒ  @D "`#X`,\@ 6\#X ,2\2\"#0&!;c, "f9!@ "O O  D2]9O  D c c    ,#@G`  +  `0  *`0  ``  ` ``2  ` "`     c," c, & @ J p " c,  |   * V'c,  -    * V 'c,  <   * V'c,9#, J p  !@ 2#,@l-#,'#,#,! ` *` '#,@#,'#,!@ 0#`J#_ J#L (#dJ#L !\@ `@    " "!T    `` "`d(cL`*#_M ``&`& @m & ;#0  M :M :@6 @ Ȫ6 @  @ k"` "c0"#h "c| k2a\M ( !㈐J `(!!/!$"` "c0"#h "c|!$2a\M ( !kJ `(!!/  䖔I "c0!'C& ` 䊔= ݒ 䄔7 "` "c0"#h "c| 2a\M ( !6J `(!!/  a $"` "c0"#h "c| $2a\M ( !J `(!!/ "c0!&# Д !"` "c0"#h "c|!2a\M ( !J `(!!/ "` "c0"#h "c| 2a\M ( !ΐJ `(!!/!"` "c0"#h "c|!2a\M ( !ⱐJ `(!!/ X"` "c0!& "` "c0"#h "c| 2a\M ( !⋐J `(!!/ u 㶔i J! 4!:!JM a M (2J!: JJ 2J ("J 0 !J a !@%ʐㄐ! x! r% ޒ l t"` "c0"#h "c| t2a\M ( !J `(!!/ b"` "c0"#h "c| b2a\M ( !J `(!!/!"` "c0"#h "c|!2a\M ( !J `(!!/ڐJ `{ "0&!"J `'"  !  J  "c0&!"#`a"#`   ("` "c0"#h "c| (2a\M ( !ᡐJ `(!!/ "` "c0"#h "c| 2a\M ( !ᄐJ `(!!/㰒 H  Œ ⫔^ "` "c0"#h "c| 2a\M ( !]J `(!!/!  Ҙ  " "0!2& "c0!,&#X! ,"` "c0!& V"` "c0!& "` "c0"#h "c| 2a\M ( !J `(!!/ "` "c0"#h "c| 2a\M ( !J `(!!/J `{  "c0!3"&`"|J `( !J `(!!/ "` "c0"#h "c| 2a\M ( !ྐJ `(!!/ e"` "c0"#h "c| e2a\M ( !ࡐJ `(!!/ "` "c0"#h "c| 2a\M ( !J `(!!/@#! ᭔`!G"`"#0!X&!H"`"#0!P&!J"`"#0!H&!I"`"#0!@&!O"`"#0!8&!T"`"#0!0& #X ,"`:MM a "M!M 2M a M _ @eĐ "c0&! r B!"`"#0!& ؒ 4 "` "c0"#h "c| 2a\M ( !J `(!!/ ڒ İ S"` "c0!& U"` "c0!&M (   !  8  " "0!&!#"` "c0"#h "c|!#2a\M ( !ߗJ `(!!/ "` "c0"#h "c| 2a\M ( !zJ `(!!/!"`"#0!V&!"` "c0"#h "c|!2a\M ( !UJ `(!!/! 3!="` "c0"#h "c|!=2a\M ( !2J `(!!/!> ]!?"`"#0!&!M"`"#0!&!K"`"#0! &!L"`"#0! & "` "c0"#h "c| 2a\M ( !J `(!!/!7"` "c0"#h "c|!72a\M ( !ҐJ `(!!/!8  !9"`"#0! &!:"` "c0"#h "c|!:2a\M ( !ާJ `(!!/!; Ҕ !<"`"#0! }&!@ Ĕ w!A ߾ q!B"`"#0! i& "` "c0"#h "c| 2a\M ( !hJ `(!!/  ߓ F!R"`"#0! >&!P"`"#0! 6&!Q"`"#0! .&!U"`"#0! &&@!I  k  i"` "c0"#h "c| i2a\M ( !J `(!!/#X! ,"` "c0 & o =  h"` "c0"#h "c| h2a\M ( !J `(!!/ ْ  Ͱ   ǰ "` "c0"#h "c| 2a\M ( !ƐJ `(!!/!  !  5  " "0! & y"` "c0"#h "c| y2a\M ( !ݔJ `(!!/ w"` "c0"#h "c| w2a\M ( !wJ `(!!/"  "c0!# S& l"` "c0"#h "c| l2a\M ( !RJ `(!!/ R"` "c0! -& T"` "c0! $&!""` "c0"#h "c|!"2a\M ( !#J `(!!/ f"` "c0"#h "c| f2a\M ( !J `(!!/!  1  ߒ + ް "` "c0"#h "c| 2a\M ( !ݐJ `(!!/@r#X`,\@ 6\#X`,2\2\"c0&   !   !+  !*  !- ۔ !, Ք  *`d"`"c0!# ~&!    " "0! o& W"` "c0! f&1#0 @ !   "` �&! "c0!( L&^J  ` @ `J `_2* !N` 2 `N` 2`N` _`N`9#`,@IJ   &@ @b  ^ "` "c0!& & s"` "c0"#h "c| s2a\M ( !J `(!!/ j"` "c0"#h "c| j2a\M ( !J `(!!/!  Ȱ#4@ Β   #@@ ͒   "` "c0"#h "c| 2a\M ( !۱J `(!!/  ܔ  "` "c0"#h "c| 2a\M ( !ێJ `(!!/ +"` "c0"#h "c| +2a\M ( !qJ `(!!/  ܜ O!    "0! C&  ܊ =@ ٛ  "`X ,\ 6\X ,2\2\"#0ݒ& z"` "c0"#h "c| z2a\M ( !J `(!!/@a u )!#4 @: #`D*`$ !e$#4c , `@/  @: `D*`$ V!T ( "`X ,\ 6\X ,2\2\ "c0"#h "c( 2a\!@e A  A"`c4  'c4 " X ,\ 6\X ,2\2\"#0&@?   @"`X ,\ 6\X ,2\2\"#0& "` "c0!) n&!   1.#N# ` @ `N#`_" J `< !1@P!1#v !1"` "c0"#h "c|!12a\N` ( !MJ `(!!/ "` "c0"#h "c| 2a\M ( !0J `(!!/!  ۥ  " "0! &!  L c"` "c0"#h "c| c2a\M ( !J `(!!/!"` "c0"#h "c|!2a\M ( !J `(!!/ p   ʒ !"` "c0"#h "c|!2a\M ( !ٸJ `(!!/@ "` "c0"#h "c| 2a\M ( !ٙJ `(!!/@ "` "c0"#h "c| 2a\M ( !zJ `(!!/!"` "c0"#h "c|!2a\M ( !]J `(!!/ Ӓ ڈ;  ڂ5! "` "c0"#h "c|! 2a\M ( !4J `(!!/ "` "c0"#h "c| 2a\M ( !J `(!!/@``#X`,\@ 6\#X`,2\2\"c0T&&  &"` "c0"#h "c| &2a\M ( !ސJ `(!!/ "` "c0"#h "c| 2a\M ( !J `(!!/ Ȓ  ֒ !/ !. ڔ!0 Ԕ Ғ Δ! Ȕ{! ”u!C"`"#0!m&!D"`"#0!e&!F"`"#0!]&!E"`"#0!U&!N"`"#0!M&!S"`"#0!E&! ٌ?  ن9 "` "c0"#h "c| 2a\M ( !8J `(!!/!' c!& ]!( W !) Q  K a"` "c0"#h "c| a2a\M ( !J `(!!/!%"` "c0"#h "c|!%2a\M ( !J `(!!/ ے   ܒ #d@ŐJ `;J `) @]t  "c0! 5     ߔ q ٔ  Ӕ g"` "c0"#h "c| g2a\M ( !ׅJ `(!!/ d"` "c0"#h "c| d2a\M ( !hJ `(!!/ "` "c0"#h "c| 2a\M ( !KJ `(!!/J Ւ`*  *"` "c0"#h "c| *2a\M ( !*J `(!!/ m UJ  ` @ `J `_ J `' J `:  "c0@# +`D "0@@ @@  : @@# !# @cc䐔 @# # @@Ȑ!  \ `D2N`ѐJ `= ``" "0&! (61@U !1#4 @>#4@\! D $ D# 1"`a"a  @6*#4"`!$a D`2 #T"ct#0"`")#    #   "`d#   J `d@# J ?@"# &!  "c0&! @x! ךM!  הG!V ׎A ϒ ׈; В ׂ5 ђ |/@%#X`,\@ 6\#X`,2\2\"c0،& "` "c0"#h "c| 2a\M ( !J `(!!/!"` "c0"#h "c|!2a\M ( !J `(!!/ ’ 'ڰ "` "c0"#h "c| 2a\M ( !ِJ `(!!/! "`"#0!&!!"`"#0!& ג  x"` "c0"#h "c| x2a\M ( !զJ `(!!/ v"` "c0"#h "c| v2a\M ( !ՉJ `(!!/ "` "c0"#h "c| 2a\M ( !lJ `(!!/#X! ,"` "c0E&#X! ,"` "c0:&! ց4 )"` "c0"#h "c| )2a\M ( !3J `(!!/  ^! X  J! 4 :!JM a M (2J!: JJ 2J ("J 0  J a  @l "` "c0"#h "c| 2a\M ( !ҐJ `(!!/  1#0 @R!  :  "�&! "` "c0"#h "c| 2a\M ( !ԛJ `(!!/ *ct n Ôv#X! ,"` "c0k&#`a"#`  ծa!"`"#0!Y&! ՠS "`"#0!K&! *  "` "c0"#h "c| 2a\M ( !EJ `(!!/0   ;"` "0!&#h#0!T`@2` " J * M ' <M :2 M :2 #ȖȒ@  Ȭ`2 "@Y *Ma " MM 2M :7@X#"`#X`,\@ #X ,2\\2\&`!     `@!#X ,#X" 2`,@Z1!#X ,#X 2`,"ќ#\#  #cX`,@ cX ,66@֒  @3& ! @$ ; *aT`[`aT@V9#(aT@#|aT@K  !\c*  2   =M  (2 lJ  ` @ `J `$ }a\   " a\    a\ a\  aT#(@ &  & 6& J `(cX , 6cX ,66 D` * "@!Ԅ& " &` &J `$ J `{2 J  ` ``J  ` @ `J `$         M ( D * `"@ & B!" &` &-"Ȓ@Y> "c( 2a\@#h   @2@?֐ $ @ ?   ' @ِ #cX , 6cX ,66& &`! @Đ  & &`!N &M { b@0#  & &`!  D * `"@ & ؐ!&`!%#`"#- # @  a\ a\ a\  "@X `" J! '-$L "JL a "JJ J 2J !5@Xc"&`# @/ "&`c#4@X#`@X|&`!`"( 2\ & &`! "` "c0!&&@א#X`,\@ 6\#X`,2\2\"c0>&`  1"` cT"` )1 5h@`  '@`c@` @1A "` hkhJ `\ cT"`h cT"`h! D* `1 " !�! ` "! @"`! �R&h &h cT1"`@#h`` "0&#h ;1 @   " & apJ@"c0 @"#T ( $ @   cT"`"#hN` [N` {N` - N` > cT"`@ @"#hۧ"@Ҁ } ;"#h$H,' PtL ' d   ` X$h&x Dh&`l0T@d!!""&L"" D&0 `&0&0&0&0@&0`&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0h D H0<!#"%$&$&0㿠N Ő" A` 9 L*  N  _2 F # 8@ #? D@ #? P@ #  \@  '  # d@    # @    ```"&#  # p@y #? t@q  ?# x@h #? @`  ? @X  ?# @O #? @G #? @? ɰ ?# @6  ?#!,@-   &`Đ#`*`@@# @ #?ޒ @ #? @   ?# @   # @ #? @ #? @ #  @ #? @ِ #? @ѐ [ ?# @Ȑ #?!@ J ?#! @ A ?#!@ #?ߒ! @ 0 ?#!h@ #?Ȓ!l@   &`Đ#`*`@@#!4@    ,#!8@x  ?#!<@o  ?#!D@f   *#!L@] # )!T@U ߰ ?#!\@L ְ ?ْ&`Đ#Ѐ` ͓*`@@#!p@: İ ?#!t@1 #?ɒ!x@)  ?#!|@  # /!@ #?Ē!@ # 9!@ #?ƒ!@   .#!@   0#!@ # ;!@ p @U ! k #!@ڐ #?ϒ!@Ґ \ ?#!@ɐ S ?#!@ #?Β!@ B ?#!@ 9 ?̀`24 #"D@ #?"H@ 2# ?&`Đ#`*`@@#"@   A#"@|  ?#"@s #?’"@k  ?#" @b # D"(@Z  ?#"0@Q ۰  B#"8@H Ұ ?#"L@8  ` N p` N h#"@/ #?"@' #?"@  ?N n#"@ #?"@  #?"@  ?N s*#"@ #?#@ #?#@ #?#@ߐ #?#$@א a ?N g##,@ː #?#4@Ð #?#<@ E ?N l ##D@ 9 ?##L@ 0 ?``"#& ` 1`H`"O# #"P@ #?"X@  ?"`@| #?"h@t #?"p@l  ?#"x@c #?"@[ #?"@S ݰ ?#"@J ԰ ?"@B ̰ ?``".#° ##P@1 #?#T@)  ?##X@  # d#`@ # c#h@  ?#p@  ?##x@  ?##@  ?```"#u ##|@ n  g##@ې e ?#@Ӑ #?#@ː U ?`2P ##@ # l#@ A ?`2< ##@ #?#@ 2+ ?&`Ő ` *`@@##@ #?#@ #?#@}  ?##@t  ?##@k # n#@c  ?##@Z # u#@R ܰ ?##@I #?#@A ˰ ?##@8 ° ?##@/  ?$ 8@& 2 t?~```"$ ```" $  z @   $ @   {$ @  ? @ $? @ $? (@ސ $? 0@֐ ` ?$ <@͐ $  D@Ő $?~ H@ $?{ L@ ?  `` `"$4 ``"&$- $ P@ & ?w T@ $?v X@  ?z$ \@   ?y d@{  ?x`"$ @p $  @h $  @` $  @X   $ @O ٰ ?j&`Ő 0`Г*`@@$ l@= $  p@5   $ t@, $  |@$ $?u @  ?s$ @   $ @    $ @   $ @   &`Ő L`y*`@@$ @ p ?_$ @ݐ $?f @Ր $?g @͐ $?a @Ő O  $ @ $?W @ > ?\$!@ $ !@ $?^!@ % ?X$!@ $?]! @ $?Z!(@   ?e$!0@y $?c!<@q $?d!H@i  ?b$!T@`  ?YN  o h , c, e"3ڰ hǀ i l"$Ѱ r o p q"4$ư u r5 t"<$ uG y"V`  $!`@#   &` h`*`@@$!h@ $?T!p@   ?N$!x@  ?O$!@ $?R!@ $?Q!@ r ?P$!@ߐ $?J!@א a ?S$!@ΐ $?G!@Ɛ P ?M$!@ G ?K$!@ $?E!@ $?L!@ . ?F$!@ $?I!@  ?H$"@@  ?>`` `"$  ``"&$ $"@q   "@i $?C"@a  ?B$" @X  ?A"(@P $?@"4@H Ұ ??"D@@ ʰ ?=$"L@7 $ ƒ"T@/ $?<"\@'  ?;$"h@ $ Ȓ"p@ $?7"x@   ǒ"@  ?6$"@  ?5"@ $?4"@ w  $"@ $?1"@ܐ f  ``".$\ $"@ː U ?,$"@ $?."@ $?-"@ $?0"@ 4 ?/"@ , ?+&`Ő `#*`@@$"@   $"@   $"@~ $?*"@v $ ْ"@n  ?&$#@e  ?%$#@\  ?)$#@S ݰ ?#$#t@J $?#|@B ̰ ?```"$ ``@`"W$ $#@'  ?"# @   $#$@ $ #,@ $ #4@ $ #<@ $?#D@  ? $#L@ $ #T@ $?#\@ݐ g ?#d@Ր $ #l@͐ W ?!`$?#@ J ? `` `"$? `'` ".$8 $#@ $?#@ ) ?#@ $ #@  ?$#@  ?#@~  ?`  㿠!J! GN DN  (@ J  J (2J` )""`J `2JJ "JJ "JJ  "JJ J 2J $#@J !8@Mf `:O O  "O  `O 2 O (" `:O O  "O  `O 2 O  2O _G N` 2 `N` 2`N` _2``N`@:N`N`  "N```@N`  2`N` ,&@.`       ,`.`!\@L\    :H` 2DH`H` 2>H`H`_":H`H`'"H`H` 2) H`_2 H`) ) ` H`H`:2) H`:") H` 2H`H`_2 ) H`) `J`)  H`) ! #`) ` H`㿠N    " @!N  "N  N   :N  "D.N . N  2N 7.N 2SN N 2MN N _"IN N '2N N  2.N  _2N .. N :2.N  :2 .N . J  .N L`  cT  "cTN $2N N  "N N   $#@N  $ c@  N { u:,`N  ,`,`L` ^`N `N  $#@N `N   @,``& J  "L`:N N " N 2N  : N N " N " N ,`L`  2`L` _2=N `N  2N N  2 N N _"N N :2.N . N :N N " N 2N  : N N " N " N [5N {1N })cT     # "cT # @J! R&Q d G!@KH,`J! &5 N [!x!!@K(#\ `"@ `" !p* 3cT     &cT. N `i (aT ` 2 `g`o a2 `m `2  @2 `s @2 `x  @2 㿠@ 3c4 @c4!@J9&c4 @"p `䀢`?2N  8`2 8N "8$#@SN 3$"8N 8 N c@CN 2N 86:"! "`㿠 " @&`1#4 @#4"@I&`J`䀢 " @ 3c4 "&c4@c4&c43c$ @~c$"(@I&c$ @"  N `$#@N 3$N e2N  N E8 N c@N 2N "088$68"P@ &"T"\`@'`"`@ !@#$"d@{ `  &`@(#$$#$86:"! "`㿠 4 23 0 0  ". 0 0  " 0 0J : "$ 0 0J : 2 8 8 6 8 0 T 0 "@@ "@@ @ "`@& 4 4  . <  ; 4 " 4 0 @- 4 " 4 8 " 0@ 4& 4 4@  0"   8  0    4``@@ 4 0 & 4 4  . < 0"  8 6 8㿠" @&`1#4 @#4"h@H&`J`䀢 " @3c4 "&c4@c4&c43c$ @{c$"@H&c$5" !@" N    `c" N N d"N N s N c2N  @ d2   N c"N N d"N N s"N   *"! !"`㿘# #,   2O` *``O` O` 2 N  N N " N $#@N "O`N  !@De   * 5O` \ '`O` "O` a  2O`O`  2 O`O` _"O`"O`  2 O`O`  2O`O` _  O`.`O` .7.㜐"'1"#,  @Du" '`"@f "@_ @@ P@} `'?  "` ``5 \ "` 5X ,\ 6\X ,2\2\X ,"cD <"`x"`J##, Z `:(`M  @I "`M X  2` , 2`,`:`M 2M @/ 2M ` #FcX2`,%@!" `" @@+    "#h" "!T    `` &`"А@Ք ` m #X#, ` -+9  @ "`"aT2 #F2`,Đ# , 2`,耢 "!c@"@ @}+ @    @^`,  `` &`M #@ 2``" *?@b  `` &```@T`: #X ,"c ``@   "` `"`@"#4" 㿘#  >!@B    N`@Fِ"N` $2NN` 2`N "!N 2N 2N _" N '"N :N 2N#&  @"`@SN@F"`2N`$#@ N` $/@ΐ @X "  @  @ "a` a  @ S  @x  @t  @p "a"  H  @ :  @_ "a"`㿠N  a   ^#X  ,\ 6\  ,2\2\N`   ,"cD " % @V 2J `" x@ɐ P@|  "  * '   '   3`"@   `@:    `"@  @~.     `  x`䀢@2;``@:x*L` 2 L`#, 2L`  ,  2`,L` \ `@:L``\"L`L`2L`  L`* L`L`"N*L`* `@*L`C*@:@*L` 2 L`#, 2L`  ,  2`,L` \ `@:L``\"L`L`2L` L`* L`L`&$* L`@"L`* `@*L`* 5  ""`@ Dc, 83`<c,"`."aT  ,  2`, 耢 "`!c@"`@ @{, @`      @\`,`  ``` &" @Ԑ#F 2`,   ,"c   ``@`    "`   ` "`c4 "#$"c4T`A㿐N ֐" .cx  *  @D#N  x  N  .E  L 1֐" 0# 6*   L `"L @<#L .@ L `" L @+  &#h@}ؐ #hh``F;`;``@}tdƐ   .@ L !#N  a  2L N _2&N`L _2L N` "   "  $ " @DŐ#( L /` `L  2L L _"L N` " L " L $ "L @D#@L .2,L L  ."(L L  /`L a   ` 2L L _2L L _2L  L /` `L 2L L _"L L 3 % @L , % @L  %  e/`  L +`L -2L L  /``L  a   L /` L ` 2L  @b/`@4c @@#\@|2\ ;``@|d  @C"`㿠#X@  N . N } J` "`J` 2 J``J` J` "`J` "m`!@ #,  @  2N   N  ``   @" N #&J` ~2J`J` ~2 J``  "J` 9` @" J` ^2` `@*J`&@#c, ! c, İ``"#h""T ``#h "#h@#\`"{N `  ) "#0 "cT D* `" x , "#T  @! D*`$@ h! D r* $@b!)@" "#h㿠1#8 @#㿠!% `!<@`@c# @΅ @1 @. (@+!@)@w!@t!@q!$@n L@K &` @x`@Z#@Z$`($"a"a @[`(`(  "`" #X ,@Z"a< `( *`( @Z @Y`(` " @"@@ "@@ @ "`@``"`D㿠! "`" !@ $!@@!@ ?$!@ 㾘T#h@2#hT" ,@&#h耢@!aJ   "J 2#h" % $@5 #h@+#h" %#h@ aJ   "J 2#h" % 0@Q5 J#t C% ;#, ;%  $cT %cT #t %#@ % T@6#5% d@05 D@+5  % @% t@ 5 @5 <@5X%`      X , <@X3 ,c䀢 c1#D@@%x`@u#D&ca@ #@Aa@  #  @ @ia ``  " X      @AI#* d cܞ㿠 "    "   "c "aD "` "` "!H "  X<Lt d$  D x 8 L X l $ D $d dp d d0d dp d 4 dT4, d dH8t 0X| P (@Tl4x P44\h ` Xp d d<HXdt 4 HH #ڐb@<#d#& !D& `& & H& & "!D?"`""X& $& `"icjbbJ5`u`k#xa2l`i#|bd#?c #t"X$bV, x#hR #l ` 6 h$`&$`hR "J|`@,F|4C|* `#R@@2<|*'%䰓2  : #%"X:  ` : #ܒd& ֒`\& Y*` (`@ "`R5 %?$`` , `" "`hR `@, 4 * `R@bR#p  2 pg#!D`"!Dp  Ip "`U* R<! 96* T!1*'%䰓2  : #%"X:  ` : #jd& d`& *` (`@ "`T5 ;%٬%%Ul l?."`!H*#R@"# * ` & ڐ#O*`@@@I% % %`@& ?@s& :& 7% & 2%  @G&  "L `"% "!#`a"#`%  @& %#   @ڒ  @ & & t2#\ "c0% % @ &  "0& & %   @[& %   @R& @ %` @O & @ @%` @B & & @& % 2c\%@ % ` @ @L & c`"c`% 2c\%@ % ` @& % 2c\% @ ? @s%@{` @& y%  2c\ #А%@i %@e` @& c%  2c\#%@S @ @C%@K` @& I& F@>& A%  2c\%  %   @i% @`& ,% 2c\% @  @%`   @P% @`& %  2c\%@ %`   @9% @`& %  2c\%@ @ @%`   @% @`& % @ %#\%`% * 2% @`& #\% % * %  % 2 @ۖ & %  %$2c\%@ i %@ e`   @ @I %@ V` @A @ & %     @% @-`& & # & x& u& r& o& l& i%% `@#5a%  @#.Z% % %`@ IP% % %` @ ? "c0C& @s& ;%@ 6@ 2%%  %`%@'%   @& %% ` @& % & %  @& %% @$  @A @@ & %% @# % @0 @@ & % % @# % ` @ @Ɛ  @q @& %  @ %` @˒ @  @[ @& %  % @ %` @ @  @D @& %  @<& % % `@3 & %% `@#  @%  @r @ @& {% %  @@& q%@& @#%`@ & b%# ;%#@ #@ ``@ & J%@ @%`@ & ;%@ @%`@ & ,%@ @%`@q & %@ @%`@b & %@ @%`@S & %@ @%`@D & %@ @%@& %   @U& %   @L& % %  @&& %% `@o& @s \@ & & @f ^@ & @] _@ &  @  @ & %@I @ ƒ 0 0@ & %@= @  2 2@ & |@2@  , ,@{ & q@'@  . .@p & f% @& _%@ & Y@@ & R%@! & L@! & G%@! & A@! & <%% `@!& 3& /% @"0 %` @v & "& % @! %@` }@c & %@" @  {%@` }@R & % @ @! @  {%@` }@? & & &  @  @ & %@! %@` @ & "c0%@! @ n %@` @  & "c0%@{ @! @ Y %@` @ & "c0% % @ & %  @ & %@ C % `@ 2 ~ ~@   @M @ ~& w%@!8 @  %@ %` @  @4 @ & "c0\& X@ @Y & O%@  @O @& E% @ % @-` @@ @& 6%@  @ @2 @& (@!2@) & @  @  & %@ @!@(@ @M  @  & % @ @!,(@% @` @ & %@ @! @ @$  @ & % @ @! @% @` @ϒ &  @& c`"c`% @-& @i ^@ &  @v& %  @& %  @& %@I  @} @ @&  @R& % @K & y@/ @z & p% @; & i% % `@j & `% %  @`& W%%  %`@& M& J& F& C& ?% & :% @ f& 3@ i& .@ & )@ ;& $@ &  @ !& @& @& @ &  &  "c0*`%*`%Ri!$ R@ *  2 1"   6  & &&  "M, * k#S@ , j4 j* R@ jR@j"HS@ '"䰓2  : #""X:  ` : #d&`& *` (`@ "`2 e"C# #㿠@ `4   "`d  d@t㿠 * ct #%@j`㿠#%a$@^ 㿠#%a@@R㿠* ct #%a\@? 㿠  } . ct #%@'aҐ     % &@8 Ad㿠N  a   N  _2N @  N   W N % @ @a @@7 @$@| @m̒ @z@Of!#8" " " a "a"!$N @2 N @O`(@OM  % @L`(@OA .`  `e" A㿠!   @ @NҔ "  @"  ```$| ,`"q$@"n$` 4i$`  B#\\$`$`@ Y$  <    <@N  @N `. @|  @-$@m: @z@N!#X $ ȁ ЅF" " 沐!"`  &"@@ "@@ @ "`@@N (!  H ``* H$4  D 2p  L/ * ` ` "  21"D."D* `* @    $L `$`!3 `!5  "D`   a * a  * "D <`  `* @ #   $ 㿠!``a0!   '!/ `"&@"&` 4&`  B#\\$ &`@ &'  4 !  D#`۔ 㿠!!  ` "`!$`@ !*` " &"& & @6 \`' 6!  @沖!!+` `"# @ " # ` 2# # !0`"` #`@4 㿠 (  ` @6! p L d@d   &  @MD f2      @M5 a2  "  "`㿠 @5  .  㿠3` - (  `  @5ѐ . @5ː . ` `a  `  ` }" `& "`㿠3 (  `  @5 Ā . @5 ` ` }" @z= `"@`@`"` & "㿠3 `(   @5u J#` ) `(  @$!=+`  "#  " # # ` @ " #`@4 "`" L㿠 x  "`  " `  2 ` !  : E ;T`  4 HK` C ?D`   !2 $9`  "&`2`   "`)` !3"&` "` &` ` ` @}`` @}` ` @}`` ` 2 ` ` ` `$@0`0@}x`4` ` 㿠  "   (   & 6  & 㿠    "*&     &  &   "`  "&     &  &    2 ``㿠      @+  㿠J!   "   3cX ,?\#@\cX2`,@4֐!cX2 ,@㿠      .   .    ; Q O N  ;# 9 "Y E   # ! "  :   F B1  ?!6;*   @ 7     A   `" ` 2  `$ 2 {!0  &  "       @k x  2  "cXLt((( (hh?㿠       .  `!U*   * c π  @ˀ  ǀ * ct        !H"#X J! K!T "%3  @m" D33   @m" D#!  %a @}  %a @} "  %a @}  @zhY ,6 !R&  .6 !L& \  * ctD    @O  8  2 "#X  @*  &  @.   .   `` `$   !`  @.  J! !x@1㿠      @  㿠 ~  z u  .    ; ; 9 8  ;# C /     " $   5 1  .!6*  <   7  /  +      @K        2  "cX㿠 1  "   "    "  !62      " R  2  "cX  , #`!   ,  @b 㿠       @  \00000008\000D0000000000000D00D000x 0 00000             0  000000000000000000000   00000000000000000000000000000D00000D000000000000000000000000000000000DD0888㿠 Z U a M*    G`5H `H  `H@   "HH   @im "!&H @!"!``@/!`)``  @ 6 !&     @$`"`"`"`.`ct  ! * ct #%@zRa#`"#   "x  2`2    "   #"c @  #"c`2     " @/! @ #`"# #"c`#`"#2|3 a@F4  `@  a@F+  ``"d a@F"  ` `a@F `d@k* @.ߐ!T . v x $ & !  *` @d   @s   * "@  "3  - @_ #`"#$  "    " "    " Ȓ   #. "   . .    . .㿠       @  㿠    }#    "  ^ "x   p "j  K {"`    }l "U Ց e "{ Α  " " `(ő l j "i k  @g 6 !&  -   .    U  2  `{`D`{   @  ` .   .  .  r }  . x  %d o _ `{``{   @  ` .   . X  D O㿠 6 1     "$`  `"` "` "` "` * ct #%@xfa .`` .`  `* 㿠  " !  @} @  `2 @. "i !   @@w ^ڐ@a ^Ѱ ^@ 㿠 Đ ^@ 㿠 8  ' 耢 $ J#`     6 #&      @u   @d  @  @ 2 c" 㿠 !  "a@!@!$"!@!@~  "`" L@u#`#` ~"#`㿠9#` !ِ. #\2@ 42#\ @" L#`!'#` !㿠!@ !4 @!$ X X"`H X"`H@ρ "#_1&#`"X#``# #"##"`@#!""!㿠  LJ! E h@>h" J ,8hN "!N!N  2N  2N _" %!@w=N "NN 2NN ;`N = `"$"(@,~"`* d]$ 㿠  "0 ˔  @ @ @ @t 㿘 .c "} ""&  "#` "  `й* 7 6 /  &   2  "` "`` "`` " `` "`` 2z` `Đ 2`` `'`'`@E" !l"`"!l``  ` `* @2` ("@@ "@@ @ "`@ w&  @ 1 2( @  @d#``  @f-#\\@  @s#\\ #`@x`@  #` a 7] ` Y` J@#  2       46  "2 *  2)       "` D"`` J2``" ` F"`` H`"  2 ` `Б* 2 7`*  '`㿠3RcL "  ! א$ @E)& @D@$ &cL {6 "&  !l"`"!l`"@@  @ @ "`  @ @& "㿠     .  @ږ . # 27 ~ 7  В`'   / cP cPJ  #t@*-"4 ", "     "'   2' A `  2`  2 ` `2 ``" `` `"``*`"`"``  `"`  @q㿠`2`"@"Á`"`&``   &` `  . `  2  2 `"` `  `2" `*"`"  `"  @  @^㿠     @  㿠ِ $ @t $7 . ` ' @ @  ' /  ' ' 2&'  '  @ " `'  ` / '    / 㿠  @tS 6.  &>`.&.#` "`ѐ` "& cP cPJ  #t@)"T",㿠.  ’ # ]J  @t  6 Г>`&`&.  .cP cPJ  #t@(Ő"t ", 㿠  @sє 27  r 7 .  Ѐ' `' / >`  /   / '`cP cPJ  #t@(|" ", "  & 㿘`3  ' @d  ' @d   @  7  @sd"   ? @ * 6* @   ? S` 2`   3`@ "  3`3`@  3` `&S`;   ` ' ?2``&2` # ?  " " @ * V?2  @ *  6 @ * V?2  @ @ * 6 *㿠) @ @r @6. ` !&>`..c  c  (&,c " (㿘  !4` 2J 8`7`` '` @cА  " %!@rȐ 2"@i͔ ` ` '`  8@c 8 6 8@U& 0% 0@r`(  8(6 8ې @   P  @ri  6`!D&`&```.` .`&` 8`" &`q&` " &`e&`&ϐV  8$"i 2d  HZ#*  @"G 2`   "``  ` $J %@r ! 2<. 7  ` {` ` ` " " " " "`  2 8 @4 8 : @4 :P /  @q  6 !P& =&  `.  . & ```& & )$`$ $ ` $ ($ (& 㿠  @q 7 .  ' ' #' / ` "`` "' cP cPJ  #t@&-"",㿠  @qD 7 .  ' "@@ "@@ @ "`@' ' #/ ` "`` ʒ"' cP cPJ  #t@%"؁",㿠=  @p 7 .  ' ' #' / ` "`|` "' cP cPJ  #t@%"",㿘@X#3@Cc    ' @aՐ  "cc@g> ?c@hEc"#?#2c\ "c0㿠 @%i#  /!1@s6  #@@r #H@r      E*  Ւ !1 8 @Ԓ   @ϔ cT@rn   @  ?#2c\ "c0㿠yt K㿠    2`  2 ` 2`` ```      ~#\ (` $` { ` ` ~` ` `  `     㿠! O̒Jߓ @D? " @  "# #5&HH`ڸ~!H&H ِ #> *  `v``&` ` c#*  @"P  4S ` M`"`< ( $    4 " {"  " $ 2 !   *`  ` `"`  8 2` @.`J` F`B >  {$      @  ` -$ )`"$8 28 "  '`p` /`#@`   `   @\! QO 2` )[ ` 5`  @/`9 "4ʓ5-&H "( "H`&H A㿠 <!$!  `, "沞!!* " "  2 " !0F  " " ``@$"!`"a| 0 @n< 0 耢 #X ,  !c@   6`#&`.` 6`#|&`.`> .`&`&`#`a"#`!0`"!0&`$X (&`(?#\ 2\X ,6`,X6`,2\X "@@ "@@ @ "`@&` c&` 耢 4!c@.X     @9`,# a  @`@  `@ " @Z   @@`@ "    "   " ϑ 㿠  :7Η ^2` "`  2`    '`&` lJ! "`` @" `/ ct @"Ӑ#` 2`H   "` "aa J 048 a  83 a  "  a J 0 &  $ `@  "``  @   `   !`D    @_`  2 챐쭐`  훐   @.8  @l 6 / ` & `& .  &  &  >` . ` `& & '`  '`&㿠      '` 2X`` N`  ` D"aa J 08a  3a  4a J 0(,`@  " ``    `    D  @_$`   $ @lR $ 7 #P'  ' /  ' d'  ' Z'  >  / ` `' L' &`&`  &&&㿠R $ @l $ 7`#8'` '`/`` `'`$'` '` '` >   /`&` '`  ǔ  ”&` $&'` !`  *` @V  z$'   *` @V `  @/  /   @. .'    А㿠          i`"S 2O I   >"aa J 04:a  85a  .a J 02*&@  "   2     !D# @] 2    4  @B  c В    p ` 8`"  &2    .ϐ `* 㿠     4  @   (  ` u ` ` `   b    ` u4  W `T@ `I `@  ``>" J 0?@  :@  . J 0/@& @`@ "   `` `!@`@  ````PD@@]   @ސܐ @  ` ` [ `"   i 0 @j) 0 4#$ ,$ G$$`$,$( $(  @ * >   @ * 㿠  2#\  6!&     * ct @#   4    {[ f @ ^  =Sy 0"  d  \2 㿠 ` "``     { @'` `"@@   @  "`d@   `d@Z@#@mu #`a"#`㿠  , 2"   ( "   < @2#@@ "  H 2   ( @" ( @f 4 " 4 @f D " D  @   @   ` @5: @&  @f `@f @`" @㿠#@ (   @@5   @5   @`@W @U@R!@b "a@S ` H ``* H  8`"`8  4&`` "`` ` "```"`4  `"`   (`"`(  $`"`$  D   D&`` "`` ` "```"`D@5@5& `( *`(&```````" @5 ` @5`" @  @3  @5"`@3ϒ  @4  *`(   W!,3@   #X $ D#`堒"7$`#@C1$`O @2 O @5X@4  % @1@4  @aϐ @4 % ' @aĐ @4 #$ $`$4@㿠`#@`'        "`d    `d@Y4   Δ `" `h"`h ` `. ` ` `"% `(`2 `,`2 `0`J! !#X ,#\#X2`, @:#X2 ,@eQ ,!b   D"`D  " D   @"`@  " @   '  "     "`  `"`D@e% ! "  " #X "`8'      "` "`4#G"` !'       "`d   `d@X ) "`d  d@X@g  "`d  d@Xm $@@^ؐ `ѐ `" (ɐ?#2c\ @@4 @2Y  !@3| (` *`( (  *   $"   `c" "4 (  ``@(   @3Q ͒ "`(`(``" (  (" $ (" @  $@g : %"@f : 6!3@P`@ !@ 1#, @3&#,@4#, l'  "     "` &` " #,@d`&` "cXcX@B2 ,(%" @f ! 1#  @3q&# @4#'  "     "`  @2# 耢 :!c@3@h3!#X` `` ````<%b@f%<@hq @_w`H#X% ,@fb@_ny     ```@-忐?#2c\ @  "  H ``* H㿠   Lʔ  " `h"`h ` ``)` ` ` `"`   ( ` , `J! !#X ,#\#X2`, X@;#X2 ,@cR ``@cK 4@_L @P #@  " & "  "``"`4  " ` "`8`"`,  p@e : %"@e %3c, 2&@2&c,& "  "`@3ic," "$@e  3c  @2k&c @3c& "  "` @1c    " ` H ``* H㿠`#@`&     "`d   `d@V\ |   `0 *`0 ` ` `J! !#X ,#\#X2`, @z#X2 ,@b!`  " & "  "`"`4#X "`8 (   *  $"  `c" # 4  `"`(``(``"`` ( ` (`" $` (" `@ $`" HU?#2c\ @㿠  '=黒   㿠  0鮒  z 㿠 d    l 㿠    6  &   {X  { {6 "&  {@ʐ 㿠     !  {"  6  & ݐ ( ɓ  6 "&  @ 㿠   6  & 乐 { 㿠     ꙓ㿠   6  & 䙐  㿠 @ג,T㿠䇐 ѓ㿠   6  & u   ``@ `@* 㿠  ,@   `````*`@ ``` ``  ``{``< &  `Б* 2 6*  &@f㿠@_ ` ``  *`t@ @[㑐㿠        .    E @- 㿠3c`!&c`  / 2   . ^3c` 20c` && ~  @c> !56 !&  . O& !62 a" & ⼐ 4 ڒ 2!3 c`& 㿠  @@ܐ ` `态㿠 ` 2 㿠 #`   @.  R#@   2 *  61&``  `  "`d`  `d@S`    "` 2`   {2`    i  "@`&`` "`` ` "``&@X㿠   "  . ` 2' ` @"#`"@@   @  "`d@  `d@S@ !  a       4  R p8 㿠 .`# 2   @ ` :`    ހ  "A       `  ` 4   $`" "  #t) ``"`#0*€q<`` g<` 26  @"2"@@  @  "`d@  `d@R@ u  g {Ja`!@ 5$ $ {   * !8曒<` 26  @"2"@@  @  "`d@  `d@R@ )   OJa`!@@ $ $    * !pϖON<`  X$$ $ @$ 4 '  @#"@@  @  "`d@  `d@R/@ Δ    $$ ݒ $$ቐ<`ᅐ<` ``2` `  /  * ct ]V` `g 4  ݰ쩓 ```<``2<`` `  * ct (㿠!x  ^ lj㿠    * #(6& ̐  @`   @"`@ ` `` "" 2"` .`` 3`` ```"`@0!`6.` &ː&`. .```&c&"& &` ``" ` " `  :   * ct ܓ㿠    ` ` `@ ցϞ㿠Ȑ`B㿠`[㿠 `2`0 ` "```` @```` `` ` ` @`` @.`S  랒 `"`&` `  4 i u`& 8b2 8 :b2 :㿠      @.  & 㿠  3 ` .` @*`  N  /N :2N :2@_T. @_`  `"`" N 2Na @X`㿠!@&.㿠         6 #& = ` `  `*㿠   ޱ!<  !!Ҕ  Ē ߜ { ߖ ːHߍ㿠  @@   ` ` 5 ` 2``&`   2&`&`` `" ``""```2```@ Ӑ 2&`&` .㿠  @"  ` "`@!`9 & 2!@`Œ   & &  "4  &뼔    "& & " 4   8  @[4&4 6!& 2 4  v *` 2 `@`  В  `ސ`   * ct Á㿠   "          2  d  -  `  @,`, `  `   ``  ` ` ` & ` @O#` `  @,` 耢  !c@ ` ,`)`2N`lِ * %  $"#`` %# &"%`` @ *0 ;" ` @ \"7``4 `?9  )aȐ$` p  l " $ e&J  &` $+ %"Ld` & * @"2[` MٸaАC ?٪aؐ5 1 -٘aܐі# {  هa   vaٯ   " $ &` & ` @N+W@ܔ ``  N` $?c  ` ` ` `"``"`2 ``@ `* 㿠    #X@N @ @  ~  9@ | u 2&  6 & z+   r f "y U S  " L w  @F v"EA w? x= y"<8   z2 0 " + Ѐ ΀ " "  ΀ < "&`   "2  Ȁ!"  &`  6 4  A2 J  6 4      6 4 "  &` "   " $  6 4  2  `2l    @, $4 $Z   {2V  ` 2P `& "K `  }2F `  2A ` `  @J|`!"@ 4/ &, @YB``А`   @,` $4"$,        { ` `  6 ]4  6 4 U  6 4  I  6 4 $ ( ,:  6 4 (1 6 4J! ) %        ` , ,`2`,@"@"8`2 , 6 42@㿐"l8   -@8+5%c4)"!P&@@% %$l"c3 &`;'c#``0" ,@ ?@  z %  c#@&c(@ cz3 @2'`8H@ '` '`(`<'`,'`0$l%c4&``"`,@ ?@ 2 688 #\'`?/`:'`'`'` l  & 7`8@n`=J `2\~!~`A!L~!nM 2M M 2 M@VJ ` 2MM "MM " MM J  $ M 2M  JM ~!n M @\M'`J`\@ ` `    `@ e\0`@E)`,`@ZoM "M$'` "!'` M "'` M J 2M/`:M `M J  `O`: `/`:M` \ # \O`: /`:\@\Z `@\V N      `"M~!n?"N 2N @J ` 2 N @J ` N N 2N @N 5~@J `  @ J `M% @RMM@M@]5M @@ M@Q@uLMI!@YN -   `@ @M%d@P N  @YN  "N (N J "@YN    @YN    `@ @Lh@P @%N 2^N M~ anJ  2  `@ ` l@LԒ @P    R` "'``  ``` ` @  ?'` ?'`J Հ  \   M J       (``@ \`  :` @C``  d" M J     ` `@ " @V@V\!/`; " '` '` x:* '` *` @X` x1* '` *` @X`㿘   &`#4J ?{  & &J  `: `!z`#`$" 41%`:q`=o`@"+1%@ "gJ "J )" &J J )2J )@ v#@ $  3" &J "J %@X"( " &J `J  J @X}"0 2J )J @ B# @ $    `" .2`@5  @ c4@  2` ?&`` @&`J |`!@@ @t 2 ?$  @$ J |`!``".`!`:`= @ 2`@ܐ  @ !  $ @ @;  @J@ `=  @@ @&``! ` @@ @`!P@ @J `) `#DT@ ``!P@J ) #l|@ ~`#@ v`㿘#4' @M& `"`@&` !P`@=`J |8`J )2 ?'@5   @'  @ ' #l`"#l@!P`@ `J |`J )2@ 㿘#4#@8`    &  `J  `(( `J  ?${`J  #{``)` &`J   )2`{@[`J {K*@u` F*` aL` 2L`L` ,2L`L` ,2` 2L``L` 2L`L` ,"L`L` } * "` &`@V`N `, `@VN 0#@&`@ +?$ @+*  $   * @#l`X"#l*+    + @#l`E"#l+? >   #l2`@ #l:`` "#l @#l#l` "#l@ "@ @q@ @  $  @ &# 0`,@7`7`J! "``, 0@"` 2` #$ ``"#@ `J ?2 `@u @1`@e`J *`J +`J ? `J {@z`  # @ ` |  8  \ X    | 4  T T T T T T T T T T  㿘& #4 3  J . ) # $; (ph )} * +"_ \ .A ?~ ["T T \ ^ |"fK @& "@ f @| ^@x Z@ "@l N @d F@` B@  @T @P #l`"#l` +'` @& ``#'`@  2}  ` @'` ` '`  $@ A  DT@ 8`!P "  @: J "  &  @ J 2  @*<    & J `< x*  @ ``@x'`@ڐ ``@o'`@ѐ ``@f'`@Ȑ ``@]'`@ ``@T'`@ ``@K'`@ ``@B'`@ ``@9'`@ ``@0'`x@ ``@''`o@ ``@'`f@S  ` 68 "* 2`@ ``'` J` ` @ `"    &  J 2  " @& 8!P @  t@g` & !P@? @  " ` !7 L $    "L   "L  #"&L [ ) $р ("А$L )ʀ ."ɐ$L ^ [ \""L ^ |"$L u`qL m`gL 2bL b xX*  $ \ Y V S P M@  * = C J @ @S8 * :@* 4= L 0L   `$@R` W$@  * =  `*  @` L  "L($  " L @ "L@S  * L=  *L +L ?L {@ @$`* $"@$@&   @Q`` '`` '``, 0@2/ @e ,`0 ` 8`  (8(H8*  ((H8*ldT\L4<(D`l㿘#4@ `$Һ J``^   #l`"#l` &` , ,> @ܐ !P!,`J ]`J -  `@: ``J ]"`!` &` \`` &` $0#`H*`@@  `   ` _27$   ` 2 ` 2 _"$    " $    2$  09$  0 :۔$q 1 / - + ) ' %  @ 9``@ &`` &`J @ @@QX  @`"  @&``@ &``  @` `J -`   `J  ] `  &` 7z "  @ "  @Q. k  `@:``J ]2``J ]@`@㿠#4  "!J ((J  ?#J  #J "J )" "J J )2 "  .J " "J #J "J " "J J 2 "* , :  0c2cc cc c2*  (* *  *  ,* ,*`: `01  c2cc cc c2*  (* *  * 2  ,* `0`,: `, `,(c c* ~:  n H@`   `0`,2`,c c`, `, `,  `H (`+`+`` +`(`` 4(` (`㿠 0@W"&@@Q&@6 `0J ~`nH@`  ٞJ {  H`2H` " H``H`2`H`,"`H`" H``H`2`H``}  㿠 $ ( " ,n (& ( , " n ,& ,  " @L &   @L & n n nӁ @   H` \2H`H` 2H``H` \2 H`H``(H` " (H`(`@*H`( # `J``J 'K``2K`H H 2I  H  "I ! I 2HI 2K`#`2K` 㿠N &&&@&@ K    K`I `  #`@*K`@ # (K  㿠N &&@ I @!   K K`  `# *K   :I  㿠%@N"8%@N|b@%@NxbH%bT@N   26 ` ". # !%@N+bX`!D!L%!T@Nb%@Nb %"@N "? !,!@  @Nz  . ".@NZ .㿠   w!@;     ?+ `a*+ ` @  !, ` 2#`` ` @ + `+ `+#`` @: `@8   B @Gy `  '``` "` '` (- !,", @  :`@ ( `@*   ( ", :   * `*`&`2 $㿘  "  L#d 2I&@$   "&@&`&@ 27"  "1". @ @M &`&` "   & @ @M   &&@ `  -N!,& *   &  @   `*   #& *   &  @ `*   `    ' @= 㿠` &c8* @` ` ` `  ` $ @     #(` @@  " "7 !,    @2$ @ *`  `   & &` @@@ @ 쀦@2(` @2 %  @ *   " 􀢀#(` @2  "a, ` 2   `  ``  2 ` 㿠@KkG @LV㿠k;`@K.㿠 <%"@L   @M`&`@C   ` " J .@L8`@K&`J &@J 0 %"@LvcX , cX      cX ,%#@K@K@ V%   P%     I%      , @%              J   *  З: @!\   $!` !h      ,%# @K1@KA@%#0@K`&@ =@D{&@(  a@K' %@K"a%#4@Ka]   㿐'HH'L'P'T''X)! `"@ @N! "8 `<`331al  & `P @#(&:  `  : "`#ܐ":  ` :  `@$ `@M  @L'` ]&al!@  @"`4c@J̒ !@J@J3`` 1 | @J |& |@J``jX``&``T2 "Tcx "Tcx T \㿐'HH'L'P'T''X `? @N "9 `<`331al  & `P @;#(&:  `  : "`#ܐ":  ` :  `@ `@L @LZ'` ]X&al!@J6@J:㿠i @cax` %* `@` `` ii*   `$  `&`,&&`2`` ./ `  `"@ ` 2`   * i`&``@"``i@Iݐ@Iڐi(``"@`@%@Icd㿠i @Iɐ```  `@I 2  `J =  `  2`   "H)   2H @   " H ! (㿐%#l@I@I 6N` w 2   J#`   @!p@Fa@I@I #x .@I 8! @Iː @I@I 2.@I. O` r 2  @  O``r 2 @I@I B! l  @I5  @6" @  @0. @I.@ @I@Iw&!L @   ``: @3  " " @I@@HĐ 㿘 !L@  `` @F\ !&`@H̐ @IM  @II  @IE  @?#x  @I3 @I0 @I-6㿐 ?$%cp@H~@H 7@"6 a "0 `` @Hy&` @7@@"@E@H@C ` &`%ct@HH@HX @@H۔㿈%cx@H4@HD`@    ``: @3  "     "J`*   4* "  K`* ` 4K` 㿠` N 0N 7O ." 0@  O 0O 7$O J! ''O 8O 9'R!'&㿠 !&`N '@ `@GN '@`"@. @` ' O`  '@`@GO`2`'@&㿠f " 8  @   @ " a@O 8* &   * &    2 @& 㿠 `  `    `  &``@` `* &`g +  "  "   2 ` ` "`` ``"` "` `2㿠@Ѷ ` " 2 `" ` " ` 2  2&` " 2@ 㿠@O ```` `  ` *` &`"  " 2`@ 㿘  `` "`  "`@l @'`2`   ' @7ސ㿠@F    `"  ` " `  2 @M  `  J @ 2  2J  㿠  ` !O`  " `O` @F֐ @@`  ``2O` 㿠  `%```" `` "``` " ` N` g"` e`` @C` e 2`"  DDDHDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDTDDDt㿠` c,J " & :*  ! M@F`(@ 32    "  d@6    a ,a 0 $$a 0 a 0 a* 0  a 0  "    a a 0 a 0 0 a 0  "  a a 0 a 0  a 0 4"   !H, \ \Dd \ \ \ \ \ \4L \ \ \d \ \| \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ P h \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \@ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \\ \H`!bJ "  }*  #p@8D?! * @2/3cx;``@2dcx @Dcx!@<[  &  #<@2#`@2 ` @Ԑ$ l1@9  l"@@ "@@ @ "`@& ܁ 3cp " [cp    "aH  !H@-&cp 3` " [`    "`   @,&` 3` " [t`    "`d   d@,&`  @   @*_"!  @   @*P?*@"cT  @   @*?"#x  @   @*01& 8c "?c "c @; 8@;& 8 8` 8`@#a,@   *J#`:@ *#`  @   @)1& c c "c @; @;q&  8`  8 @#a,@  *J#`:@ *#`  @   @)ǐ1&#c "?c "c @;#@;@&# 8` 8`@#a,@   *J#`:@ *#`  @   @)1&!,c c "c @;g!,@;&!, 8` 8`@#!,@   *J#`:@ *#`  #    "`d   d@>"#8  ##!x 2?`  @:``   @:t ``@&   2"H/   "   @:U   2  $&`#   ` '` @>*`" ` ``*  @:@   @::   `.:  *** ``   " ``& 㿠#` %`@:+ 2`#&@:  ` : `h*  ` 2`%#@: % #@:    㿘! <!l. c `    `   Y` ` `@9@  @=N "L `(`L L CH "T꧐ A L H2 ``    `   Y` ` `"X  @͖  @=     `   Y` ` `"\  @  @<  i#(  ( d97 ( (@"  "  &5:  `  (: 3`"`  &    * @&   * @$!l@;' (@0֒` &``P 2 @w $:  ` `: "`$ L $!l &@:  ` 】: `"`` & `  * @&`  * @$!l' (J! `   "``  ` $"dN`"`  `@ `"  `㿠X#"``Ԁ :"" "܁㿠     P " @:!"#@#@    WՑ* &  `*` @8     &/ N`  `"  * @`` 2``2 `@8` 2```2` ` @1 @ 㿠   8  `    J A      &N`, `"`` 2`` WX* '```*` @8``` * @ ` `  ` @8T`  @5w`&````2`  " &`&`&`  &`& ` ` '` ` '``` @@ `㿠       ( p " @2 p     &/`N`  `"  @* @`7  2. 2* @7 2#   &``  " '   $@9% $?& @, " ' 2  㿠    ] P "Y @9(Ö p2A  ! "aa J 03 a  . a    a J 0 !  * @ " @    /"D *  * @)* >      &. N`  `"* @`` 2``2 `@7+` 2` `2`  㿠  ` `.*M.`   "@& 2` 2`U* .@6`@ `\  `"`\." "cxVA` *#M@6&`'` 0'` "(` "   "#` # 2# ` '`# ``2  2```" '` @& 㿠@/ݐ @!   * &  * &  ""@{"(㿠 @3 U a㿠 @86 U U㿠 @ &`&` ` "  `  * @6`  `㿠           @%㿠  U`  , "&` U , " ,&` &`&` &`   㿠  $` ?` ? ?& & $ 㿘 2 ꐐ" $   G P"B@7  @-  '   @5&$ #    ' ' @9Ɛ' ' * &"   @2 &$    T* &`*` @5] 2    &  @( ?& * @ 쀧 " &$ 6&$&$ "` 㿠   P " `@7```㿠Z ؒ&`ٓ  @.  ᠅( `#  !`    "`+ ! `@#  @@`"@@``@#`@ ! ``((`(㿠  @Ϻ   ` @"?    `*`     ` " :  ` :    ` @4*  `@"    "` ( "`" !.`"  "  " @  @ ``  @5  @ *     "@* 2` 2`" S* ` @4b*  @`\ 2 "`\  * "cxS "  `*`   & (2,!l("@ :` @ :` *` "!l. "(( "c `ST*  "`  ` ` ` "` ( "`" !.`" `"  "`" 㿠    Q P `@5 V"#@#@`6     @.  @.2  ( @-@ @@5@ a   @-. @    㿠     P  `  `    @ 2 !  $  ( " i    63  ( ( (l(" :  ` : / ( "l/ / !` ``" *`" ` &``/ `" @  & ( / @@0 & @& ` ! ` J @3x  @,㿠@, @Ò   ( ``* ( "  " ? "` "`㿠@,q @  R&*  "`  *("`& ""@,X &  @&?`` 㿠@,F @~  Q* . "` @2 & *`(" "  " 7  ` @ " "2㿠 7   2 ( "      "!*`&@/&``& ` " :  ` :   ? `@ "  "`?"`㿠 B ( "   " * & &` @/`2&  ` " :  ` :  "  `@ "  "`Q " " ?"`"` $ @/ $" $   ``s㿠 !      `*`   `"`"  *` "   !㿠 b`_ ( 2  ( ֐ 殐"   ` " :  ` : 4 &@  `@ "   `@ "  * "  "`,    `@"    `*` ."   `""`"<` !." " 㿠 ,   '    ( "  a "     "`  `"`"   `"`"   M! `㿠 $"`&?  0     ( $!.@`@.&&`&`4`6 !.@ " "   !q㿠 @q  `"    &   & 2  㿠1!l#ܐ" :  ` :     @o! `"&!l` 㿠1 "cX*!#`* @* `@  c(* @"al#LcH@$ @o  㿠3al#ܶ " :  ` :  1  @n    @o & &al     &&al  ``㿠1  & `P @o@!lc(" :  `  : "`  㿘31al  `* @     '  @!r@'} "&:&&al  㿠1!l#ܐ" :  ` :     @nm `"&!l` \\\Dp\\\\\\\\4㿠1!l`  &` "`d  d@! &`  6J "`A#`a*`@@%#@0 X  S %#@/ M  H %#@/ B  = & @/ 7 4& @/ސ .  ) & @/Ӑ #  $@1`(& @/Ő    , @1 , & @/    @2 @1!#ܐ":  ` :  `@m `&`&!l  㿠1!l` P`   ` "a "F&!la J 09&`a  4&`a  "6&!la J 02)&`.&!l`@  " ``  2&` &!l  `   7"D# &`&!l@!` " &!l&`&!l  &!l  㿠53l& `  @J#` 1N! ` ` " .!P t".! `.!" @"G  "&Ő&&l` 㿠1#@!l"  " 2G   " "aa J 07 a  2 a    a J 0 %  # @  "  @      8 D    @!- &!l  &!l  㿠*!#`* @* `@  c(* @"al#LcH@@m?#`l* @"   @q   㿠1!l &``   ` "`  (Wϖ " `!l"`"&!l```&`@+ !0& &&!l  㿘53l`  @&  ` `* @ +&     2`` "! `  @   W 6" l@!@`&  "&?潐&?&l`  & @   ' @Ґ @$# ` "`e  2 `#  ` '` @1Ր"@%.    '  @@&E` "&?g&?&l` 㿠5l  3 `* @#ܐ" :  ` :     @k "  "&l  "    `* @oi@&l  `" &l  `* @@ &l  l ` l` `@㿘3al &   ` "  V " al"`"&al``1"c@c@ &c@   @c@ ! "   @;`` ^!0& &&al  㿠@!l      ``"   `*@ "  @,       㿠1!l` N`  ` D"aa J 049&!la  84&!la  5&`a J 02)&!l-&``@  " ``  2&!l&`  `   :!pD# &!l&`@`  &`&!l  &`&!l  㿐53l`  @& ` `* @ +&   2`` "!`  @   UӔ "l@`&  "&? &?&l` 1"c@c@ &c@    @c@  "     @;` !`@;hh@l` "&ؐ&&l` 㿠31al      ` ݔ  &!&&al  㿠!!l# "`" `c(* @`` `* @@ &`$!l` 㿠1!l#ܐ" :  ` :     @iД `"&!l` 㿠!l "`" `c(* c(":  ` :   @ #`  `  `  "J!  @-0Rv    "`d   d@fऐ"Ȑ "cx $`:J! 3 @- RQ     "`d   d@={"     "`d   d@)g# `"cx   +3 @Φ & ` @+} "$ ` $ (  @·  ( ,aH #paH @+V ` J W @*?#(. 0"  "!l  #(. "  "!l  㿠51l`"&`  `  &&l` ` "v`` "%`/`"``   @zʑ#(1  " @iߐ  "v3&&l   *1  !      @y &l  !&&l  !@z#@` ` "`d`  d@3  !@zp#L MƔ `   1`  J ` `  " @i  " 3&&l  3`  `  @yl 2`   #ܐ":  ` : . @g  `@)@&l `* @   @  ⚐&&l` 㿠51l 2#    `  &&l`   "w   "% ; "   ` @y֑#X1  " @h  "w1&&l   +1  "      @x &&l  !&&l  !@y#p    "`d   d@>  !@y{#x Lє     1   I6 ` `  " @i2  " 1&&l  1    @xw 2 l" @ρ  `* @`  &` `   <@(`(@ c @   "&ᨐ&&l  㿀!l!l "`" `(*`  "`" `(* @ #l#p!"c  @"pl  " @*.&  ( p  l #\#`!#d!0#h 93"1 *!   ":t  8 @ #t t @!ː @% *!@! @%  *!z 8 @ p  ' @' @! `"%@k%  *!*>' \#X " dh @x7"  ` @-ِ@+% !@#  ࡐF1#>"7&## " #!# 8@("`@'@'$ 8$`# 0 !##@(a,@'@'$#$a,`8  `8`@#a,@  *J#`:@ *#`    @v  ` p&:  ` l: * @"!l   l `* @$:  ` :  @` "l+l"`"!l  㿈5l   0     @v #d   @  '   4   #ܐ":  ` :  6 @e4      '  #hh@#hh `@@wE# 8 `&l   `%&l     2 h! "h! h08 !#l""  "   *    "  g"  `&   h  " " ` `l " `l  #` #`8  5#d@g8 &5`"4  "4     2 4 " 8  4 &c8* @ ُ4"48 2&4ة4"48 24"  &4  ``"  %:~ 8{ 8y 8  ``" !" 8 `8 48 % 0% 4 " 4   "`J 쀢  , 'E ,% ,% 0% 4%  "4@  " d @hda0%"al   #d 2) 84  J M  4  @&L< " 88  4  قL< "  84 ڀ`4  ``" 2 4  ``" < @#4$4 ` `#\@, !" 8 `8 48`]`     #ܐ":  ` :  `@c`  * @'*% @"`  " ` `"@o@ ` 0  ˀ`   `@Ā`  `"  d @gd"!l   6       s g2    g @ f g  ?  ""   `@2  * * " d @gda0%"al   `       ) g"?"  d `@gd` "!l   `%"al   㿠'l `  @ "``` `* @            ` `     `x  J W I  J W 6  WJ` * W " ,         Dh  ` ` #@&j  `` ``    DN  ` `@ 8` @   WJ``.* W-`@ @b$@e##8@?#@?@"#@8#\ `   ` @  @b `"$`FJ! "` "` J W 2`     "        $5#`  `  @s_ 2$l* & "@ ܦ$$l` `  `  @s9  @ P@%  :@M   @ P   ! @! 2E ` ,`  J W `@Z  @@   WJ``* W`2` @4 `  `  @r * & "@) 0$"!l`  ,``" ,#ܐ":  ` :  6@aa $J` ` *aJ`  `Ja  `  t @ `2N`  (   ( ` ܐ"``J`J 2 * `"`"  M` "M`M`  2`M`  2 `& 0@"M` 2M``M` 2M`M` " `aX@" 6`>$  `  @rI  `"   "` BV`"`@ P@$  `" P  < P"`  ("` B1`"`"!l` 㿠53l`  `  c`   c`* @* `@  @`@b#L#H1"cL#d#`@#` &#`#`@`&#`#`* @* ` @" #(&:  ` : "#X" a8" :  ` : "#"!@" !"*&l` 㿘5l  & '  @  3`  `  !&&l`  & "  a "` ``"`@aZ  ` `@   "g@r.  &!&&l` 㿠!l`   #`* @* `@a" #`" ##`* @༑* @ 1 #(*`  "X 8*` " " "@  ` ``"#``     #`* @༑* @   23`  @; *"0&@#,&#ܐ":  ` :  #(&:  ` : @_~ #(, @ !&  *2 @" &  ( @_"!"!l  㿠1!l#ܐ" :  ` :     @_L #`* @* `@ @qh#  (@``@&  `#&!l    `@ `#&!l  ` "@ * `@`` 7"`" !"`a0#&!l  P!l# ` #p0 #8 @"`"#`  @ " #` 4   #ܐ" :  ` :  6` @^Ȕ #` ` '` @`   ` 2 ` # ##| ###lA?'@ #`  `a `a0``   J 쀢  #t #t8  @`ې#d8 "cd4 "p8 2l` 4 &c8* @ Fh42 @4҆4"94"N`8` &J`84  ``" `":?`8<`8#d 27`84  J M  4  @ =M< "'`88  4  ӰM< "`84  ``"  `  `@b"!l   2p4  ``" <p@04%4p 8!  * p: ##x`8 @` #` '` @`@8``l   @*#\ X |`   ` '`  @#`, g "!`* $``Ҳ` `& '@9@Q$.@.`&"``* $`` $`` "#!0"``  @a"!l  <&&@ & "` J`&"."`@`* $`` $`` "!0"``  @a"!l   ,&@Q@`* $`` $`` "׹!0"``  @a"!l  @'`* $`` $`` "ד!0"``  @an"!l  $`@n  '" "@@є@"`@r@`  #\  @ Ґ"``'@``&@ @" @`* $`` $`` "1@ @ :&  `@@a "!l   `"`  @`"!l   `l   @ˮ#\ " |`    ` '` @"4@@k%@1"!1#d#`@#` &#`#`@\"&#`#`* @* `@""" """"" "$"(","4 " "!l  $$`,@n  "``," ``,% '@ ` '@^` "x@Ux t#\  @% ʐ'@@?` "`@ S`=  ` `"`` `"`` `"``" @ؐ`* $`` $`` "?@@H&  `@@`"!l   "``  @`"!l  @m#㿠5#@l"  " 2H   " "aa J 048 a  83 a  "  a J 0 &  $@  "  @      I#D   @` "  " ``"? *` (* ("   3  @[_"`  c(* @U@[U " &    " "` "``"  " &  " &  1c(* @    @l '  `* @@ ג` b#ܐ":  ` :   @Z  ' &l  .&l  @Z@]!  c(* @  w" `4`` "`&l  㿠3!l#`"`"#`*` * `@  6`c(* `"X` 8* "`"`"@ ` ` "  4   "   `"`<@x /`` ('`2 @'`- #ܐ":  ` :  c($:  ` : @Z c(, @ !$ 8   (2 @k &  (   `  ( ` `* (@Z_"!"!l@Z,㿈l `" @l (`  M "L` K "K`` 8!0@"l  ` !@kޒ`@` ` "`d`  d@    `P!@k  -Ȓ `  @k `   @̖ @Y@[א#L#H1"cL2@k x ( 2t3 , 2o3 4`e'$`  `  ` ۀ` @ "@@ "@@ @ "`@`` "`@B/`   "``  ``< ,! " ` `"'`4`` `@9J#`  t 4  @  @k  @k `  `  `@j<`  *% , %%1    @[ H " @ @   4A'    @j ؁% , d( H + "`" ` * @$ :  ` : $$ 8!$!l , ":  ` :   0  * @ /$!l 3 &al ,`$al " :  ` : al " :  ` : * !"@  al  "@   &al@X  ! " $   * @$:  ` : `  @@ #\ @ `@X[ 3#dc`@c` &c`c`@X7&c`c`* @* ` @" (&:  ` : "#X" a8" :  ` : "#"!@" !"*"  <24*6 <``" < <  "@@ "@@ @ "`@ < d2J! " 4    "  4     4  $  `<@s`<*`@ "`````````V`-!;?   @"@@ @ @ "`@1%`J` @2 J`;埔  % 哔  @ 劔 % $ @  #$ %`%4 J  n  *`( <f <"` @ZP  <* @  "`\`l`  (  M  ( ` `* ( 4`` `&` `&` 4  `"    0     "      " `:  :@ "  "    . &"  8f "`  "`  & &. @  " 7` ` ` @ " `&2`"!l $㿠7l@'  "@@  5@  @@`   $`#X ("`  !'?&l  `   a " ``"@W  ` @  @h"%  '?!'?&l 㿠` "`ސ` +` "`"` : @ƒ   @``" ` &`` 㿠71l3   c(* @ ` "`Л`  `7 ` "s ` ` "`d`  d@ߐ "`  ;z "Z     ``   ` ` "M @'@ `c(*` "``,` ")      "`d  ` d@`9k 2 ' `   ,@g!' &l``    "`d   d@@gƑ!    "`d   d@o,Na &:G !P:@ :: @g!\92' @g!' &l``@g!`" ` `` `@(㿠 @ ! & @ & &  $ "` *`" *` "` : "  "" " "㿠1 \   \ cx& \6##ʔ 㿠 ذ  * "@* :  "  !&@`D@ *  㿠 ذ4;#53  * "@* @:# ` 2` `  "` "`  `" ` ` "" @ @*` ֺ #\ - ذ(;#53  * "@* @: `"` ` `" ` ` '``` " @͐ @*`  㿠 ذ3  * "@* :  " &@ *  㿠 ؒ1``"``" ````2``25 `2``\"`\  `\@  `\"  `\㿠5$# at" #"at "`\" "ׁc<"c<  c<@  c<"  c<㿠4# # "c<" "ہaP"aP  aP@ aP"  aP㿠4Ԑ#"aPaP쀢 :"" "܁a"a  a@ a"  a㿠4#"aa䀢 :" " "܁AH`T`|l| T㿐  "`:    " @  Qb *  Q      "          #;``` `Q         ^#h h6;`& `s`q     Q#hh" Q"H $ %@;`  W`         Q" T;```D `BQ?           Q" 4X;`.`                 4C;``                4/;``a"$Q"Ѐ`,@@V"H}&  "` T ;`&  `"`"`K &  "`D &  "` "` "`9 3 &  "` "` "` "`  @ "   " @) @@ &  * &   3t;`&  "` "` "` "`  `"`"`  3b;`&  "` "` "` "`  `"`"` "` "`  03L;`&  "` "` "` "`  `"`"` "` "` "`  "`$ "`( *`, 3/ 0& `" 3 "  "  "  " Q" " "  "  "  "  " $ * ( 3 0& `" 3m "  "  "  " Q" " "  "  "  "  " $ " ( " ,  P2;`&   P@  "  "  "  "  `" "  "  " t  82;`&  "` "` "` "`  `"`"` "` "` "`  "`$ "`( "`, *`0T  (2;`&  "` "` "` "`  `"`"` "` "` *`& "`  2`$8  P2;`&   P@S  "  "  "  "  `" "  "  "   X2z;`&   X@9  "  "  "  "  `" "  "  "  < "`4  ?&  &  㿠  "        "    "" "    @[ * &  㿠  " @          " Đ    @(   &@* @* @         2v 1 "  "  pppppp88888㿠 " "   "  cX @" e"  " @  Ta` +*  5 $ 0  +    @] @D ~* .` 5" 3 * &  " ) @@ &  " J#`  J!   t @ ٙ PPP,PP㿠 " "   "  cX @" "  " @  Tcp 1*   *    ""   " ɐ   @Ӑ @ ~* Ƥ " "  * &   "   & J#`  J!   t @ T `  2 H` "'H` ^! M -H` `"  @ W2 ( `( W`((@(H` #2H`H`   .( .( .((` `~b *  "Ò"ƾ㿘 2   "J   @ "    U"    9     B#\\  ;``@d  "    " J! "  @! 2 j  @  2  " i     ! : "  @@  `     "C   U"    9     B#\\  ;``@Yd     J! "  @ 2   @AJ!       "  I   C  >   '  " [ @@ & U"    9     B " 2   ;``@d "` (   &   !J! "  @S 2   "   @@ &  @  "`   J!  #0   "ŀ  A㿠 V#  "> ɐ  "     "    " J! "  @ 2  @ 2 ?  @9 @ "    V# " i  ,  ! 9k "  @  ``  V# V#H$%  "7   "    " J! "  @ 2  @ 2 א  @с @   J! Vʐ V#  :         :   3@  "   .@E " @E 2     " " "   %    J! "  2  @& 2 o @j  " "   &    J! V #0  V "VX V#,8DP\ht㿠 &`"  "3 ǒ  "    &`  @  &  #@`L       `@N`   &`" " "   e  ! 8> " @   `&` `"  @`&` X `\ *       (  0  < H    &    ,#@`P/& #``@ &  "]       `@`  @ ? & #@ `l  " @c@ &`@6`    #@ &`  `@    " @3J! "&`= &`#D    2    ",   : |          !#x   `@I`$#xN` "5.``N` 2`..`@ 9  : N          !#x  & p@ V$#xN` ".``N` 2`.` &@&"` & J! "&` #0 2 &` "2&`´ &`#H㿠  "   2   [  Q! 6ܖ "J 2 A @ ! `" J 03   .      J 0 !  *  @@ "  ` @ @  ``YbD *  * * >   @   "  ``J 0`  `  `J 0  @ "   @  "    Y"D  t p8Xllxl㿠@ " `  "  cX @" U"  `@`2`!`   2   " @Z#L@  * &   &    * & Z!`.`@@ * &   k! 4`  `  ` 4` ` 4` ֒ ` ϒ ` 4`ǒ `  ` 2``   2`` @R   ,cX`@"   0 ``* 0  0 ``* 0 6` ` 6` ` 6` ` `3` @ `~* Pu`@ lm` ] " ` $` (V  *@=` , "`, "`$ "`( @ &  * &   " ^  0 ` `* 03{`3t  "` Jc``" J! "    t @   ,cX`@"   0 ``* 0  0 ``* 06`` "``5u , ` "@@  @ @ "`@ 0 "(    `"`"   0 ` `* 0*Q 0 @  0  "   " @  ` "`cX`,  2( ` "`  0 ``* 0`   ' = ""   @L0      "   ,cX`@   0 `` * 0"   @L      "   ,cX`@   0 ``@* 0"   @K 5   "0 J! "&@"#   2 ( 2  , "          $ِ# &   "    "   0 ``* 0  ,cX`@0   0 ``)* 0"   @K      " "  @K      "   ,cX`@   0 ``* 0 @@KJ#` NJ! I  t @   "   )  "  "  * & 3 "`` "@@ "@@ @ "`@ "` &  @  & `   " " @"` "  @@ & `  "` `   & 3`(F2E`  "    * &    ` )J"   )E  :` * &   3   'S 'g "` "` "` ` *@  *@ &  @ & Jc`` J!   t @6 㿠`N  I " "   "  cX @" F"  " @ }  :    2  "   &  * &    &@`""` `""` `"` ` "` 㿘 #     '  @ k    : #@ @     @h  `@"    `*  * &   & J#`  J!   t @ 㿘`` ` '` `㿘`K #    '  @ @@` `@@ @      @  `@"  * &   & J#`  J!   t @, 㿠`  ``"` `" &`&` &` &`" `   :`e 㿠  " cX @"  & t@N 2 " 8 t2   :         t `" %P  @  ` '` " @"'` #"@@ "@@ @ "`@'` `  /` /` '` /`  '` a'`a+E. V#*#.AOB"WP ESI\L"b PeSkU"vpg a4c6e"=g;iAl"Hxt pHqFs"LmxtHv"OdxM~"[ ]#p\'` X'`!T'`R'` O'`#K'`#H'` `D'` @'` $<'`  & 7'`#4'`#0'`#,'`#('`#%'` t'` '` '` '` '` L'` 8 '`  '`  & #   * & 㿠   G   B   "-N 2$`& " ` "` "  N g" $ @g $  2N    8* & 2 @& 㿠 2 # #   '  "`d   d@4    `@      @  @ /@ # "K *@@ `@"  hq  @Ҕ  Zc   @ @%<#&@ @$- @-  %"`, $&@ &"` J`&".`"@ $@  㿠 "  "`  "  cX @" ې"  "`@ ` 58V# `    `"` ` @&` 8* &  " @0& `& `& `& &  &`"  "`" ``DDDDD 0X(8Hhx㿈 7"| 5l ` ` %} @B$ @Ee  O    I @ < @Df "@@ "@@ @ "`@"`@'#ܐ":  ` :  63@A 3` &``P @B#('@:  ` `: "`'``&lE @A  @  "  * &   " #\"`"#\  *     "   " ca ;*  @1 " < " D " L  $ И  * " $  " А  "  @`    "  "|   caL ?*   9  5 % 1 G - "` ) "\ % "X ! "T  "P  "L  "H  "D   "@   "<  "8   &   &   `" 㿠 .  !%!0       ő (   &  & "  "`" 㿘 2   " _'    '  W㿘  L'    '  @`    `  ` '` ' @R   㿘  P'    '  `' T`  ` '`    ?  @  ??@ " ?@  㿘 " "   "  cX @" Y"  " @   /    7   '%  "      X '       '   a  " J    "%`    2`` "`  &``  &`   ? @<`2` ``* $`` $`` "  P`  ` $ $` `   `` ` ` `   . T<  @ɔ "!&`` &`" ` ` `@  `  `` ` Ŵ@@&``?/`` &`"  `  :`풐` ` `. ` & ` & & @Ò  2&`&`.` `&"`   "`    2`"``  &``  &` ?@k`2`` `  @֐逢 @Ґ?㿘   " $   "  cX @" "  "    ! ,) @  "  @@ 3" ΐ * &  " Đ @@ &   ``" @f  ``B" "  * &   " 죐  & @ `  J  ` a J " JJ 2J a " JJ 2J "@ f#B;``dd"  & 0!J " JJ * :  9g**" *J [J" *" :J  `@:   P  ``"  `  ( J"J *` J a  1*J* f֒ f# " "  * &   "   & 㿘  " $   "  cX @" Ð"  "    ! -( s@  "  @@ 3" 먐 * &  " 랐 @@ &   `"`" @h  ``B" "  * &   " }  & @ ` hE h  " "  * &   " ]  &  @ h B;``dL㿠! ``" ` `*  $ 㿠`  ``"` `" &`a&` &`&`1#H &#H`` &#H#H* `"@`(&`㿠`  ` "` `" & 3&  & (& 3cH &cH`` &cHcH* `"@㿠 $   3cX @3ǐ"3cH &cH`` &cHcH* `"@ (& 㿠`  `"` `" && &`&@㿠`  `"` `" && &&㿠`  ``"` `" &`&` &`&`㿠`  ``"` `" &`&` &` %&`  7& "@@ "@@ @ "`@`"`` &`㿠 2   \ `  ``"` `" &`M&` &`&` (   7&  (& 㾘N  ` (?#8 28,28`;97 5i @!N :2&!&&al  㿘1!l! )`"&` @ "&` ` a  `&`&!l  㿠31al   #ܐ" :  ` :  6  @4  H A[&&al  㿠1!l%` "" 7&"@@ "@@ @ "`@"  &&`&!l  㿠!l "`" `c(* @`  `  @E  &*37ຒ `""` '`"@@ "@@ @ "`@ "  '  &"!l  㿠31al  `* @   @ "&&&al   &&al  㿠31al   #X `"`ƒ 2&al  㿘!l"  `  ` '` 暐1#@`* '`#  # * #"`#"@@ "@@ @ "`@&#`1^ #D@#D  `P&#D$"c8#D}*`"c>` @!: @&#D#D* #$##8#T R!?"2"" , `!,(`@* `  `"#"@ #"@ J!T # * #`<` '`  g   #ܐ":  ` :  @3# H&"al``@E=!㿠31al  @ " 4   #ܐ" :  ` :    @2 @=     ' &al  㿠31al  `* @@ "&{&&al  㿠!l "`" `c(* @  * `@( `@ؐ&8` Q&"al  㿠31al  `* @@;᧐ "&2&&al  㿠 !l "`" `c(* @  `*  @@&8z  &"al  㿠1!l`c _   "(8    ;!0&`&!l     )!0&`&!l   (  , !0&`&!l   "w   &`&!l  !0&`&!l   &`&!l  㿠31al   a&&al   !&&al  "    !&&al   "}  Q  $   "A]=ݐ h`5" h "!橐, "  " " " " * & " !&&al  㿠@!l      `"`"   `*@ "         㿠1!l  `* @D``@  `  ``" ` `*@ " ```  "` 2&` &`  㿠1!l  `* @ ``@  `  `"`" ` `*@ " ```  "&`u`&`  㿈53l`  @& ` `* @ +&   2`` "!`  @    "l庐`&  "&?7&?&l` 1"c@c@ &c@    c@  "     ;h ;` !`;h;`hl`@d;ppt` "&&&l` 㿐53l`  @& ` `* @ +&   2`` "!`  @    "lA`&  "&?&?&l` 1"c@c@ &c@    c@  "     ;` !`@;hh߄l` "&&&l` 㿐75l  @'   `* @ +'     2` !  @    l̐ &  "&?I&?&l #@ & 3  '     * u! F@A" `&   "     ;` !`;hhl  "'? '?&l 㿘53l`  @& ` `* @ +&   2`` "!`  @    "lN &  "&?ː&?&l` 1"c@c@ &c@   ;`c@;``@Wd@A "(` `   `@u#ؑ #\@M\ \ " @F'"`  "&&&l` 㿘53l`  @&  ` `* @ +&     2`` "! `  @     4" lƐ`&  "&?C&?&l`  @"@@  & @  `@`  `  @? 2R``  @"M`3 "`" `c(* @$@:  ` : @Ēcܒ"@:` @ :`@c('@:  ` : @.=c(, @ @`7` "$``$` ` @ " @8``.@ ' .{@ y. u$@@"` @`   cX@"`@@."@` @Ԑ@"`%`#  ` '`  3@U`   @M ܠ `  $ ``'  ` F`` @6 $ ```*@ `*@ '``@ '`` ސ` "&?\&?"!l  㿐53l`  @& ` `* @ +&   2`` "!`  @    "l➐`&  "&?&?&l` 1"c@c@ &c@    c@  "     ;` !`;hhl` "&&&l` 㿠53l`  @& ` `* @ +&   2`` "!`  @   q "l, &  "&?&?&l` 1@"c@c@ &c@  `Kc@` `  ?`*  "&}&&l` 㿠53l`  @& ` `* @ +&   2`` "!`  @    "l &  "&?>&?&l` 1@"c@c@ &c@  `c@` `  `:ۇ  "&&&l` 㿘3al &   ` "   " al"`"&al``1"c@c@ &c@   c@ ! "   ;`` !0& &&al  㿘3al &   ` "  \ " al"`"&al``1"c@c@ &c@   }c@ ! "   o;`` !0& &&al  㿘3al &   ` "    " al"`"&al``1"c@c@ &c@   *c@ ! "   ;``  !0& &&al  㿘3al &   ` "   " al"`"&al``1"c@c@ &c@   c@ ! "   ;`` !0& &&al  㿘3al &   ` "  !c " al"`"&al``1"c@c@ &c@   ܄c@ ! "   v;`` ^!0& &&al  㿘53l` `* @ %&   ` "  "  "lĐ`&  "&?A&?&l` 1"c@c@ &c@    "c@  ! "     ;``   ?~` "& &&l` 㿠1!l &``   ` "`  $ " `!l"`"&!l```&` !0& &&!l  㿠1!l &``   ` "`  &p " `!l"`"&!l```&` !0& &&!l  㿠1!l &``   ` "`  %: " `!l"`"&!l```&` !0& &&!l  㿠1!l &``   ` "`  ' " `!l"`"&!l```&`U !0& &&!l  㿠1!l &``   ` "`  )Ζ " `!l"`"&!l```&` !0& &&!l  㿠53l` `* @ %&     ` "   # " lL &  "&?ɐ&?&l`  & *  "&?&?&l` A㿈53l`  @& ` `* @ +&   2`` "!`  @   9 "l`&  "&?q&?&l` &` 2  `@. ` "&T&<&l1  ;`= ;``@d @   ;`.;``@d#pp|a8 |a@H;h;hhl` "&&&l` A㿈53l`  @& ` `* @ +&   2`` "!`  @    "lX`&  "&?Ր&?&l` &` 2  `@ ` "&&<&l1  ;`١ ;``@Ld @   ;`ْ;``@=d#pp|c |cH;h;hhvl` "&}&&l` A㿈53l`  @& ` `* @ +&   2`` "!`  @    "lܼ`&  "&?9&?&l` &` 2  `@ ` "&&<&l1  ;` ;``@d @   ;`;``@d#pp}b }b H;h;hhl` "&&&l` 㿐53l` `* @   "!  9{ "6l  "& & &l` ` "`s` ` `  ؏!;``ւd  "&&&l` e1` ` '` O ١O  a >O _:O +O -` `  M!;``@d' Ē #    '  O 쌐O - +*` -*`  "\g N  "&!&&l` `   !;``d  "&&&l` 㿠!l  " ` " !  * "   "`& `` R        F"aa J 0=a  8a  7a J 02-/ @   "      2   "      ~#D#  S   !0 "   A㿀53l` `* @ !  " !  + " l  "& R& &l`  ` D@` `  -` `  ;`&;``@d: #ppa bH;h;hh l  "P& L& {  "E& A& " y #     '  @ ` J: *2J : "":$ &J: *"4J&"!l  㿠53l`  @& ` `* @ +&   2`` "!`  @   M "l &  "&?&?&l` 1@"c@c@ &c@  `'c@` `  `@̐  "&W&&l` 㿠75l  @'   `* @ +'     2` !  @    lٛ`&  "&?&?&l #@ & 3@  '    Ժ  @6q"``&      ԧ @拒X` "'?'?&l 㿠53l`  @& ` `* @ +&   2`` "!`  @   l "l' &  "&?&?&l` 1@"c@c@ &c@  `Fc@` `  :`@B  "&v&&l` 㿠53l`  @& ` `* @ +&   2`` "!`  @    "lغ &  "&?7&?&l` 1@"c@c@ &c@  `c@` `  `Ҁ  "& &&l` 㿠53l`  @& ` `* @ +&   2`` "!`  @    "lO &  "&?̐&?&l` 1@"c@c@ &c@  `nc@` `  b`"  "&&&l` 㿠3al &   ` "  = " al"`"&al``1@"c@c@ &c@   c@      !0& &&al  㿠3al &   ` "    " al"`"&al``1@"c@c@ &c@   c@      !0& &&al  㿠3al &   ` "    " al"`"&al``1@"c@c@ &c@   ҃c@     w !0& &&al  㿠3al &   ` "   S " al"`"&al``1@"c@c@ &c@   5c@     ) !0& &&al  㿠3al &   ` "    " al"`"&al``1@"c@c@ &c@   c@      !0& &&al  㿠3al &   ` "  !  " al"`"&al``1@"c@c@ &c@   љc@     э !0& &&al  㿠53l` `* @ %&   ` "  " b "l &  "&?&?&l` 1@"c@c@ &c@  `<c@` `  0`  ?ܐ  "&g&&l` 㿠53l` `* @    " !  9  " ռl "& :& &l`   @     ϓ "& & &l` 㿈53l` `* @ %&   ` "  .  "lo`&  "&?&?&l` 1"c@c@ &c@    c@  ! "     ;hѾ;``;h;`hl`@d;ppϫt` "&&&l` 㿐53l` `* @    " !  0 L " l "& & &l`  "@@  & @   ;`f@;``@2d;hhWl ^#ܐ":  ` :   @  & &l` 㿐53l` `* @    " !  /  " ԣl "& !& &l`  "@@  & @   ;`@;``@d;hhl #ܐ":  ` :   @6  & &l` ??㿈31al  `* @    `"@@  "@   д@ h F `@;h#pph`p @ F;``Ηd #ܐ":  ` :  @ڔ &&al  㿘31al   @Đ`"@"`@@  @  #@@:#ܐ":  ` :  @ a0&&al  㿐53l` `* @    " !  1  " Ӭl "& *& &l`  "@@  & @   ;` @;``@d;hhl #ܐ":  ` :   @?  & &l` 㿐53l` `* @    " !  2  " El "& Ð& &l`  "@@  & @   ϥ@ @  ;`"|`d@0;``@td;hh͊l #ܐ":  ` :   @͔  & &l` 㿐53l` `* @    " !  3  " l "& Q& &l`  "@@  & @   3@" ;`"`d@/;``@d;hhl #ܐ":  ` :   @[  & &l` 㿐31al " ` *`  "@@  @   '@''#Ё @߼!;``@ߴd'' ǐ#ܐ":  ` :  @ &&al  㿘53l` `* @    " !  N "  l "& & &l`  "@@  & @   i@ !0 ƿ!!;``Vd ]#ܐ":  ` :   @  & &l` A㿈31al " ` *`  "@@   @  "`d@  `dO@B c&#hˈ #ܐ":  ` :  @O &+&alhb؁bF;`;``d #ܐ":  ` :  @% &&al  A㿈!l`" ` *`  "@@   @  "`d@  `d@J` "JJ` a "JJ J 2J 0"J x c s c &#h  x#ܐ":  ` :  `@ `*&`h  F;`;``Hd  O#ܐ":  ` :  `@ `&`"!l  㿠31al  `* @ʖ "&!&&al  㿘75l#@  `* @  #X (  $`@&    "   `ˬ `& @   $`   ˝ `"    '  G E    6@", @"`"'$  2  * %   %    sf   x M  s*`," (" " $$&l J! `"!$&l 㿘7l5#@3@ `* @ &   '    ` `&   '    ` `    ' f@`:` @ t:`q`"`   v   v ј  v`*`,`" (`" `" $ /Q  =  * J H*  E @  :*   `* *`1 `*  `**` (  =   :  *@"` =    `*    `* * `* `   &'?&l 㿘31al  `* @#X (    `"@@@  "@  F@"`$`  ' ̪ 6 8"' @Ԑ` "$_$&al  㿘53l`  `* @#X (`  1"$  ' `a ` ` '` `S`  6 @   ͐" `6 @8 t"'`@i "$$&l` 㿠3al!`1""`#(*` #(" " :` @ :` ` *` :  ` : @r#(,`  Ð&&al  㿠31al " ` *`  "@@   @  "`d@  J `d@J  #ܐ":  ` :  @̔ &&al  㿠31al  `* @  : 2    v      "`@  "@@  &@  .@.. * '   ' #ܐ":  ` :  @z &&al  㿠53l`&1 `* @   "`d ` d8 `` "`d`  d)@ِѥ&&l` 㿠1!l`"2  `* @Y &`#    "`d N d N a "&!lN@ .&!l  㿠1!l`"2  `* @ &`#    "`d N dN a "&`N@ .&`&!l  㿘!l "2  `* @ & #    ' ݪ @@ !N  "N@ٚ .*N"!l  㿘!l "2  `* @̣ & #    ' h @@ !N  "N@p .*N"!l  㿘!l  `* @    '   N ` :Ý *  `  :`ސ` ` " '""*! \N 2NN 2 NN _"N*N*" '2N*` `""``* &`` &`& ɐ& "!l  㿠 !l`" ""`(*` ( "  :` @ :` #X (  n `-#@  &?@8 9@ &    (    }@8; !9@ &    4"2` " @"  `` `@`@(x"%``% %  (     @'  .#(  "  "!l  㿘31al ` *`  " &alalcܸ"@ :` @ :``   @  )`"`ٻ'` ``  @'E 2%&alt&alal " &al    @'+ 2 &ala'``&al    @ss@sl㿘3al&  @'ѐ"́ 1 ' y   @  {2 &!&&al  &al `㿘1!l&`` @'"  ' B   !0&&!l   &&!l  㿘 !l`" ""`(*` ( "  :` @   A:`8> !5    '  ` " @"  `` @E"g@'#$$(    @&:  .`#(   "  "!l  㿠3al1 "`" `c(* @    @& " &al&&al!&&al  㿠7l3l" " (* " "  (* #X (`  "@:  ` : `  `  @% % @"@@  @  @ 6" * @&&l!&&l`  &l` #@<!75@3`&      Ģ 6 "* %`@  %` %`* @ %`%`2`` 2 ` "` `@(`' "!l  㿠3al`""`(*` ":  ` : #ܐ":  ` :  @ ן&&al``㿘!l "`" `c(* c($:  ` ': ׂ'3     `А"`` '` Ƃ  ߠ . #( #ܐ" :  ` :    @ ""al  㿠!l5` ""` (*` ('@ `:` @ :``7`#@7@&      þ ``   @#X ("@:&   `   á         6@ ,   $      %@   %:  ` : Ϫ " (* @Լ(.` `   `  @$@ 3#ܐ":  ` : 6(&@:  ` : @Д(, @  , ,`@ԍ (  $`` ~ 2 $`* @!*`  "  &  ( "g`$`,  $  ذ &4  `@&" ,  " /`# $ ""# "4 /`  " "` `@" " ,  ,` /`@@z. `*`   `!*" " `,   ̈́ & j `` ,`-,`@@`,`P6( ` " :  ` : @4 /` "@@', ""` `@"  `@&"  `@@&  `@"  `*` /`" `""`"2``   &   ```-#( `   `  @#  `$`,`@p (  `a 2$`* "@$`.&  ( K` $`. п&& 4ސ!& "!l  㿠!l "`" `c(* c("  :` @ :``@` *`  ` ̑``w``@ . #(   Z`   & "al  㿠1!l`Ӑa " &` `(`"&`&`&!l  㿠1!l"  Dcܒ"@:` @ :``@  a&&!l  ! ` ( Ԣ&&!l  㿠 !l "`" `c(* c(":  ` :   `* @&:  ` `: @ ``Ȕ @ #(.    `  H & "al  㿘1!l "`" `c(* @    @! \ "' ' *Q  `* @&@:  ` :    @h2 x` #     '  ?`    "  (  JK *+ #  8J * &   &   "&Ȑ&"!l  @?@AxxxxxxxxxxxxxxxxxxxxxxxxxxD $@x4x xxxxxx xxxxxxxxxxxD $@x4x xxHx xxx x@ x @01!l" "  `  ' x   ' #xxh#xx @@#``   `  @  "C`N` a N` x& N N x" & @N   N` % #``#`J a `J *2```J` 2`#``J *"``@!?!;?#|?;#??#\;x %#t;O ` *O (  *2O  "t  `@O  " 0O  -`O  * "`0 O  2-` " &`%!`S“*`@@`' J 12 ` ;*O `t@$x@ # x%@%@ #4%@@ ܐ#H%@`ǔ`A.'  "   @ `J` " "`J`  `"`  @ `J` ""`J`  2"``*` `"  "`#ܐ":  ` :  6@e %?$' J *%* @4`* `u~! H`H!$  !@   J  *@ J  *@ J  *@ J  *@  J  *@@ J  *@ J  *@" J  *@ƀ` ` %``J @6 `׀``bM А%`<`" Ȁ`Ő%`,`" ``#l`b "` |@ " ' ` `%'``<M  0*@*`'``,M @  0*@*#ܐ":  ` :  @  Ylr$ ' J *%* @4* Ɛ`#p`h "` |@ " ' ` `''< M J **`',M < J@**#ܐ":  ` :  @ = p$%@`%`M ' "!'"`@4M`#ܐ":  ` : @ %`M '"!'I %Ð$%`4M؀`%@`͒%`M '@"`4MÀ`#ܐ":  ` : @ Ք%`M ' Ћ$%`4M`%2 @'`%`@v W怐@$ `#ܐ":  ` : @ u%`@X Ԑ WN%`$c`%2 @'`'W%``v@7 䀐@$ I`@+ 䀐 :  *`@* $ 2 @75`#ܐ":  ` : @ F"%``v@ ~ Z%`$ `@ k  `:`* ` *`2`=7ې%`$`%2 @'`"%`` @Ɣ @$ ؀`@ͺ $ F;ɀ`#ܐ":  ` : @ ڔ%`@͙  Ϗ%`$`%2 @'`)%`` @x 쀐@$ `@l 썠?Ȭ JF$ ;t`#ܐ":  ` : @ a%`@D  :%`$O`%2 @'`"C%`` @# 耐@$ 5`@ 荠$ F;&`#ܐ":  ` : @ 7%`@ r N%`$`%2 @'`0%`@ؔ `V`  2 *` @ \  *@ 2 @'? JF;@ؠ$ ʀ`#ܐ":  ` : @ ۔%``V" \@̗  ?Ƞ J;;g΁%$`@y   `2`?*  @ @*2`  'Ƞ J;;<V%$l`%#h2 @'4#ܐ":  ` : @ vR%`h N@2 Ů %`"%`$9`#ܐ":  ` :  %@ J %  &`@ ń #d`)d$%2 @'`%`@ ܍&$ F;`#ܐ":  ` : @ %`@ʔ F ܍&;ͺ%`$р`%2 @'`Š%`@˨ Р$ ԽF;`#ܐ":  ` : @ Ȕ%`@ˇ  b|%`$`%* "@:  ` : '耥qM nM aj/M" ?N  M  M" ?  M  M" ?  M  M" ?  M  M" ?*`*`;  /̑+ : /͑* `/Δ ̔ڐ%``M 2M " M M a&/#ܐ":  ` :  6@ ' $`"`b &`@ %`  ` & @ْ 2` 6# *"  @'#? J;;M`' 'Ժ'``Ѝ^''Ԁ` !`Ժ'``Ѝ^''Ԁ '`ԍ^ "`''2 * " ' ԽF;)ԍ ;@CАԍ ^;P#ܐ":  ` :  6@ Z$ `*}O "!l  㿘 / /$+N` ?:  @ /' N`N`* : 0  @ /N`N`* :  < @ /N`` ? @ /  4N` J   `J "*J 2J#\̔ H\L   $ ,LL  < ( , ԝh1!l "`" `c(* c('@`:  ` : #\  `* @ "c@c@  `c@  'c@  c@&:  ` : #l *7?! 5#!@LL *  &@c   L   L" 0L  -L* "`0 L  2-$`% $`S*`@@@#p %~ ۀ :@# `"@"  `* ~  !͔ % Ŕ%``  ' ' '$J *~!`A%    % 6  x ?? % ?yi%``  ' ' '$J * :   ': `@ "   `@:   }   ' `B'1 L  *   *` ' &L L  : *` ' &L "`B   *   : *` ' `  Ф*  ' (Ƥ%``  ' ' '$J * 2  :' `@ "   `@:   ܐ   ' `H''J L   L  L " *  *` ' &L(% L   L  * L * " :  *` ' &L "  *` ' `  !*  ' (%%````` ' '/  & %1%`````    '쀐$`׀Ӣ%1%`````  ' ' '䀐$`%%````` 7 7ޒސ & %%````` q * :  :  *`@7ޒސ & qm%%````` 7K 7ޒސe & RN%1%`````  ;`j ;``@d'ؒؐ@ $`-)%%````` ' '! &  %1%`````  ;`& ;``@d'ԒԐ $`逤%?#1%`````  ;` ;``@ƪd 2 *` @ *@ 2@ 'Ԓʔ ج%%1%`````  ;`ϐ ;``@zd'ԒԐ $`%%````` 'l 'ВА & s  dl%%``   &  ' '` $`M%``  ' ' '* @ `@ * @ t  -@ * "@ "@' '8*L ~0\#(*`  " "!l  㿀!l@ "@@  & @  @`&  &  ' + @`$ #d#l (#h0`   `  #`@#` ##p`#$ "`$    $   !$ ` ` `4    `4    `4 ` ` F` 28 > (   ( ``* (  !* " "<ƒ #($:  ` `(: " " * &  * "!l"`(#( $:  ` : #t8 "8M` a " 8 M 2 8  @#d8 "cd 28d 8(P& !@M   @`@M`  "`@%@J`2  ":  ` :  `@F $M  " ` M  2 `2^ @`( 274 UM  ``@J` 2``@A$@S`2 ɐ ":  ` :  @ `$# $4  `e8 4  J   ! @ " @  !ဦ`&M#M  " M@ߐ *MM  M2ՠ%`2 ] ":  ` :  @  $ u4%@e`2 2 ":  ` :  @@a $ u42ܠ%@@` d@{#d x #\ @p n`, "``," ``,% $@ ` "m`2  ":  ` :  6@ $` "8``   *3` ``   ">`6 `2 į ":  ` :  `@ޔ  $` (``   p @gp#(t $d:  ` : "@@# !`l $l 5``2`   ,`&`$`&   "&``$א`2 M ":  ` :  `@| $`<#(9$:  ` : "`h " * @&  * @'!l" (``'  " :  ` : .`  @I @ '!l  `  `"!l  `1$  1a$"al    `* @: zŐ$"al  @/#㿠!$!l#(&@:  ` :   (!l㿠!#d*`" 2`@ :`"#d#d * @* [ $ c``㿠3a@@2a@!* "@2  : "* B $ a@ &a@* `"@a@ a@  a@(`ā@ 㿠1#@2#!* "@2  : "*  l$ l# &#`* l"c  c(`l@`@@㿠!# Pa8" :  ` : * $2  : *`a8$a8a8@"`a8@$ P㿠! ̕*`" 2`@ :`"  ̓*  $ ȁ㿠#H#L  * ` " & `* "@" t  4 㿠    ``̐  $`` &`* `" ` &``ȑ* " ` &``ȑ*  " N  ` "`  `` G ``B  `` = t `  "! 1ynN!J#` " N! "  z  t" @ &    2 @' .!  1"`8  @& .#0 ".#0ys.#0㿠  ``̐  $`Q` &`* ` " ` &``ȑ* " ` &``ȑ*  " ې &   `` G ``B  `` =  `  "! 1xN!J#` " N! "  y t" @~ &    2 @' .!  1"`8  @& .#0 ".#0y.#0㿠 ``̐  7` &`ȑ* " `&`        ` `ȓ."@ ` &`ȑ* "   "         ` `㿠 ``̐  7` &`ȑ* " `&`       ڐ ` `ȓ."@ ` &`ȑ* "   "        ߽ ` `㿠 ``̐  !Y` &` ȑ* "  ے` &` ȑ* " ` &` ȑ* " 㿠 ``̐  $`4` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠 ``̐  $`` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠 ``̐  $`` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠 ``̐  $`` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠 ``̐  $`` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠 ``̐  $`` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠3``̐  $`c` &`* `" ` &``ȑ*  " 㿠 ``̐  $`G` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠 ``̐  $`$` &`* ` " ` &``ȑ* " ` &``ȑ*  " 㿠3``̐  $`` &`* `" ` &``ȑ*  " 㿠3``̐  $`` &`* `" ` &``ȑ*  " 㿠3``̐  $`` &`* `" ` &``ȑ*  " 㿠3``̐  $`` &`* `& :` @ ȓ:`" ` &`ȑ*  " 㿠 `̐  $ &* `"  &`ȑ* "  &`ȑ* "  &`ȑ*  " 㿠 .`"@`̀ d`!   &!*  ȶ "     & ȑ* "  & ȑ* " $㿠 `̐  $4 &* `"  &`ȑ* "  &`ȑ*  " PX$h4x `  X㿠?q# ` -)"' %`5" &` * @0 o*  `7" &` * @ `" &` *  ސ .0 ".0uߐ.0T``" &` * @ `" &` * @   `  '`  "` `  `@:`` {`  "`8`  @' `8* '``" )7 "  .0 ".0u.0``" &` * @ `" &` * @ `  '`  "` `  `@:`` 1`  "`8`  @' `8* '``" ߐ&7 .0 ".0uK.0``" &` * @ `" &` * @ `  ` " ``" &` * @ `" &` * @ `  ` " ``" &` * @ `"`&` *` `" ``" &` * @ `"`&` *` `" p``" &` * @ `"`&` *` `" _``" &` * @ `"`&` *` `" N``" &` * @ `"`&` *` `" =``" &` * @ `"`&` *` `" ,``" &` * @ `"`&` *` `" ``" &` * @ `"`&` *` `"  ``" &` * @ ``" &` * @ `" &` * @ ㎐`" ``" &` * @ ``" &` * @ `(``:"``" &` * @ ``" &` * @ *  @` 8X``"``"`p#`"`Q`8 "`tʐ`    `  " ``` h`" hQ}` "``  " `` "``* $`` "d`ܐ`` 'o`    ' '_ ' `@" @``" &` * @ `"`&` *` ``"`&` *` ` ]$``" &` * @ `"`&` *` ```" &` * @ `"@&``oq `4`㿠3al#ܐ" :  ` :      @ *#` a&  &al  * @*` ` ``  a0& &al  `& &al  ``㿘31al " `    '  0Y  0 " 0 0 ( " 0 0 (@F 2  0 0 (J " 0 0 " :j 0' 0 :7 8^ߔ' 0 0   a " 0a 8 0 (&@" 2 8 8(7 8 8 "&al 8?a 7 8%P   `"`&al  㿠7l5  `* @* `@``$  `( `  0   o&`  @@ ) $ ,'  `0Y,`%, `, #\  @gN 2K,  "d` "`x`2 ` `"`` `"`` `"``" `* '`` '`` " rd Ԑ" m' `  $`= `" &`&l `0, "," ,%&`@ `,`"@&`, &`("  &`$,$`%,&l ( dtT$  H !l#x "`" `c(* c(":  `  : ##h #p@#8@ #\  @  3p * "@ !<#       '   p, p    ``@ p       p@`  p` '` p @p`` `   #|! #t#l#cH *  ` " L`- `"`2L`@xh @h #h J! tmՐ 8˔l` ` '`  #d4@@" J?"J  " *J" l`  ` '` #``Z#``#d#` M 2M`}%? *Mu* M2`J  ",`M   \ 2M "`M? #8@M *M2 `J  2M`;%@8#&3" -" 4-,(#2`@: & " -" 4-$  dJ`-?` -"2J`\ M` M`   `J` J`  2` l` ` '`  #d#  J  2`$  *J    %`"` *  p  ``   ``@ p   ``  Q         `` "#`  &-" 2-`|  `  ! & ; @f&; @]`%J`   "`J`   `I*`.# A-    %`"`   H@` %' @ @8 T  " H#(*` "al  '`  #&" -" 4-& %@   .    .%J   .%    %J  2% .---- 0   %`"`   H`@" H#(*`  " "!l  㿠51l3  c(* @- " & 1    @ "&l#ܐ":  ` :   t   ' &l    ! c(* @ &l#L#H"cL 4 f a! 1 c(* @  w"  4`` "`&l   2 t   `d@X㿠 !l( ":  `  : `  " ``d"? "   "``" $=  "   "``" &(":  `  "`: `"  #ܐ" :  ` : 6  . " `@"?   "``"  ""`"2 " `@"?*`#( "    ("  ' &`'' &`&`2 (   "``@Z " &  " &    " "` "``"  " &  " &  c(* @1    @ (  `* @ n(#ܐ":  ` :  d &"al  .`"al  c! "  c(* @  w" `4`` "`"!l  㿀3al1 "`" `c(* c($:   : * c(    #p @o#p p`  a$&al    @nT        "`#X `' ="! `(`" `$" `(`` (`"  ` @     8"`` \`" ` , "    @ܐ t @֐ " `,`@ː @Ɛ ́@ " #X '`71 $ `d` ` @"  $":  ` :  …`!(#`Ő#L#H"cLm #\ ( $  ``( *`( ? ('\:  ` (#d: `"`   "(   (* @#h"c   (* @#l"!l !"(#H !  כ "`a ה "`$#H      c`#d`@!#`` "`c`"`#` #%* @ * @'" )"+cX-"8" :  ` : "#"a@" "p*"c #@[ " %* @ * @ d #( $cX 8*` $ %# %a@ % #(' :` @`: a(`"`  ##( h #(* @ c l #(* @ al\ (#ܐ":  ` :    !u#(#(#(`P @ #(.` "al㿠1    @   #@  `* @" 2G   " "aa J 07 a  2 a    a J 0 %  # @  "  @      #D    s "    㿠7l     @4 2 &l    5 * @  @3` y@  `$ `     ,@"G b`  V"aa J 044 a  8/ a  Ga J 02$ ?@ "  2 3  !h   B#  %     * @    } &l  v ' &l   !' &l  㿘5!l    @ &3  i&  "e @T    J 02Z #~ @  `' `n @2)  "@ " ":  ` :  6` `R'`x"@  ":  ` :  6`” `'` 3@1  ! @&@ #ܐ":  ` :    `'`3  `* @  @1 "k& @    ֐      ,@"IT& "Q&   "a "G&a J 044a  8/a  "7&a J 02$/& @ "    2#&       B# & "&   `* @3 !&"!l  㿠#` T~"*` *  `   "(@  1 "9 J! "5   * e!+ J! "&   * e!8 J! "   * eߐ!T ` ` " @`  &D㿠@#`*  @*` ` ``  * @(` `D * @(` `D㿠 F~". *     "(3 2 ",J! "(  * ej!hJ! "  * e[!J! "   * eM!ð& D㿠#``E`" &`* @* `@`   "#` /` ' *``  "  4   "  "``"`<2`,` "@  "X``  c(`4`㿐'H'L'P'T'X !@H'c! `? ! 7 `<`231al  & `P /#(&:  `  : "`#ܐ":  ` :  `푔 `x N$` L&al@1& 4 4` $ 4#@5  4㿠7@ @ m@5`` `v] e3 @`@ T  `3 "``` `*@ " ` "``` @@`@ "       `` ```@:   `` ```@`      ~a      ` 3#3  Z wc`&ic` 6c`c`" &c`* @* `@ (*`  "X 8*` " " "@ "    &!`@`e   `&@  "`X !'  "!l!1#   "@@   @  "`d@  `ds@!Ё!@1@53`` 1 | @, |& |@/````&``T2 "Tcx "Tcx T  㿠1!l&``2B  ! "aa J 04 a  / a    a J 0 "   @ " @    #D      2 A  ! "aa J 03 a  . a    a J 0 !   @ "   @     #D  E !0&&!l   &&!l  㿠1!l` O`   ` "a "E&!la J 049&!la  84&!la  "5&!la J 02)&!l-&!l`@  " ``  2&!l&!l  `   "@D# &!l&!l` " &!l&!l  &!l  㿠1!l` O`   ` "a "E&!la J 049&!la  84&!la  "5&!la J 02)&!l-&!l`@  " ``  2&!l&!l  `   #D# &!l&!l` " &!l&!l  &!l  㿠 !lg#`  `` `"@@@  &`@  N@#ܐ":  ` :   є  3  `  , * @  ``` ` " &!$ & `, *  2 $ ``" & * @*```` `   2         `* @`    ,Ґ'  "al  ` ``  I ,' `` `` ```=  ' `t`, '  ``"!l  ` } @`  ``3`4' ` R ` ' !  ' F ' A`&``` `!32 `(` & e& ` b`  &a0W& ` T`  O#X a G3 ` " :  ` : a( 2! W ˮ ` `&a(``0 *`0a(``( *`( a(``@6a( va(a(  ` @o* a(`"`"!l         a' "al  "!l  㿠#!     1"    `" #(&!l z"`#(!l @"!l_!!l   2!l_!!l @  "!l!l    Ґ㿠 `  2 ``  ? 2`   `@:   `` @(? ```@"`  `@  㿠31al   "(`"@"`@   @  "`d@  `d@#X u a0&&al  ``㿠%#9$cX*!;#`!* @`* @ 73 5#(* @&lcLH@$T  ?`@1@  `@  24`@ -ah  ah  2!ah a|  a|  2a|  #    ~", <  !   ꦐ#LH&cL! M!l"! lZ #d#`@#` '#`#`7'#`#`* @`*  @" #(&:  ` : "cX" a8" :  ` : "#"!@" !" *"  <24*6 <``" <"@@ @ @ "` @  u @ ``"&l`$``㿠97!l53" & (* @`  `   #L#H"cL` ` * `@ &   괐1#d#`@#` &#`#`&#`#`* @* ` @`" ($:  ` : "#X"8"@ :` @ :`"c"a@" a"*#X " ('@:  ` : "$` $"(` (",` ,"04"4"`  "8`  @ $"<?"@'!l ("<($  (:` @  :`" ('@:  ` : "@'!l` 㿠53l`  `  vn|#L#Hf"cL1#d#`@#` &#`#`&#`#`* @* ` @" #(& :` @ :`"cX"!8" :  :""@" "*cX`" #(&:  ` : "$` $"(` (",` ,"0"4&l` 㿠!l#` "`"#`*` * `@  `(* `##X` !8* # `##`#!@` `  * (@  @ `&! &   &"!"!l  㿠;9al7 5" '  (* @!((@ 13# c`@" # c`# 61# c`@$("# (   " ( 'al 1#`6#`["H#` 6#` #`" &#`* @* `@(* @"cX a8* @' "c"a@   "   "  4   "  ``~"`<,{` "a@  !1q"X"R `l` "K       "a "? a J 0V`a  Q`a  "/ a J 02F`'  @  "     28`       #hD#'`    ` `p    `p   v`p ` `@)oe "l`  &! &  &"!"!l囁}"㿠3!l5c`7* @* @ 1 (* @   c`6c`^" / 6c`  S"c`@6c` c`" &c`* @* @(* @"cX a8* @"`"c"a@    N  (*`  f (`  "@  ,"`X  "  4   "   `"`< ` @0 $! $ `%`@ $&"!"!l֑"ܝ㿠1   7#`1Ǒ"  61  #1#`@6#`i #`* @* `@  (*` "l 8*` " " "a@`l* @"       㿠1   #`1x#( I 61  m#H1#`@6#` #`* @* `@  (*` "l 8*` " " "a@`l* @"    诐   㿠    "    "  !62& &&  "K&  "   "   2   "  @  2  2  +1#"$  &`  " &`  2&&&"2#& @㾐'l `     2 `  @  "   2  (   , 1 4 m`4  #h#1#`6#`# ;-#`* @* `@``  (*` $l 8*` " 'c "a@`6l#\  `  l $l`. @ l$l 4   " ` ( ` `* (r5`4  `"`<2cD c* `l@"   甐 Y#L#H"cL , "* H (  % % 8  ,!#($:  ` :   0 #( ,;  @  $`  <4`4 <``" < < "@@ "@@ @ "`@ < d2 J! "  4    "  4     4  $Y#  `<@q6`<*` "```` `` ``$W\!-;?   @"@@ @ @ "`pn@1%J` @2 J`ppa  % mpU  t pL % $ i pA #$ %%4\ "po  p+  *`( <p# < "`     <*   "`\` ^`  4`` `&` `&` 4  `"    /    "      " `:  :@ "  "    & " * .  "`  "`  & .@i  " 7` ` ` @ " `&`2`"!l $  "`d  d^ ``   ` `#` `#L`  &#`' B7*` * ༒`      * "  `    ( X`  `    #U # & '`D<ༀ  @5`60 & `* @* `@  (*` "l 8*` " " "a@`l* @ $     ` "&`&``  2&`  ! $ 4#,`$ 4,`#`(@ " 4#@q "!l㿠31al    `"@"`@@  @  @9a&&al  㿠` `  ``     @:  '@Zn`@  㿠)'!l; 'a@ⶐ b _ (\!⪐!⧐!⤐!$P!~ ! $!!n#n$`(%$"a"a o`(`(  "`n"  `( *`( n8 n4`(!% " @!X3 c#&c#,n9"c,c,' X7& $XX53" (+ ,Ӓ &c`` `D`0 -ऀ ) X % l"@@ "@@ @ "`@&2!q X %  X%!l"  X%!l H$#@ X   X' X#`"`"#`*` * `@  `(`$X` 8* "`"`"@`" ` 'a@  ' Xύ1c   &        "`d   `dD  4 l&  "     "` &a%``%!l >W%*͝㿘7l   9'  4   א @?;` D`   "`d  d5 8!0' &l   d!  &  L`ԐL`  lJ#` 3"@Vp`` !1+`p    `p   `p ` `  gŖ  a  !0' &l` TfJ `/dJ `.9&J `/]&J `.9&J `/U&9&#@ <`p    7&`p    e`p ` `   ; lK  &`@   &   M @@ ؤ`N` .N` /"`T    @$А&@`̤X!j1&!/ !1 #&`@̔P` &@`Pߒ` &@aB a'``"al `p    `p   `p ` `@!`` g`gY @N#L#H"cL ̒ '1 K & "#,S᝴w#`3"#`1` #d#`@#` &#`#`&#`#`* @* ` @" #('@:  ` : "#X" a8" :  ` : "#"!@" !"*!@" ` "$"( X", "02!"!l" 4x75l   &   ``  ` '`  !4  J#` "@TВ`ݓ̇ߟ#L#H3"cLF!1 L`" L&@Œa(O&aܒ R2@̐ܔ$#` "c`6 #d#`@#` &#`#`&#`#`* @* ` @" #('@:  ` : "#X" a8" :  ` : "#"!@" !"*!@"  "$"( X","0 耢 !c@ a   5Đ]&l!& &l 㿠3!l#`"`"#`*` * `@  `c(* `"X` 8* "`"`"@` ``"a@`` "`X`7  @? ($2$-#ܐ":  ` :  c($:  ` : K c(, @ !$@  (2``&``@( !3v"!`O` O     C"aa J 0^a  Ya  "4a J 0N, @  "     @      "hD/ ^ (#`p    `p   `p ` `@we !1 ,#`   "!l㿠53l`  `  #L#H1"cL` ۵ #d#`@#` &#`#`ے&#`#`* @* ` @" #(&:  ` : "#X" a8" :  ` : "#"!@" !"*!@" ``"$"(`X","0`"`X "!@#`   &l` 㿠1!l#`"`"#`*` * `@  `#(* `"X` 8* "`"`"@` ` "@  P"`X 3  @<` *`1&``-&#ܐ":  ` :  #(':  ` : ޔ #(, @ !'   *2 8 &  ( 8"!#`    "!l  㿘 #     '  &* "@ *    2    84`     L      "' ^  @"OL  ^I ~"O  ~  , , `'`  "4`4`` 4`4``(`  4`4`` 4`` 4` `"2  :  4` 4``  4``   L ^   4`` '" 4`4``4`O *`4` 4` `O #f`O . O  #^` O >  O >  O >"  #O O |2O  O |  O |"   O <   O <  O <"  O . 'O  . 'O  .'  '`4 4 4``41  ` 1  , 4`'`" O #2O  O #" O .'  O # O #" '!@' 4 44 4``"2  : * ` ` `  `@:   !  ` @  &㿠31al  `* @"@@   &@  "`d@  `d@J#` "@P` Q:o# p    Z $ P  ' " `   2 `":  ` :  6` `'` P 2 `Q?* A"T":  ` :  6`ؽ `}'` ` "@ `א P    "`   "` "`?"cT      !&&al  "!l  㿠ێ !l"`"!l`"`ۄ  W -u"`ٰ㿠!l"`"!l`   "@@   @  "`d@  `d(@ ǔ "`uf`` `u^㿠3al "`" `c(* @":  ` :  !   `* @ @/   "`d   d      "`d  `d`J` ,`#    1\ "   " Ő "`d  d`J`  Nِ!!0&&al  㿠!l "`" `c(* @" :  ` :    `* @ @/s    "`d   da`     "`d  `dL`N` ,`#   ` 1Ԓ `" ``  "`! =`` "`d`  d`N` !W!$㿘31al  `* @   "   P      ' #\ #\   @5    " ,   Q&&al    Q&&al  !&&al  !a(㿠31al   #`"`#ܐ":  ` :   ֣  @:8  !0'  ' &al  㿘1!l&`` `  `            x ` ```  `   `  ` ` ` " @9ߒ   @9ג @e L&!4@"` &a8@ "`$ `$ "  <*V > *V` `"  $ " !0&&!l   @  @4  $  @ $@( !a4!&&!l  㿠31al  `* @   a&&al  `$  `  `   "  " ڐ "&Pe&&al  !&&al  㿠31al  `* @   @- @+"@@@  "@  @@J#` "@Ma@ P#ܐ":  ` :   Y  ' &al  㿠31al   a"&al  #ܔ"" :  ` :    0        "   a0"&al  !"&al  㿀7l5 ` `" *`( ($ :  ` : "  !H  !P !\!h  "d "_  ` ``"Y  @ '' B/֐ 1& #ܐ":  ` :  `Ա `$`z&l& "le[l y    ; q q   1 P P  (.`  " &l        "`d   `dI !t挒㿠1!l`    P`   q` P`!0&`&!l  㿠18!l`       OW q OS P "  &`&!l``!&`&!l  㿀!l " "  `"  q`ea  a"  ` ``!& !̐ " ` ``| @ '' B(/ 5&e & #ܐ":  ` :  6$Ӿ $$@`  `    ѐ!j$ $ʐ c$ $$y& &" dH g` &&`d& &` &`F&``&` &`y& &" d+ J  P  &  匐!ԁA.㿀!l`" "  ` *`    "   @&$<` @* $@ "@@ @ `1   Ɛ х # އ!х>?B#'ĉ FD'   9#!@`K%`2``  ` "`d` ` d` 6`` ``@ 4 `*` `$*`` Ȑ %  !# ;` @* #@   M@*@ ;`  $@,`@A 7 @ "(@    !# ; ` *`# J @ `*  ;`& @ "M)  Ӣ` 1M'`  `   `# ` …B;`'``d"!l  㿠 3"@@ "@@ @ "`@3c "&cdc&c㿠53l`  `* @`  1" #    "#  ,#ܐ":  ` :     !4$   $  ( Z   @#  L#ܐ":  ` :   ѿ  $ `"&l ` `   o&l` 㿠31al  `* @   #"   Ѐ 3@5 -J!`*!!      ` &"       ``"  ` *  L&&al  a&&al      @ @X㿠`  `     @  Ӎ#L#H"cLI5#d`@` &``%&``* @* ` @" !lc(" :  ` : "#X" a8" :  ` : "#"!@" !"(*" "$*6c"( "@@ @ @ "` @  "`  $㿠15!l   #``"`##ܐ" :  ` :  `  Ц `  `  `   `"&!l  H  H``  ` }  ⟑!✑" WJ` * W ,㾠73l!<c`* 5@* @      $   H`8@!  @"c` @ 2M < 22 D 2 E $"`D D&@ʒa<  "  ` ` ` "(   E̐"`<EƐ","`<   <" }x ` ` `"}x"`@!"`8yc`J W "/ 8 `  $mc`  "`@  &``"     ``$@ @)     H8`"@ " H 8 & 0 $  `ܖ  ``@ ` 4"`8 0``" 0! &  WJ``* W @ Ɛ"0   `,` ᴐ"L  Gc`" &c`* @* @ ` ((`"X` 8* "`"`"@`" `%`` $`J!   Fo"p Fj"  @'   8H`@ " 8<  J! " FS"    `` @|  `    " H  "     ``* J W  @ !0'  ' #p& C&l㿠7l5 1"`" `(* @($@:  ` : +  ``@``c   ``  ` ` Ja`"    "`d  dEڐ" a"cx `$`7Ja`"0      "`d  dvE"   "`d  dbE# '"cx':` @ :`@'^`@3  J W @?(.` 0"  &l  (.` "  &l  㿘53l#@`   `"`& @        ~  ! & @   $    ~ $    ' #\ #\ @,      " ,!0$?&l!$?&l` 㿘;al9 5"`" `#(* @#(&@:  ` :  `* @` `#@` #   `   '  3@&      ~ ΐ# "#x&      }  `  `  `   "#(  "#(  S('`   : |6   < @  a$  'al  "` ` *@  *@ %  @ %  @ GJ#` " #(  t  #(. &``'al @    : {     @ @    @ @ 6 1"`   `*  * %   %  GJ#` " #(  t L #(. {`G`&`'al #(. "  'al @㿘!!l; 7"`" `c(* @c(&@:  ` :  `* @` `#@` 5`  ' m 3@&      | ޠ#0` "#x` 2 `   `T` O  " &      | "  ` @ :@(`&       '   ` `  @  @J! ?  C*#@`C%#``/ c( {  F & $!l c(/  "  $!l 㿠31al    `"`"  @/  &!0&&al  㿠31al   `* @   "" @0 z FJ&&al  㿠5l#@3@&   &    {  &   &    {  "  @0 !0& &&l  㿘7l#@'  &         | 53@&x`  V &     '    "`d    `d~#\\  #\7\  `` 2Q  ` ``"K  ` ``` `"C   ``   ` `` ` `  #\ \` `  #`@` "`  &     '    "`d    #` `d}#\\#`@|` & `  a0' &l` x  &xa'  &l` @㿐75l `* @'   "@@  ' @   ;`|6@;``@d` ``  `   `  }  ` `     1  "  @  & z" #    '  C!:  x! !"   ,@J#`  `#x#@A"怦`  @    @"    L@  .`~b '#  ,@  D !'?&l `y "'?D'?&l#Ĕ  "'?D'?&l  "cx!'?&l 㿠31al  `* @@"@@  &@   z@    &             " @ 2 `x  D' ' &al  㿠5l#@3@&   &    y  &   &    y  &   &     y  `  "cx!&&l  `  `   `  `$ ` `` @, J#` "@@c̐@ &!&&l  @ՒaD`"` &aH@ϐ`"`$ s`*V`` `"`` $ " `!0&&l   "``@} ` $ "``@u $`  ` $ @!&&l  㿘5l#@3@&   &    y  &   &    x  &   &     x  & ؀`           l ` ```  `   `  T ` ` "@+Ӓ  @+˒ J#` "@?cԖ@ߔ  !&&l  &!L@"` &aP@"`$ s*V&aT@"` &aX@"`$ s*V` `" $ " " $ " !0&&l   "@  $ "@ $ 2  $ 2@ "@n  $ "@f $   $ @!&&l  !&&l  㿘1!l&````  `   `    ` ` 9  4  ' zDJ#` " "@>c   @  !0&&!l  !&&!l  J!  >Z# "cx!&&!l  㿘1!l&````  `   `    ` ` 9  4  ' yڐJ#` " "@>|c   @  !0&&!l  !&&!l  J!  =  "cx!&&!l  㿠1!l@`"@@  &`@  w@``  `   `    ` `` ` ` @L  !0&&!l  !&&!l  J!  =  "cx!&&!l  㿈31al & `* @ ' `  `  `   v  q           `4 ` `` " @)   @ &S&@a\`"` &a`@`"`$ s`*V`` `"`` $ "`~` "&@&&al   "``@ ` $ "``@ $` ` $ @ J!  < 4 "cx!&&al  㿠31al  `* @@"@@  &@  v @``  `   `    ` ``` ` @D 2 `t` "&@#&&al  J!  < L "cx!&&al  @㿘97!l  3@!`"`#@&   $   `u `&   $   `u ``$ `  `   `    ` ``~` y` "8'k'!l !s! * $ $!"` `*  ' @ R"  `* $7'!l    ' w  'u' '@c !0$'!l J!  ; d "cx!$'!l @㿘53l` ``  `   `  a  ` ` H  C! *@ "  @ "  ! " ` *@  `' ` `  " `  @` &$ ` @` `" ` ``* &&l` J!  ;#  "cx!&&l` @㿠7l       `` "`` \`   U`  4@G "cl"!`}#@`"7 ` 22 `   ", `    "$ ``  `   `    ` `  `@a  ?}"ch#h yv #@`5` "`d`  dvJ|`"!  "cl   2``  `  "`d`  `dv+` @! "ch  `  "`d`  `dv` @ "ch#h $J!  `  `  "`d`  `du`@֒  !n:)` #ܐ":  ` :  6      C    a0$ &l  a$ &l  !"E&l$ $ $ $ |$ w$ r$ m$ h$ $c$ (^$ ,Y$ 0`T 4$ &l  㿠@(1 !la&``&!l   !@-  `a0&`&!l  `&`&!l  㿠@(g1 !la&``&!l    @-  `a0&`&!l  `&`&!l  㿠@(91 !la&``&!l    @@-T  `a0&`&!l  `&`&!l  㿠@( 1 !la&``&!l   !@-&   `a0&`&!l  `&`&!l  㿠@'1 !la&``&!l    @,   `a0&`&!l  `&`&!l  㿠@'1 !la&``&!l    @@,ʒ   `a0&`&!l  `&`&!l  㿠@'l a""l  a0""l  @㿠@'\ la#  "l      8 ܀   a0# "l `# "l 㿠@'( la""l    a0""l  `""l  㿠@&3al1 ` *`  a&&al   o ;&&al  @㿐@&3al1 ` *`  a&&al  " <a" #hh ;``p@d ;G&&al  @㿐@&3al1 ` *`  a&&al  " <`" #hh ;``pd ; &&al  @㿐@&Z3al1 ` *`  a&&al  # <a" #hh ;``od :Ӑ&&al  㿠@&" la""l  < Ԑ 0  a0""l  `""l  㿠@% la""l  < Ԑ   a0""l  `""l  㿠@% la""l  < Ԑ   a0""l  `""l  㿠@% la""l  < Ԑ   a0""l  `""l  㿠@%f la""l  < Ԑ   a0""l  `""l  㿠@%7 la""l  < Ԑ   a0""l  `""l  㿠@% la""l  < Ԑ (  a0""l  `""l  㿠1@$!l !la"&!l   Ԁ( a0"&!l  `"&!l  㿠1@$!l !la"&!l   Ԁ$ a0"&!l  `"&!l  㿠1@$!l !la"&!l   Ԁ" a0"&!l  `"&!l  㿠31al      `"@"`@   @  "`d@  `dq@  `"N` 2N`   "N`    " N`      a @@  a0&&al  `&&al  a&&al  㽠5l    Ϡ #ܐ" :  ` :  6   Д   `4 a a   a   a    `#@  3` &aw #@a  a  a    ``` [`` @d < Ԑ  2`  ! ``'`&l  a0'`&l    4``  ` " `  ``"  `"`` @> `   `a0'`&l  `  `` ` `` `" `  J!        "           $4B  "cxa'``&l  "!   "  "`d   dov_#@ 3  "`d   doΐ @̔ (J! `   "`d   do@~ `!n3`ؐ`a'`&l  @`@^"@~  <  `  ! ``'`&l  a0'`&l   . 2 ( "   6` "` "` "` " ` "` 2 `@&   ! ,  "@@  @ ``'`"al  a0'`"al  `@~ S㿠31al  `* @    "@@   "@  "`d@  `dn@N 1`X    `X   `X ` `   D  `@   ``"d ```dn N 1`X    `X   `X ` `   D " `@   ``"d ```dn J#` "@3.`@}2 `j  6G ' &al  㿠3al1 "`" `c(* @  `* @ @$ j 6&&al  㿠31al  `* @"@@   @  "`d@  `dn&@J#` "@2Ȓ`@~2 `jV  "&5&&al  㿠3al1 "`" `c(* @  `* @ @$6 j/ 5&&al  㿠3al1 "`" `c(* @  `* @ @$ j 5&&al  㿠3al1 "`" `c(* @  `* @ @# iߐ 5j&&al  㿠53l`1 `* @"@@  &@  "`d@   `dmo@      "`d   `dm] J#` "@1a@}V2 `i` "&5&&l` 㿠53l`1 `* @"@@  &@  "`d@   `dm@      "`d   `dm  J#` "@1a@}2 `i:` "&4Ő&&l` 㿠53l`1 `* @"@@  &@  "`d@   `dl@      "`d   `dl J#` "@1[a@|2 `h` "&4s&&l` 㿠53l`" ` *`  "@@   @  "`d@  `dlz@`<@|(cܒ"@:` @ :``  `a'`&l` rf  `4#`'`&l` 㿠31al  `* @@"@@  &@   i@       "`d   `dl J#` "@0a@|!2 `hK` "&3֐&&al  㿠31al " ` *`  "@@   @  "`d@  `dk@J#` "@0a @{2 `h  3#ܐ":  ` :   Ԕ  ' &al  㿠1!l`"@@   &`@  "`d@  `dk@``  `   `    ` `   (  @{ (@{  "`(!0&&!l  cx  "cx!&&!l  㿠3al`&`  `   `  g  ` `\ ( W`  `  ɚ %1@{< (<#ܐ":  ` :  6 *  ` | {' @{!`(2#@{ (#ܐ":  ` :  6    { {' "!l  cx 1 "cx    @ &al  !&&al  㿠31al  `* @``  `   `  Ȑ  ` ``"` ( "`@z (fː "&2V&&al  cx  "cx!&&al  㿠1!l@`"@@  &`@  g@``  `   `  s  ` ``"` ( "`@z\ (!0&&!l  cx  "cx!&&!l  㿠1!l```  `   `  4  ` ``"` ( "` @z (!0&`&!l  cx  "cx!&`&!l  㿠1!l```  `   `    ` ` ( @y ( 6 " (" (!0&`&!l  cx  "cx!&`&!l  㿠31al  `* @#ܐ" :  ` :      @x !'`&al  !(   @xV eB e  `1*`'`&al  㿘31al  `* @#ܐ" :  ` :     U @y]$?/?*@"cTei  0 ' &al  㿘53l`1@ `* @"c@c@ &c@   fc@     f /#?* e*"T` "&0&&l` 㿘!l "`" `c(* c(&:  ` :   `* @":  ` : `) 1N#` $     "`d  N#``dhN#` "N#`@-N#` "@-Aa,@w?&1#x .#( dĒ?   0O & "al  @w @w?"#x >1 @w  @w  .?#x  @w @w?*@`"#T?@9.#( d}  `0`&`"al  1  @@`"` @x`"@@`@  @  "`d@  `dh@@ @v?"!l  㿠9!l7 3"`" `(* @(":  ` : ` `* @`  @@V`Q('@ :  ` :    @HC(1N#` $`   `  "`d`  N#``dg`N#` "N#`@,N#` "@,Ma4x(`"@@`@  @  "`d@  `dg@@(. c’    /M & '!l` 㿠3al1 "`" `c(* @  `* @ @ c /%&&al  㿠31al  `* @wj@c} /#ܐ":  ` :   D  ' &al  㿠31al  `* @    "@@@  "@  d@ B!<@w&c6 .#ܐ":  ` :   &&al  㿠53l` `* @`     "c@1@c@ "c@  `dAc@` `  d5`J#` "@+Lad @v2 `bՐ  "'`.`'`&l` ̑!l㿠53l`1@ `* @"c@c@ &c@   cc@     c @vb` "&.%&&l` 㿠7l5#@3@ `* @ &   '    `c `&   '    c    cJ#` "@*a@v>2 `bD` "'?-ϐ'?&l 㿠31al  `* @@u b' -#ܐ":  ` :     ' &al  `3al#ܐ" :  ` :     Ք @u t t @u;h#pph;``vdv1& ``    29&al x @u;x#x;``vdvc&`| @u;#;hhvlvQ& ` @u;#;ppvtv?&&al  @p3al    @t_ `"@"`@@  @  'b@'  !"@uj@ui#ܐ":  ` :  6 4      9   `*  @a&&al   ~'l#d a#\ #` *  ~ a*  & ܒad@s @sܔj ,&3&al"1&alv u&v u&v  u& v u&u u&u u&u u&u u& u u$&&al  㿠31al " ` *`  "@@@  @  b @@tcܒ"@:` @ :``   a' &al  `  ,/ ' &al  㿘31al  `* @@sb  6@t@"@@  &@  a@@s@sG" `i +#ܐ":  ` :   0  ' &al  @@@㿠3al1 "`" `c(* @  `* @ @ 2 `` +&&al  @W@㿠3al1 "" (*   * @2 `_ +r&&al  㿠3al1 "" (*   * @Ð2 `_ +K&&al  㿠3al1 "`" `c(* @  `* @ @ ? a&&al  _ +&&al  㿠7l1 "`" `* #(  `* @ @; ? !&@&l   _X`  * ' &l!i `  *Ԑ ' &l  㿠3al1 "" (*   * @2 `_" *&&al  @ @㿘53l` #ܐ" :  ` :     Δ !7`"@@   '`@  "`d@  `db@@r,!8&`@"@@  '`@  ` @ '` ' br @r@r 2 `? * "cT`  `   s `'` "&l!7  ``" &l `hP &lh &l`  V r'`h r'``  j4 "!i”  2r&`^M r&`` ^F # #ܐ":  ` :  6`  `rv'`g "!l  @ @㿘75l a: "@@   ' @  "`d@  `da@@r1a;+#@ & @   '    `_! `&    '     ;``P ;``@pd@qג@q#ܐ":  ` :  6       r`'` " &la:] &lg &l 0 q͐'`g qȐ'`` `iG !hՔ  2 q& ]a q& ]\  "!l  @ @㿠53l` != `"@"`@   @  "`d@  `d`@@qB!>`"`"@@@  @  ^[@@q/@q.#ܐ":  ` :  6`ؔ `  `  &  qb`'` " &l!=\ &lg &l` * q'`g q'`` `h "h$  2p & \  "!l  @ @㿠97!l @<#@`3&    '`   "`d   `d`:  &    '`   "`d   `d`$  L "  @p2A,#@`&     '`   "`d   ``d_ `& @   '`   ]y @pV@pU#ܐ":  ` :  6     D `p$`" '!l@\`'!lf=`'!l 0 p:$f/`p5$``g "gB  2 p& [`p& f `  "!l  㿠1@!l`  `  \`@o!0&`&!l  㿠1@!l`  `  \`@o!0&`&!l  㿠1@!l`  `  \`@o!0&`&!l  㿠1@!l`  `  \`@o!0&`&!l  㿠1!l@o#ܐ":  ` :  " a0&&!l  㿠1!l@ot#ܐ":  ` :   a0&&!l  㿠1!l@oY#ܐ":  ` :   a0&&!l  㿠1!l@o>#ܐ":  ` :  Ȕ a0&&!l  @ @㿠53l` !K `"@"`@   @  "`d@  `d^s@@n!L`"`"@@@  @  [@@n@n#ܐ":  ` :  6`e `  `   n`'` " &l!KZo &ld &l`   "1&ln'`d n'`d n'` ZS n'`ZN n'`d n'`d n'`d n'` d{ n`$'`du &l` 㿠!@n{!la0$``$!l  㿠!@np!la0$``$!l  @ @㿠53l` !P `"@"`@   @  "`d@  `d]@@n:!Q`"`"@@@  @  [@@n'@n&#ܐ":  ` :  6` `  `    n!`'` " &l!PY &lc &l` - mې'`c m֐'`c mѐ'` Y m̐`'` ```eK` `"dٔ ` 2`"!l  㿠!@m!la0$``$!l  㿠!@m!la0$``$!l  㿠31al  `* @#ܐ" :  ` :       @m a'  &al  @kb  $ ' &al  ,LpH!l  "`" `c(* c(&:  ` :   `* @":  ` : J#` 1 @  97` "`` "` t$`" ` `"` *a`@(`#(.` J#` "@!b @F!#@!9#7 ` $"#``% )`   `  "`d`  `dok`% ` `  Y`% `@(`!l . @@h"c"0U@l<@l7@l1@l*@l"@l#\@l#\#`@lĔ.`#( X   # & "al  㿠```" %?` ` `" ? @lZ  @lV ?cx  cx   "cx@lD ? "cx㿘7     5<"     '  [t 2   2  #    '   n * &    &  2"H  :;` * T& / ` * -`" * T` *`"" 2  $`?2  * * *& @` `""`` "Ԑ㿘&:  ` 7: `` '` Z ' @jr   : Tq   @ 4` "``  `  '`  Z``&`4`   :V$ $:  ` `: $ "` `   `  '`  Z```"X``"\`$bbb`&``` $ `bW&```4` "%,,,,,,,,,,,,,,,@@D8DD`"``t&`3    '  Y @@#h #x <!# #|#\ `xM % M %2v   k* *  : . *  ` . > . ` 7  .   *`` 7  .  7  *`7  *` *`㿘` ` `v !2 "  @"$` 2`00U10ϐ05 ` '` Wl ``# ` '` jz ""  ]W'.`" `* &``"]H ` 㿘75        !2 "  "  2 00  003   '  V    #   '  i"b` "^`" ' #    2N 2M` `"A. & J ;" '&   4& J "..     '  Vܖ2 JN @2` . @ *`""@&'@e 2 `. `" `* '`` 1㿘9  ' VM ' V?`#  ` "`d`  diQ` `  :`Q `  @``& `@d `" `* &`` &` ~ {`x6 Y Z( ["Hfb" ` ```#  @ ``` @ ``  ``  @ ` `2`D@" `  ```#  @ ``` @ ``  `` @ ` `2`"" `  ```#  @ ``` @ ``  `` @ ` `2`  YZ["%E% LL /  "2L% "LL  /  "2L% "LL  /  "2L"\"\ߐ` ``* 㿘!l   "  `    `  "` `  " `  `  `& ` .`  `  m 5` `* @ ` 0 P "`.' '-2` 'Q   ' & ` #`@dK "@:` @ :`@ `@d> Œ-& "L`" .A`"":  ` :     ee`% ` \ې .!& V " :  ` :      eA$-& 2 ` 㿐           j ` ` "`  `   [ ` #\`J V -3 #<\@  ` ` $`'J V`J V |2``  $`` @"`` $ " ``@b $`@b`  @b @b 2`\#<@$`    "      $!&@ba`" `" $) "N` *`V @cǔ?´  bbb@b@b!"/@" J  "/.@ @" J 2///N``*`VN` +2L $L @" J |"L N``/% L |2?L  L   & L 2 &!@b_  J#` @8J#` "@bJ! @b"`J``||""z4  >:J#`  "@ԒbL > a` *`V/L  w/L &: L   & L 2 &!@b `!А -*`V@aL < L    r L 2  r/L &c&  L =2L   L \"L ЀL  " L  L 2 L  @a' U     ``   ` `` "cxc``  ?` `J V s`` s*`V`@c;@a`@a͐!@a} `! -t*`V@a6o" J |H,"L " J  "L , " J L   & L 2 &!@aA  J#` @J#` "@ْb"l` |$*V` <*`VL   & L 2 &!@a `! -*`V&"@`ȐJ! "``J V <2`@`ْ "`!n,b``J V 7 `J V |2 `J V -- aX@a @``l< 0  s`*`Vl  !'c@a #x _ ` s*`V "A " @`u"  @`s`$  @")@` 1 !L,}    ``: K$     " ,l!L   ``: K  " @`D -   c< $ @` `*" `J V s&`J V >2 `<!l  &`" $b@`N `"`$@``" `" `" $`* V  㿈 $#`  ̔ &`!$ ,(` `  `    `    6` ` ` @_  ̒a$@a`!$"   .    #@#|) '+%< .C  S.    "    &    '  & P& #\    g 9 J#` &"@V&b@_  @ ˀ    !la$;"`at#h!x#d`    @8  J X  @`{ #@_C#xP` @ w@_9 @_0#x|` @  dV\ X] 9 '#x #\   `  @_#xw @ D``1aX     & @`  ̒a$@``ath!xd@" ̒@`d     "`d  dO@^#xa&b @^ -w  6   @`̒ ~ ʾ 㿘```  `   `  ~ ` `       ~Ӑ ` ` " @R   @J @^ؐ @&" @^"` &b$@^ "`$ `$ "  <*V > *V` `"   $ "!0Q @^3  @^  $  @^' $@^!Q㿠.` >` Ѐ`? ` 9`  `  `  J! ``   "``  ` $[#ԁ @* ` > " ," 0 4"`8 *`V "cx 㿠  :  J V |2    ?* "T`?' J V - !   $ "    `$@"  @] $ ?"  @]`   @]  ?"  "  " $㿠         2  =1?3  $   ` 0"   ``"  `" @]    ?6` " `  G Ѐ 2  2  @] ֔㿠         ` ` ` @_J!  # "cx?㿠         ``  `@^ 2 `J!  ]  "cx 㿘    2     '  M @    !K    K 2  *K  +" K -2K  K    K 2  2K   .2` K  2K     K 2  2K   e" K E2K  K +" K -2K  K " K   K 2 K   K 2    㿐 5  L  "  @ "   "   ;``d@\`   * >    "    B# # " K "؁ B3    @[`   * >    " & J! N  @ "   "   &"(@[`   * >     '  L  @\Q `   㿠1al  #ܐ" :  ` :  6   ٔ   ""al 2 X   Q          "!` S #@ "cl ` @\w "ch 4#hJ!    "   $ $"!`@R#@?"ch?"!3 "`d  dLER#@ "cl "`d  dL0 @[$ 1&#h#h`6 #hJ! "#h "`d  dL@Z "#h!nJ`D#h㿠31al  & #ܐ" :  ` :  6       `4  #l  L#h t "cl"!&&al3 "`d  dKR?#@ "`d  dK @[ 1&#h#h`6 #hJ! "#h "`d  dK@Zv "#h!nɒ`#h㿠r#&`:  ` :  y* &8''` 5  "@@  @  "`d@  '``dKU@'``'`` ( '` J / J#`  @"      "`d  J dK,J " @[ @[J!  @Y#xR`@ 㿠1# "1y#&#1 h y~ h& h㿐N N  a N N 2#1@Y#8 D&#8b,@Yϔ  2=N&@Yb0#8`N f2N `&@Yb4N " N   '2$NN  N 2 & J` &  *`& J '2N.?` @[[# '.? N . Na &"8@Y   Na N "JN a "JJ J 2J =N #!N1& "N  2"@@Y3N " N N |.N 2N&!6 :  xP* $# "`h#`hJ`"?"!J "JJ "JJ J 2J "J"J "JJ 2JJ J "J "J*J 2J"1# # @Z#cx J!  @Xcx# `  `Ĕ@Z  㿘J#` `@58` "` t`" ` `"` *a`@(`!!T!":!!!"#@ dJ#` `"@%`@':  ` @: `&  `  F@!`&    &   IL@Z `&@(`#@ dJ#` '"@ `':  ` :  `7@ & `  F`&   F'` :  ` @`: ;`&    &   H@Y `&@(`#@J#` `"@ `&        "`d   `dH ':  ` : J a  J S J IJ G"{   ^ @&       F   `@ 5@`&      F  @YH `&@(`@5@`&      E @WR `&@(`J#` `"@ a'@:  ` : #@ d!;%<`5&``  `  & `  H/` J Ԁ !X@X !l "&@V " ` &&@V 2&`@(`J#` '"@ a ':  ` :  O#@ d @Vϔ `7@`&   'Ei'``&   'EY''`:  ` @ : ;`&    &   G@X~ `&@(` 㿠`  8  @ I <     `  8  @ >    >    `!,# @V  * `"` <` 㿘`#@&     E!*@ `@&  "  D#\\&@  "  D#\\!&"#x!*!." #`#``@Wȓ#``@Wǁ#``@WƁ?H`#@ &7@ ?  Dg!/ ` &   DU  `&   `DC`   !' !+!/" ,  ' $ p    p  2    @Wa ??*  T <#   ' Y   :BL, *   ' FQ. ct !(   CĐ"#x!'!+!/" @W @V@V`"  `*   ې㿘#@ 5@ &`` `  C`   &`` `   Cn`     '  EԐ"  !T"#x@V㿘#@ 5@ &`` `  C;`    &``  `  C*` &`` `   C` &`` `   C ` " "   "  ,!p  " Zc #    '  X    : A= "#x@V0   " ` *@ 㿘  @"@@  @   B@    ' E  * @T   "#x @T@U "cx?(#@`7@ &   B|``  `&   `Bj`& 3  B\ @U&cx?`?fe @ _!( @U ??!(.#     '  WŐ   : @@ @@Sv "    `*   $ W      '  Dt@@SO&@SE @UP &cx?㿠 7㘐"* "@`̐    㘂$!*  &* `"  &*  #"  &* " `@4 &* "  &* ,"  &* " ` &* "   &* " 㿠#,   # "  * @ "` *`  " "` *` `"` *` `""` *` `$ `"  * @ * "` *` ` ""` *` `` ! `" 4   @*``@` " `" @(` , , , , , , , , 4 8 L $ x''  N"c$`K@! *c (&`J *c#d 2 (Jc "*c (" "` < " N ;!N ; " & qW@R:N`  "`N`@Rd .``@*N` TM:  #d M I` &c8* @ -  L`2   ``" pM; & 8"@*  @   ``" O/%  " "#X@"a4M: ,@ G#d M: "6M;%$8& :,M;N    @ '*N M; "e M: %   J N 2 @j   : N   N "  *N M;  @C  2M;    @VŐ@'  ``@ E2M;M: `? %J" b| $*    : N.@   @   * M;`$ & J `     `_  Jc  Jc  Jc _  %N `     `_  "   @ : *N ")M;@ 2+!M;`$ & J `     `_  Jc  Jc  Jc _  &N `     `_       @9 ڔ *N 2M;@* 2˔M;:M;N `  `_   @   *N M;:M;N ` 2  2 `_  @   *N {M;:xM;N    @В q  *N `M;:]M;N    @ V  *N EM;:BM;N    @ ;  *N *M;:'M;N    @    *N M;2%$@m    M; n %0%4\ 2 M; 2 %J 쀢 2%M; D%"`%4,5,`"%,n,%,%0%4,%0%4   *M;    ""@  ""@  (M; n Ր! 㿠"  "` "` $"c,& $"#      ""` `<"@7= !4@ " "`  \  P|  h h 4 @dt   hx  ` 3O`!1R ! N "*   Ԁ@J#   '`#X@'`J    Ԁ@J#   '`#X@'`J    Ԁ@J# 〧   Ԁ@܀  #d  #X@΀ ˀ  #X@  #X"   2 `#X@ ` O`  #X@ ` O`J J` #X" $ @ @NB @ }O`  ` * < J @  2 `#X@ ` dO`    ` 2 ` ` 2` _` OO`  #X@    `   `  _`8O`  Ԁ@Jc   Jc   Jc _   '`J`  J`  J` _    ` 2   `   _ N N      @   #X@    ` O`    ` O`  ` O`  #X@    ` O` *    ` 2`   J"`  " #X@  $  @MD  N  Г*" cu r"c  *" c, g c,c" # c$'$c$#, 'ܐ?' ' ''' '''&`M$c$#$  &` @ &     "  " &   6  ' '   "'   "   &     "  " &  &&` ' '   "'   6 $ ' '    z&` &     "  " & '  O Ӹ#,  &` "    * `" "# 4`  " R" N "&`     O # O # O O <;&` @  #XU#@|`J  4   @&`  @&`6値|2 @pO ~ `nJ@ ` cd`"O `|`J 2 &  &  @&`  +&`&`   &`   &!bX@KRN!D` Զ":` L@㿠#X # @ "@ @&N " b  ԑ*   J  K 2  JJ@ KJ@"   `:`K *@  `:`K *@2 !K 2 K 2K _~ *Kx u!K mK gK _c *K] ZJ a R MK 2F CJ a ; 6K 21 ,J a $ K 2 J a   K " # " `0  P` 㿠 8`@",#a,@"PHc`2H-8 bt,"Hc`b`bH`Ԁ`Ha`b㿠J#` s1 X      X   j X ` `"Đ    a "   t> " X `" X ` *a`  "b X"c X     X   i X ` `#    a  t  `  *a#T#$㿠&@I"`"@I"b"㿘'HH'L'P'T''Xv@IU1!` i!&!h&!@I!㿠 _.``@IĞ㿠5#(l`""` *`  "@ " : :  `  ::  .`        "`d    `d:0 " 2 @K Jݲ ` "@@K  6V &l㿠5#(l`""` *`  "@ " : :  `  ::  .`  @  "     7m        "`d      `d9 @JJz ` "@@J$   5 &l㿠3al "`" `c(* &c(:   : . N!. &&al㿠7#(l`""` *`  " "@ :  `:   : :.`(!8.` 3     "`d      `d9W @   "     6 !       "`d      `d9& JI "@ @&l㿠5l3`""`c(*` c("@ " : :  `  ::  . !I!c("@c(@?rc(&l㾠#(;!al9`""``*` `"@ " : :  ` :: `*  `  "`d`  ``d8#@` &   &bp@GcY &  CX 7 "       "`d   `d8 &@G"| %X P  P      "`d    `d8i HXc,t`d'a"bd̒`H`!0"@`'al㿠@$?㿠@$?%5.3fpanic: top_env wpanic: restartop %s syntax OK Usage: %s [switches] [--] [programfile] [arguments] -0[octal] specify record separator (\0, if no argument) -a autosplit mode with -n or -p (splits $_ into @F) -c check syntax only (runs BEGIN and END blocks) -d[:debugger] run scripts under debugger -D[number/list] set debugging flags (argument is a bit mask or flags) -e 'command' one line of script. Several -e's allowed. Omit [programfile]. -F/pattern/ split() pattern for autosplit (-a). The //'s are optional. -i[extension] edit <> files in place (make backup if extension supplied) -Idirectory specify @INC/#include directory (may be used more then once) -l[octal] enable line ending processing, specifies line teminator -[mM][-]module.. executes `use/no module...' before executing your script. -n assume 'while (<>) { ... }' loop arround your script -p assume loop like -n but print line also like sed -P run script through C preprocessor before compilation -s enable some switch parsing for switches after script name -S look for the script using PATH environment variable -T turn on tainting checks -u dump core after parsing script -U allow unsafe operations -v print version number and patchlevel of perl -V[:variable] print perl configuration information -w TURN WARNINGS ON FOR COMPILATION OF YOUR SCRIPT. -x[directory] strip off text before #!perl line and perhaps cd to directory use Devel::%s; This is perl, version %s with EMBED Locally applied patches: %s built under %s at %s %s + suidperl security patch Copyright 1987-1996, Larry Wall Perl may be copied only under the terms of either the Artistic License or the GNU General Public License, which may be found in the Perl 5.0 source kit. PATH//dev/fd/-rcppstdin%s/%s%s%s %s -e '/^[^#]/b' -e '/^#[ ]*include[ ]/b' -e '/^#[ ]*define[ ]/b' -e '/^#[ ]*if[ ]/b' -e '/^#[ ]*ifdef[ ]/b' -e '/^#[ ]*ifndef[ ]/b' -e '/^#[ ]*else/b' -e '/^#[ ]*elif[ ]/b' -e '/^#[ ]*undef[ ]/b' -e '/^#[ ]*endif/b' -e 's/^[ ]*#.*//' %s | %s -C %s %srPERL5LIBPERLLIBpanic: restartop Out of memory! ::_<%sSUPER::SUPERimportunimportAUTOLOAD::SIGSTDINSTDOUTSTDERRINCENVARGVARGVOUTabARGVEXPORTISAAnyDBM_File::ISAOVERLOADSIG%s::_GEN_%ldOperation `%s': no method found, left argument %s%.256s, right argument %s%.256s%s found where operator expectedline :'{$)| lLuUEQ[#!%*<>()-=])} =wds]rnftbxcavaA01! zZ79~$@&PERL5DBLUQL\uU\lLU@F=split(%s);@F=split('%s');=cut=>+-*/%.^&|<=cut_{$:$SIG$@"'`q&*<%/?-+<=>cmpLiteral @%s now requires backslash $#+-'"CORE=>$->*%&%ld%s::DATA|&*+-=!?:.__LINE____FILE____DATA____END__AUTOLOADandabsalarmatan2acceptBEGINblessbindbinmodeCOREcmpchrcoschopclosechdirchompchmodchowncryptchrootcallerconnectclosedircontinueDESTROYdodiedumpdeletedefineddbmopendbmcloseEQENDeqeofexpelseexitevalexeceachelsifexistselseifendgrentendpwentendnetentendhostentendserventendprotoentforforkfcntlflockformatfilenoforeachformlineGTGEgetppidpgrppwentpwnampwuidpeernameprotoentpriorityprotobynameprotobynumberhostbynamehostbyaddrhostentnetbynamenetbyaddrnetentservbynameservbyportserventsocknamesockoptgrentgrnamgrgidlogincgtgegrepgotoglobgmtimehexifintindexioctljoinkeyskillLTLEltlelcloglastlinklocallstatlengthlistenlcfirstlocaltimemymapmkdirmsgctlmsggetmsgrcvmsgsndNEnextnenotnoorordoctopenopendirpoppospushpackpipeprintprintfpackageprototypeqqqqwqxquotemetarefreadrandrecvredormdirresetreturnrenamerindexrequirereversereaddirreadlinkreadlinereadpiperewinddirscalarseeksendsemopselectsemctlsemgetsetpgrpseekdirsetpwentsetgrentsetnetentsetsockoptsethostentsetserventsetprioritysetprotoentshiftshmctlshmgetshmreadshmwriteshutdownsinsleepsortsocketsocketpairsplitsprintfsplicesqrtsrandstatstudysubstrsubsystemsysopensysreadsymlinksyscallsyswritetrtietelltiedtimetimestelldirtruncateucuseundefuntiluntieutimeumaskunlessunpackunlinkunshiftucfirstvaluesvecwarnwaitwhilewritewaitpidwantarrayxor;|})]oa!=$_{::[\]^_?iogmsxiogmsxiogmsexiogmsex`'"ARGV([{< )]}> )]}>eE+-0123456789near "%.*s"near "%.*s"at EOFat end of linewithin patternwithin stringnext char ^%cnext char %c%s at %s line %d, %s (Might be a runaway multi-line %c%c string starting on line %ld) Missing comma after first argument to %s functionNot enough arguments for %sToo many arguments for %sType of arg %d to %s must be %s (not %s)Can't use subscript on %s^%cdidsigCan't modify %s in %sCan't declare %s in my@$%, \s+&`'123456789+BEGINEND%s:%ld%ldBEGINENDiogmsxiogmsxLANGLC_ALLLC_CTYPEwarning: setlocale(LC_CTYPE, "") failed. warning: LC_ALL = "%s", LC_CTYPE = "%s", LANG = "%s", warning: falling back to the "C" locale. C%s during global destruction. at %s line %ld, <%s> %s %ld. panic: message overflow - memory corrupted! %s=%s-%d%d%d%d%d %ldPATH__DIE____WARN____PARSE__ALARMIGNOREDEFAULTmain::%sCHLDCLDARRAYCODEFILEHANDLEGLOBHASHNAMEPACKAGESCALAR%d/%d$&*(){}[]'";\|?<>~`**** %ld%s=%s(0x%lx)%s(0x%lx)%ld%ldgB%d/%daAbBhHPfFdDiIlLN@Xxu^\s+%#*.*f%*.0f panic: die %sr%s/%srCan't locate %s in @INC (change .h to .ph maybe?) (did you run h2ph?)_<(eval %d)rw%s_TOPrwrwrwrw%s %s %2d %02d:%02d:%02d %d%c%spanic: sprintf overflow - memory corrupted! Warning: unable to close filehandle %s properly. -----rw-Can't open %s: %s rw%ld -c-cfexec$&*(){}[]'";\|?<>~` %x %d PERL_DL_NONLAZY%s::VERSION1.00 BBBBB   B+  0 $ T 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000000 0|0y$0v00s<0pH0mT0j`0gl0dx0a0^0[0X0U0R0O0L0I0F0C0@0=0: 07,04801D0.P0+\0(h0%t0"0000000 0 000000(040@0L0X0d0p0|00000000000 0 0 0 $0 00 <0 H0'ې ېperl.c Patch level: ### @(#)yaccpar 1.8 (Berkeley) 01/20/91   !!"  (333) *+,5 v33 ln.4|Bb"Z[ -2@$dza7EFx0/6DeC}ckityA>~sqjoug rp?! SV B CEFGHIJKzXM U )!4.OGe*AGGNNN\NN? Amm _IMGqAAAA(l`NNY3b7v9 ^;`afmm o%m)  wk 5 % T Q %> Q  < ] e   Q'kk Z1:=@mv W 8ckkk ,kLG.rVRZ TAPDO9=PRP _ace9PPnPs1|^Q`t  &S=1S9ZP23ib 4SSjK&dk<<&1S!<<;#%9BD@A F<PM=fN " $'-7<=>EI9999PPPP5)J*O+,.099PPP:6TUSSSSC1G%HSSS#DN Q<<<<''''%'''#'L<<L'/''88''88\]''''''''''''''''''''''''''''''fffff88888fJJJJJJffffffffffffffffffffff3vx=?/8@;:JJJJJ9JJ>JxJJxJJJJJJ'<'''''''x''43'=?/8@;:x>''<Y3=?/8@;:lu{4>< !"#$%&'()*+,-.0142567''''''''''''''''''''''''''''''wU? &'()*+,-.012567m &'()*+,-.0125367=?/8@;:r>3<=?/8@;:>43<=?/8@;:>4<3=?/8@;:4>< &'()*+,-.0142567 &'()*+,-.012R5R67RR R&'()*+,-.01R25673 =?/8@;:&'()*+,-.01>25673<=?/8@;:>43<=?/8@;:>4RRRRR<RR3RR=?/8@;:4>< &'()*+,-.0142w5w67ww w&'()*+,-.01ww2567 w&'()*+,-.0125673 =?/8@;:&'()*+,-.01>WW2567gWpW3y<=?/8@;:WWWW>4wwwwwwwww<ywwwwwwwwwwwww4hhhhhh h&'()*+,-.012567 &'()*+,-.012567hhhhhhhhhhhhhhhhhhhhhh;;``;;```;`:::::`__:___:=_===_==;;;;=`````;;`````````````````::::::::::::::::::::::____G_G______GG___________=====G=================fffffmmfmmm\\m\\\GGGG]]GG\]]]WW]WWWXXWXXXfffffffffffXfffffffffffmmmmmmmmmmmmmmmmmmYmYmmm\\\\YY\Y\\\\\\\\\\\\\\]]]]Y]]]]]]]]]]]]]]]WWWWWWWWWWWWWWWWWWXXXXXXXXXUUXXXXXXXXXUUUVVUVVVTTVYYYYTTYTYYYYYYYYYYYHYYHTHHHIIHIIIKKIKKKUUUUUUUUUKUUUUUUUUUVVVVVVVVV{{VVVVVVVVV{{{TTTTTTTTTTT{TTTTT^TT^HHHH^^H^HHHHHHHHHHHHHIIII^IIIIIIIIIIIIIKKKKKKKKKKKKKKLKLMMLLLMMMNNL{{{{MNN{N{{O{{O{{{{{QQOONOQQQ^^^^^^^O^^Q^^^^^LLLLLMMMMLMLLLLLLLMMMMMMMNNNNNNNNNNNNOOOOOQQQQQOOOOOOQQQQQ[hoq}~(8  [,);$);,);)!"#$;R(:;)+X?}-{;2(;;([{[8))<))))$),]t([])[N)((;):;({{{[)\)(_^a`cbed)f({)j{,;){;)&')];{;:;;,;;;+;{.;{)*{0!({$%&](*+{-{NG]{;(($@(   )(][   }]);;[)}![$%&'(]*+(-)1(}4}}789};{}~@;}]))&' &' &'[)&',9*&']&'&'&'?;-{1{)}~]&'&'&'&'&'&'*[;E)&'K&';O&')!&'$%&;(S*+)-E{&'&'&'&'&' ;&' ]@     &'[&'!"#$%()),/&'356{~;[     &'[{]!"#$%()&'/356![{$%&()*+,-&'&' :;?@{*+,-.014789 []),[ :; ?{~{!"#$%()[]/3!56$%&()*+,-{:;?@4789 &].01)4,789 :;?+,-.~014789  ] !"#$%&'()*+,-./01345678914[789 &'{*+,-.014789[  { !"#$%&'()*+,-./013456789!01$%&(*+-;@ R&'X*+,-.0![$%&(*+-t{ ;@{~-.014789![$%&(*+- @{1~4789),[!:;$%&(*+-*/1{~@=>?@] [ k!"#$%(){~[/356  {!"#$%()[/356 ) {?!"#$%()/356[  &'{!"#$%()/3!56$%&(*+- ;,-.@014789![$%&(*+- @014~789![$%&()*+- @{~*+,-.014789[!$%&(*+-~@ [] [!"#$%?()~/{356 [ !"#$%()[{/)3,56 :; ?{!"#$%()]/356 ! $%&(*+-!"#$% ()@/356014789![$%&()*+- @*+,-.~014789 ![$%&()*+-014789@~[&'!*+$%&()*+-~@ [ !"#$%()~/)3,56 :; ?!"#$%()[]/)3,56 :; ?{!"#$%()[]/356 !{ $%&()*+-!"#$%()@/356%*+/!1[$%&(*+-=>?@@~ [k&'*+,-.01)4,789),:;~:;? &'*+,-.]01)4,789]:;?{ [ ]!"#$%()/)3,56 :; ?!"#$%()]/)356:;?{[]&' &'*+,-.014{789 &')*+,-.014789:;?[] {&'*+,-.01)4,789),:;:;? &'*+,-.]014789]),:;?{),]:;?{ )&']*+,-.014:;789?{),[]:;?{]&' &'*+,-.014789),:;? &'*+,-.014789]), &':;*+,-.014789] &'?*+,-.014789[ &'*+,-.)01,4789{:;?),]:;? &'*+,-.01)4,789]:;?),&']:;?), ]:;?+,-.014789),]:;? &']*+,-.014789 &'*+,-.01)4,789:;? &'*+,-.014] &'*+,-.014 &'*+,-.01 ),&'*+,-.01:;?),]:;?),]:;? &'*+,-.)01,]:;?),]:;?),]:;? ]&'*+,-.01 ),&'*+,-.01:;? &']*+,-.)01,:;? &'*+,-.01] &'*+,-.)0,:;?&'*+,-.)0,),]:;?:;?),]]:;?)&',*+,-.),:;]?:;?:?]&']*+,-.[{&'*+,-.&'*+,-.&'*+,-.&'*+,-.&'*+,-&'*+, *+,-.014789&+,234567:;Zd  "  "  G` (in cleanup) Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q W0 W8 W@ WH WT W` Wh Wp Wt W| W W W W W W W W W W W W W W W X X X X( X4 X< XD XL XX X` Xh Xp Xx X X X X X X X X X X X X X X X Y Y Y Y Y, Y4 Y@ YH YL YT Y` Yl Yt Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Z Z Z Z Z Z Z( Z0 Z< Z@ ZL ZT ZX Z\ Zd Zl Zp Zt Z| Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z [ [ [ [ [$ [, [4 [< [D [L [T [\ [d [l [t [| [ [ [ [ [ [ [ [ [ [ [ [ [ [ \ \ \ \ \$ \( \, \8 \D \P \X \d \p \x \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ ] ] ] ] ]$ ], ]4 ]< ]D ]L ]T ]\ ]` ]h ]p ]x ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ^ ^ ^ ^ ^( ^0 ^8 ^D ^L ^T ^\ ^d ^p ^| ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ _ _ _ _ _( _0 _8 _@ _H _P _X _` _h _p _x _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ ` ` ` ` `$ `0 `< `D `L `T `\ `d `l `t `| ` ` ` ` ` ` ` ` ` ` ` ` ` ` a a a a a a( a0 a8 aD aP a\ ah at a a a a a a a a a a a b b b b b, b4 b@ bL bT b\ bd bl bt b| b b b b b b b b b b b b c c c c4 cD cT ch ct c c c c c c d d d4 d< dH dP d\ dp d d d d d d d e e e e( e< eP e` eh ex e e e e e e f f f( f8 fP f\ fp fx f f f f f f f f f g g g g, g8 gD gP g\ gh gt g g g g g g g g g g h h h( h4 h@ hH hX h\ hl ht hx h| h h h h h h h h h h h h h h h h h h h i i i( i4 iD iP id it i i i i i i i i i j j j j j j, j< jL jT j\ j` jh jp jx j j j j j j j j j j j k k, kD kT kh kx k k k k k k k k k k k l l l, l8 l@ lH lP lX l` lh lp lx l l l l l l l l l l l l l l l m m m m m( m4 m< mD mH mP mX md ml mt m| m m m m m m m m m m m m m n n n n n n n n n n$ n( n, n0 n4 n8 n< n@ nD nH nL nP nT nX n\ n` nd nh np nx n n n n n n n n n n n n n n n o o o o o$ o, o4 o< oD oL oX od ol ot o o o o o o o o o o o o o o o o p p p p, p< pL p\ ph px p p p p p p p p p q q q q, q8 qD qP q\ qh qt q q q q q q q qPPP l`x8@ÌŌ03d4 d0hɴ@ИИtt0|0ޠth   X  0h<l@DH(l@xH"$!8''*-(.08123P405578 :9<>$>@>L?,?VputhABEEG0OdPPQ8R”'PdϘp ވxH?@CDDGGLNPRSxY,\]xb(b4eefDfgjxjn0oprlvxtz{~8\h\ht,Th H|8$t$0$d<\($<d<4x(DƔtɀT`4PЈФрќѨDӬԼ<H"p&l(4hՄՐLhth܄ܐ0< tD44P\$lLL(x\\\ LLdL  X(L((((((((( LLLLLLLLLLLLL LLLLLLLLLLL\LLL  \LL!LLLLLLL 8L#(LLLLLLLLLLLLLLLL,LLxxLLLLL,LL(LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLDD@D@@@DD@ @TT"   dTdTl\l\..> ..666666>.     ! ! H#H$! ! $)##- %AH%AH@@I ] @@ADDDDD Df U  vT..vv   ff     ))]]     @@ !W q q q r r4Use of uninitialized valueSemicolon seems to be missingUnquoted string "%s" may clash with future reserved wordUnsuccessful %s on filename containing newlineCan't use %s ref as %s refCan't use string ("%.32s") as %s ref while "strict refs" in useCan't use an undefined value as %s referenceModification of non-creatable array value attempted, subscript %dModification of non-creatable hash value attempted, subscript "%s"Modification of a read-only value attemptedOut of memory! Insecure dependency in %s%sUnsupported socket function "%s" calledUnsupported directory function "%s" calledThe %s function is unimplemented"my" variable %s can't be in a package r8 rH rP rT rX r` rd rl rt rx r| r r r r r r r r r r r r r r r r r r s s s s s s( s, s4 s< sD sL sT s\ sd sl st s| s s s  !"#$%&'()*+,  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~T(3>IU`kvͮü¢кƳ֦̠󬡾˽ūğ  !"#$%&')*+,-./012456789:;<=?@ABCDEFGHJKLMNOPQRSVWXYZ[\]^_abcdefghijlmnopqrstuwxyz{|}~ s s \0Px(@XL@( s s s s s s s s s s s s s s s s s s s s t t t t t t t t t t$ t( t, t0 t4 t8 t< t@ tD tH tL tP tT tX t\ t` td th tp tt tx t| t t t t t t tperlmain.cDynaLoader::boot_DynaLoader Unbalanced scopes: %d more ENTERs than LEAVEs Unbalanced saves: %d more saves than restores Unbalanced tmps: %d more allocs than frees Unbalanced context: %d more PUSHes than POPs Scalars leaked: %d No -e allowed in setuid scripts/tmp/perl-eXXXXXXCan't mktemp()Cannot open temporary file-I- -P-Suse Config qw(myconfig config_vars)print myconfig(),'@INC: '."@INC\n"config_vars(qw())/dev/nullUnrecognized switch: -%sCan't write to temp file for -e: %s-%s had compilation errors. Execution of %s aborted due to compilation errors. /Callback called exitCallback called exitrequire ''-dPERL5DBRecompile perl with -DDEBUGGING to use -D switch -INo space allowed after -I -M-muse no Can't use '%c' after -mname () split(/,/,q{})No space allowed after -%c-ssolarisSep 16 199615:33:37Can't emulate -%.1s on #! linemainmain::mainINC_@DB::/ Can't execute %s-ecc -E/usr/dist/pkgs/perl,v5.003/5bin.sun4-I/usr/dist/pkgs/perl,v5.003/lib/usr/bin/sed-e '1,/^#/d '-rprogram input from stdinCan't open perl script "%s": %s -xNo Perl script found in input perlperl -Can't chdir to %sargsDBdblinesubsingletracesignalmain" STDINstdinSTDOUTstdoutSTDERRstderrsolaris000ARGVENV$/usr/dist/pkgs/perl,v5.003/lib/sun4-solaris/5.003/usr/dist/pkgs/perl,v5.003/lib/usr/dist/pkgs/perl,v5.003/lib/site_perl/sun4-solaris/usr/dist/pkgs/perl,v5.003/lib/site_perl.BEGIN failed--compilation abortedEND failed--cleanup aborted%sBEGIN failed--compilation abortedEND failed--cleanup abortedBad free() ignoredBad symbol for arrayBad symbol for hashBad symbol for filehandle/lib/.pmRecursive inheritance detectedISACan't locate package %s for @%s::ISAUNIVERSAL::SUPERISAISA::ISACannot create %s::ISAAUTOLOAD::main::Variable "%c%s" is not imported(Did you mean &%s instead?) Global symbol "%s" requires explicit package nameHad to create %s unexpectedlyNDBM_FileDB_FileGDBM_FileSDBM_FileODBM_FileUse of $%s is deprecated *::*::FileHandle::Identifier "%s::%s" used only once: possible typoAttempt to free unreferenced glob pointersOVERLOADNot a subroutine reference in %%OVERLOADMethod for operation %s not found in package %.256s during blessing in overloaded package has no overloaded magicin overloaded package has no overloaded magicCopy method did not return a reference (Missing semicolon on previous line?) (Do you need to predeclare %.*s?) (Missing operator before %.*s?) \nCan't find string terminator %c%s%c anywhere before EOFUse of %s is deprecatedcomma-less variable list ; ;}continue{print;};Warning: Use of "%s" without parens is ambiguous\.^$@AGZdDwWsSbB+*?|()-nrtfeaxc0123456789[{]} #\%c better written as $%cBEGIN { require 'perl5db.pl' }Can't upgrade filter_add data to SVt_PVIOfilter_add func %lx (%s)filter_del func %lxfilter_del can only delete in reverse order (currently)filter_read %d: from rsfp filter_read %d: skipped (filter deleted) filter_read %d: via function %lx (%s) panic: yylex"Unrecognized character \%03o ignoredMissing right bracket;;LINE: while (<>) {chomp;@F=split(' '); ;}continue{print;}perlperl -perlindirperlCan't exec %sAmbiguous use of -%c => resolved to "-%c" =>Unrecognized file test: -%cUnmatched right bracketAmbiguous use of {%s} resolved to {"%s"}Unmatched right bracketReversed %c= operatorArray lengthScalarMultidimensional syntax %.*s not supportedYou need to quote "%s"Can't use "my %s" in sort comparisonFinal $ should be \$ or $nameArrayScalar value %.*s better written as $%.*sFinal @ should be \@ or @nameNumberStringStringBackticksCan't use \%c to mean $%c in expressionBackslashAmbiguous use of %s => resolved to "%s" =>Bad name after %s::Bare wordAmbiguous use of -%s resolved as -&%s()__ANON__Bareword "%s" not allowed while "strict subs" in useOperator or semicolon missing before %c%sAmbiguous use of %c resolved as operator %cmainENVchmod: mode argument is missing initial 0AnyDBM_File::ISAMissing $ on loop variable"no" not allowed in expressionPrecedence problem: open %.*s should be open(%.*s)filehandlefilehandle <> should be quotessubroutine namesort is now a reserved word::?Prototype not terminated__ANON__umask: argument is missing initial 0"use" not allowed in expression elseif should be elsif%s (...) interpreted as functionNo comma allowed after %s[...]{...}Ambiguous use of %c{%s%s} resolved to %c%s%sAmbiguous use of %c{%s} resolved to %c%sSearch pattern not terminatedSubstitution pattern not terminatedSubstitution replacement not terminatedeval do { };Translation pattern not terminatedTranslation replacement not terminatedbare << to mean <<"" Unterminated <> operatorGlob not terminatedpanic: scan_numIllegal octal digitMisplaced _ in numberMisplaced _ in numberFormat not terminatednext token ???%s%s has too many errors. "do" to call subroutinessyntax errorif BLOCK BLOCKunless BLOCK BLOCK1Out of memory for yacc stack(Did you mean $ or @ instead of %c?) Can't use global %s in "my"%s never introducedpanic: pad_allocpanic: pad_sv popanic: pad_free curpadpanic: pad_free popanic: pad_swipe curpadpanic: pad_swipe popanic: pad_reset curpadFound = in conditional, should be ==implicit split to @_a variablea constantimplicit split to @_Useless use of %s in void contextThat use of $[ is unsupportedlocalCan't localize a referenceCan't localize lexical variable %sParens missing around "%s" listmylocal;%s trapped by operation mask%s trapped by operation mask%s trapped by operation mask%s trapped by operation mask\s+%s trapped by operation mask%s trapped by operation mask%s trapped by operation maskModule name must be constantimportunimportBEGINAssignment to both a list and a scalarProbable precedence problem on %sCan't use %s for loop variableCan't undef active subroutinepanic: cv_clone: %s__ANON__Subroutine %s redefinedPrototype mismatch: (%s) vs (%s)-__ANON__Subroutine %s redefined__ANON__STDOUTFormat %s redefinedoops: oopsAVoops: oopsHVNOT IMPL LINE %d%s argument is not a HASH elementmain'ARGVmain'STDINArray @%s missing the @ in argument %d of %s()arrayHash %%%s missing the %% in argument %d of %s()hashmainpanic: ck_grep.pmNOT IMPL LINE %d_ARGVpanic: ck_split blocksymbolsubscalararrayhashMalformed prototype for %s: %sStatement unlikely to be reached(Maybe you meant system() when you said exec()?) NULL regexp argument/%.127s/: %sregexp too big/%.127s/: %sregexp out of spaceSequence (?%c...) not implementedSequence (?#... not terminatedSequence (?%c...) not recognized/%.127s/: %sunmatched () in regexp/%.127s/: %sunmatched () in regexp/%.127s/: %sjunk on end of regexpCan't do {n,m} with n > m%.*s matches null string many times/%.127s/: %snested *?+ in regexpinternal urp in regexp at /%s//%.127s/: %s?+* follows nothing in regexp/%.127s/: %strailing \ in regexp/%.127s/: %strailing \ in regexp/%.127s/: %sinternal disaster in regexp/%.127s/: %sinvalid [] range in regexp/%.127s/: %sunmatched [] in regexp(null)(null)(null)linechunkInsecure %s%sEXECCan't fork$Illegal octal digit ignored_TOPNo such hook: %sNo such signal: SIG%sFETCHSTOREDELETECLEARNEXTKEYFIRSTKEYEXISTSCan't break at that line NoNeSuChLDCLDCHLDSIG%s handler "%s" not defined. Bad associative arrayCan't unshiftpanic: null arrayFilehandle %s never openedFilehandle %s opened only for inputprint on closed filehandle %sNot an ARRAY referencean ARRAYan ARRAYNot a HASH referencea HASHa HASHpanic: do_match- -cf 'set nonomatch; glob ' 2>/dev/null |Read on closed filehandle <%s>panic: pp_iterpanic: do_substSubstitution loopSubstitution loopNot a CODE referencea subroutinea subroutineNot a CODE referenceNot a CODE referenceAUTOLOADUndefined subroutine &%s calledUndefined subroutine calledNo DBsub routineDeep recursion on subroutine "%s"Can't call method "%s" without a package or object referenceUNIVERSALCan't call method "%s" in empty package "%s"Can't locate object method "%s" via package "%s"Can't call method "%s" on unblessed referenceCan't locate object method "%s" via package "%s"Can't upgrade that kind of scalarCan't upgrade to undefCan't coerce %s to integer in %sCan't coerce %s to number in %sArgument "%s" isn't numeric in %sArgument "%s" isn't numericNULLREFSCALARLVALUEARRAYHASHCODEGLOBFORMATLINEFILEHANDLEUNKNOWNBizarre copy of %s in %sBizarre copy of %sSubroutine %s redefinedDon't know how to handle magic of type '%c'Can't modify non-existent substringpanic: sv_insertReference miscount in sv_replace()DESTROYAttempt to free unreferenced scalar semi-panic: attempt to dup freed stringNot a subroutine referenceUnable to create sub named "%s"Can't coerce %s to string in %sREFSCALARLVALUEARRAYHASHCODEGLOBFORMLINEUNKNOWNCan't bless non-reference valueBad filehandle: %sfilehandleBad filehandle: %sNOT IMPL LINE %dNot a GLOB referencea symbola symbolNot a SCALAR referencea SCALARa SCALARdo_study: out of memoryIllegal division by zeroIllegal modulus zeroCan't x= to readonly value-Illegal division by zeroCan't take log of %gCan't take sqrt of %gsubstr outside of stringNot a HASH referenceNot a HASH referenceOdd number of elements in hash list@ outside of stringX outside of stringx outside of string %% may only be used in unpackX outside of stringpanic: do_splitSplit looppanic: corrupt saved stack indexpanic: leave_scope clearsvpanic: leave_scope inconsistencySubstitution loopNot enough format argumentsRunaway formatpanic: mapstartXsub "%s" called in sortUndefined sort subroutine "%s" calledXsub called in sortUndefined subroutine in sortNot a CODE reference in sortabE0Exiting substitution via %sExiting subroutine via %sExiting eval via %sExiting substitition via %sExiting subroutine via %sExiting eval via %s%s(eval)DB::argsSort subroutine didn't return single valueSort subroutine didn't return a numeric valueNo DB::DB routine definedCan't return outside a subroutine%s did not return a true valuepanic: returnCan't "last" outside a blockLabel not found for "last %s"panic: lastCan't "next" outside a blockLabel not found for "next %s"Can't "redo" outside a blockLabel not found for "redo %s"Goto undefined subroutine &%sGoto undefined subroutineCan't goto subroutine outside a subroutineDeep recursion on subroutine "%s"goto must have labelpanic: gotoCan't find label %s %sPerl %s required--this is only version %s, stoppedNull filename usedrequire.h .ph %seval%s did not return a true value``r ...caughtWarning: something's wrong%s ...propagatedDied%sfilehandlefilehandleumaskTIEHASHTIEARRAYTIEHANDLETIESCALARCan't locate object method "%s" via package "%s"AnyDBM_FileTIEHASHAnyDBM_File.pmTIEHASHNo dbm on this machine Undefined format "%s" calledNot a format referencetoptopbad top format referenceUndefined top format "%s" calledFilehandle only opened for inputWrite on closed filehandlepage overflowFilehandle %s never openedFilehandle %s opened only for inputprintf on closed filehandle %sNegative lengthNegative lengthSyswrite on closed filehandleSend on closed socketioctlfcntlPossible memory corruption: %s overflowed 3rd argument0 but truesocketsocketpairbindbind() on closed fdconnectconnect() on closed fdlisten() on closed fdaccept() on closed fdshutdown() on closed fd[gs]etsockopt() on closed fdget{sock, peer}name() on closed fdstatTest on unopened file <%s>openHOMELOGDIRchdirchrootrenamelinksymlinkmkdirrmdir$systemexecPOSIX getpgrp can't take an argumentsetpgrpPOSIX setpgrp can't take an argumentsetprioritySunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec0 but true syscallToo many args to syscallToo few args to syscallpanic: do_transUse of %c in printf format not supported <>++rwr+piped openCan't do bidirectional pipewopenpiped openropenARGVOUTinplace openSTDOUTCan't do inplace edit: %s is not a regular fileCan't rename %s to %s: %s, skipping fileCan't rename %s to %s: %s, skipping file>Can't do inplace edit on %s: %sSTDOUTClose on unopened file <%s>tell() on unopened fileseek() on unopened fileStat on unopened file <%s>statThe stat preceding -l _ wasn't an lstatYou can't use -l on a filehandlelstatCan't exec "%s": %scsh/bin/shsh-cCan't exec "%s": %schmodchownkillUnrecognized signal name "%s"unlinkutimeBad arg length for %s, is %d, should be %dArg too short for msgsndCan't msgrcv to readonly varNULL regexp parameter/%.127s/: %scorrupted regexp program/%.127s/: %sregexp memory corruption/%.127s/: %scorrupted regexp pointersNo %s allowed while running setuidNo %s allowed while running setgid while running setuid while running setgid while running with -T switchPATHInsecure directory in %s%s$ENV{PATH}Insecure %s%s$ENV{PATH}IFSInsecure %s%s$ENV{IFS}nullstubscalarpushmarkwantarrayconstgvsvgvgelempadsvpadavpadhvpadanypushrerv2gvrv2svav2arylenrv2cvanoncodeprototyperefgensrefgenrefblessbacktickglobreadlinercatlineregcmayberegcompmatchsubstsubstconttranssassignaassignchopschopchompschompdefinedundefstudypospreinci_preincpredeci_predecpostinci_postincpostdeci_postdecpowmultiplyi_multiplydividei_dividemoduloi_modulorepeataddi_addsubtracti_subtractconcatstringifyleft_shiftright_shiftlti_ltgti_gtlei_legei_geeqi_eqnei_nencmpi_ncmpsltsgtslesgeseqsnescmpbit_andbit_xorbit_ornegatei_negatenotcomplementatan2sincosrandsrandexplogsqrtinthexoctabslengthsubstrvecindexrindexsprintfformlineordchrcryptucfirstlcfirstuclcquotemetarv2avaelemfastaelemasliceeachvalueskeysdeleteexistsrv2hvhelemhsliceunpackpacksplitjoinlistlsliceanonlistanonhashsplicepushpopshiftunshiftsortreversegrepstartgrepwhilemapstartmapwhilerangeflipflopandorxorcond_exprandassignorassignmethodentersubleavesubcallerwarndieresetlineseqnextstatedbstateunstackenterleavescopeenteriteriterenterloopleaveloopreturnlastnextredodumpgotoexitopenclosepipe_opfilenoumaskbinmodetieuntietieddbmopendbmclosesselectselectgetcreadenterwriteleavewriteprtfprintsysopensysreadsyswritesendrecveoftellseektruncatefcntlioctlflocksocketsockpairbindconnectlistenacceptshutdowngsockoptssockoptgetsocknamegetpeernamelstatstatftrreadftrwriteftrexecftereadftewritefteexecftisfteownedftrownedftzeroftsizeftmtimeftatimeftctimeftsockftchrftblkftfileftdirftpipeftlinkftsuidftsgidftsvtxftttyfttextftbinarychdirchownchrootunlinkchmodutimerenamelinksymlinkreadlinkmkdirrmdiropen_dirreaddirtelldirseekdirrewinddirclosedirforkwaitwaitpidsystemexeckillgetppidgetpgrpsetpgrpgetprioritysetprioritytimetmslocaltimegmtimealarmsleepshmgetshmctlshmreadshmwritemsggetmsgctlmsgsndmsgrcvsemgetsemctlsemoprequiredofileenterevalleaveevalentertryleavetryghbynameghbyaddrghostentgnbynamegnbyaddrgnetentgpbynamegpbynumbergprotoentgsbynamegsbyportgserventshostentsnetentsprotoentsserventehostentenetenteprotoenteserventgpwnamgpwuidgpwentspwentepwentggrnamggrgidggrentsgrentegrentgetloginsyscallnull operationstubscalarpushmarkwantarrayconstant itemscalar variableglob valueglob elemprivate variableprivate arrayprivate hashprivate somethingpush regexpref-to-glob castscalar derefarray lengthsubroutine derefanonymous subroutinesubroutine prototypereference constructorscalar ref constructorreference-type operatorblessbackticksglobappend I/O operatorregexp comp onceregexp compilationpattern matchsubstitutionsubstitution contcharacter translationscalar assignmentlist assignmentchopscalar chopsafe chopscalar safe chopdefined operatorundef operatorstudymatch positionpreincrementinteger preincrementpredecrementinteger predecrementpostincrementinteger postincrementpostdecrementinteger postdecrementexponentiationmultiplicationinteger multiplicationdivisioninteger divisionmodulusinteger modulusrepeatadditioninteger additionsubtractioninteger subtractionconcatenationstringleft bitshiftright bitshiftnumeric ltinteger ltnumeric gtinteger gtnumeric leinteger lenumeric geinteger genumeric eqinteger eqnumeric neinteger nespaceship operatorinteger spaceshipstring ltstring gtstring lestring gestring eqstring nestring comparisonbitwise andbitwise xorbitwise ornegateinteger negatenot1's complementatan2sincosrandsrandexplogsqrtinthexoctabslengthsubstrvecindexrindexsprintfformlineordchrcryptupper case firstlower case firstupper caselower casequote metacharsarray derefknown array elementarray elementarray sliceeachvalueskeysdeleteexists operatorassociative array derefassociative array elemassociative array sliceunpackpacksplitjoinlistlist sliceanonymous listanonymous hashsplicepushpopshiftunshiftsortreversegrepgrep iteratormapmap iteratorflipfloprange (or flip)range (or flop)logical andlogical orlogical xorconditional expressionlogical and assignmentlogical or assignmentmethod lookupsubroutine entrysubroutine exitcallerwarndieresetline sequencenext statementdebug next statementunstackblock entryblock exitblockforeach loop entryforeach loop iteratorloop entryloop exitreturnlastnextredodumpgotoexitopenclosepipefilenoumaskbinmodetieuntietieddbmopendbmcloseselect system callselectgetcreadwritewrite exitprintfprintsysopensysreadsyswritesendrecveoftellseektruncatefcntlioctlflocksocketsocketpairbindconnectlistenacceptshutdowngetsockoptsetsockoptgetsocknamegetpeernamelstatstat-R-W-X-r-w-x-e-O-o-z-s-M-A-C-S-c-b-f-d-p-l-u-g-k-t-T-Bchdirchownchrootunlinkchmodutimerenamelinksymlinkreadlinkmkdirrmdiropendirreaddirtelldirseekdirrewinddirclosedirforkwaitwaitpidsystemexeckillgetppidgetpgrpsetpgrpgetprioritysetprioritytimetimeslocaltimegmtimealarmsleepshmgetshmctlshmreadshmwritemsggetmsgctlmsgsndmsgrcvsemgetsemctlsemoprequiredo 'file'eval stringeval exiteval blockeval block exitgethostbynamegethostbyaddrgethostentgetnetbynamegetnetbyaddrgetnetentgetprotobynamegetprotobynumbergetprotoentgetservbynamegetservbyportgetserventsethostentsetnetentsetprotoentsetserventendhostentendnetentendprotoentendserventgetpwnamgetpwuidgetpwentsetpwentendpwentgetgrnamgetgrgidgetgrentsetgrentendgrentgetloginsyscall10123456789abcdef0123456789ABCDEFx\.^$@dDwWsSbB+*?|()-nrtfeaxc0123456789[{]}|/usr/bin/cshZEROHUPINTQUITILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMTERMUSR1USR2CHLDPWRWINCHURGIOSTOPTSTPCONTTTINTTOUVTALRMPROFXCPUXFSZWAITINGLWPFREEZETHAWCANCELRTMINNUM38NUM39NUM40NUM41NUM42NUM43RTMAXIOTCLDPOLL -fallbackabsboolnomethod""0+++=--=**=//=%%=****=<<<<=>>>>=&&=||=^^=<<=>>===!=<=>cmpltlegtgeeqne!~++--atan2cossinexplogsqrtxx=..==negUsage: DynaLoader::dl_load_file(filename)%sUsage: DynaLoader::dl_find_symbol(libhandle, symbolname)%sUsage: DynaLoader::dl_undef_symbols()Usage: DynaLoader::dl_install_xsub(perl_name, symref, filename="$Package")DynaLoaderUsage: DynaLoader::dl_error()DynaLoader.c%s object version %s does not match %s.pm $VERSION %s1.00(undef)DynaLoader::dl_load_fileDynaLoader::dl_find_symbolDynaLoader::dl_undef_symbolsDynaLoader::dl_install_xsubDynaLoader::dl_error+     $ (   0    v   " .5 COPQ\ vd,ls   v T Hhx,(  H!4)0/ T=F vxLUl`epw O`OxQ(R U\lUWzX[ \]`]l> P_\(` 4/aTAcRfbms?p0t``vHa MSxF`VD0d(0:@ Gd<Kt,4 $=jtAF wOX\V@i0$0TT`LHTۤX\H8tDYh[=T ]@T[]X&\d0? 09H A]JT@(SRZaf}0q}hP|,H?<@PD$0D|TDTD0E(D E(El,0EH9EAF,IFTHRF0Z|dU8q4r0 w w L*H4P l Dd("\.7P >ELV w$\`<ca lnv~  v<vLv   w( h8+t; I w,[ b w0mPz|t w4 w8 Ll< p w<dP\\L 08  w@% wD6hGV 8^TTmC|{ +<D wHh  , X  'p  $ * wL 2x A  F  Mf Z wM g p s wP {G H T wT wX ll w\ dH  w] |  P   3  8  I W w^ _x l z  И 2  w_ w` ` xd ' e X \ B & ` 1D @ wd K wh S wl [  ge  t wp x wt wx  T  w| w @ HF < x    ' 7  E  N w V<0 b  hވl tRx  w   |  w L w   8    x )#(P 6  C w Q|t _b4l l 4 tÌ<   L h  x x   x \  x t\-@SxS8`q gC x   x/P $ x P ˠpKzd! x*: @!? <H0 Zf ,p” n/>D( a  l   LQ4 x$4 x< KxXX a $n}@ 8H 8G  x  yH6l H| H/<OdI yLO yP\dHk `z  ޠ U! yT TD $ 8 yXx5% y -'?LZ3tg q { {$8<( {,` { h { { |"&x\7 DQ _\l4x~ |<  |Th D >$   X<<h0T=M S`a gv#t XX | 1?,  <Ɣ | | @ 4L- `4pDDQ^08n ls |}rl` $ |lD  _h(L  h  v *(x: NC` | w(<  n# @(= $z Xl*h? 4H v'RalH8k |$s |(~L\ a8iDPy LAd `8(HȐ 8  d,48 =(4N0\$j lqR |kll  O47 tXL \$B HI X(fD5 > F X c=r m Xt  4ed  ,0{ ) /h> FR _ l      ܄ P`Y,`L*:t8L8G S \ a8pɀ|P |  `lq\ PPhHl$   $ ,  >  G~8 X@ h0 t ` |  T  \| R |  xh < 0  UT! i! !(!9 $!P (!Z !g!ud!h !2H!op!!x! ! ,! ! <! " \" 0 "͘L"+H"7P<$"D <"Qh"b @"j&l"{xt"t" "c"d"xd" D"PH# H# X# L##h#/ #8#G$\#S<#d(<#w P#||# ## # t#0# P# #$ $ T$(4$4$*$9z$G X$Q<$a $hH\$x $ h$$$ \$V$`$ `$3P$j$ 8$$ % \%P%- %2 %; 0%B%Pd%^,%k %r % @% <% d%4%H%x0%*|%:% h%x& & @& &! &0D<&? &G@&S&d&s(\&S&40& l& p&@& t& x&0' |' '`' ','8 'F'V8'e 's \'g'@'X ' '8'Vp' 'hp' 'l( ((9(+ (;(Hh(Yl(g}H(t(ɴh(4(h( (.(l(e@( () )) ).C)B p)N)Z )b )rxx)$) )`)~L) )(L) L)x) *T$*0*(-\4*5 *>H*O *U l*aQ0*p*|Ed*[* * * D* @* * * * Բ$* 4*\|+ @+(+, +5 += +Gj+U +Z+i +n h+{ +Ѭ+ L+@+ + ,+ + + +l+Hh,4@,, ,' ,4Q,B $,P,^ (,n ,,v,ɨ,X ,p,0,,iP,Ϙ, t,P, h, 0- @- - @-!Ѩ-0 4->4 -P-(d-^Nx-k-y`|-$-P- - -- 8- (-@-|H-`.5.4tL.$ <.20.; .Ad.U|.cwT.~<0..!L.80.Pp. @.T . .Ӱ,/ D/ //!//D/C H/Mt/_L/g /x9 /D/l/Ր/|/Ф / H/?/ L/ 4/ P0|0 0 0 T0/ x050B0R X0^,0o0}l0 590 \0 `00Ll0 d0P011H1 - 11р 1@P1P d1W9`1b(1t1 81 h1 l1\1 1 01 !1 p111 d@2!D42 t2 ,2!jx 2/ x25 2Cf8<2P |2Xr<2e2q2D2,2 2 2 2 2 2 2 2 2R<33x$3$ <32x3B 3Kh3Y`3j* 3v 338h3 3 833 3 T3 3 L3 X43 4O4l (4%\4+ \464Eh4R 4a 4g%T4t 4}Լ4'44 4 444 4 4 4$5\5505%p56 @5?:5O 5V܌05d d5pI5ܐt5 $@5\ 5s55 5Dx5<@5h5Մ 6 6 6p6-06:6G"p6Y@6m D6{(h6 6 6\p6Dp6 6 6PH6 67 7 p74 7( 875Hx7C?7U 7] 7b7q 7~ 7`7 7 7 07 7t7P7D78(T8 8" 8.8C]x8S 8Z 8aT8qp`8 8 8|8Ӭ8k(8 \8 $8r`8 L8l8b( 99# (90 ,98 x9>b`9QP9c v9j 099 9 9w(9 999 9 09 (: 4: 8: 2:*yd@:8 `:?4:Lzl:Y:g :x d:~:H:::;@: : : %B:8; <;x;$;4 F;B ,;L ;S -;` @;stl; X;yt; D;P;tX; H;; ;< <<l<0h +$ |> t> x>->A |>Fd L>T >] *+>n $> p>8h><>8 > > >x>>Ōd>?t? ?# y !?*?<G04?K?T ?h?v ? ? ?@?8X?? D ? ?d(??th@ @ @$f@2¬\@= @D @Vh<@f @v@{x@<D@ $@t@@#x0@ @@C@@9A x<ATA/A; xAA AJ A] TAc<AoB AzDAt,A Av A Au0|A `AA AA B B \B;B&B4 B8 PB@4 BQl B` ,Bg Bo B}B0B B B BBPBP B BDC(C C|C* HC0`|C9^CGCU< Cd CkCz C C C CC C C C C>@ C C C!8CCPDLD DdD-D:0 DKL,hDZ|lDio$Dt ,\DD lD D D D D L"D DhD <D E E E E- E:8 E@LEOTEZ Ej,tE~ 0E EE <E EutE E@EE EE TF FsPF$TxF0 F6AFCh FQ F]$Fn\F}@F DF FFќ F F F F F G (G tG G,LpG@LGK Gb\`Gr?G |G G G GlG 8GP(GuG\G'G HGݼHhHH!LH,L H= $HF (HM HSHe<HstH dH\HHH H ,H 0H`PH 4HhH H 8I <IEIn0@I- @I> DIK hIW Ic{IqPdI HI (I perlcrti.s_ex_text0_ex_range0_ex_shared0crt1.s__crt_scratchvalues-Xa.cperlmain.cmy_perlxs_initperl.clocal_patchesfdscripttmpfpinit_idsinit_stacksinit_postdump_symbolsinit_main_stashinit_perllibopen_scriptvalidate_suidfind_beginninginit_predump_symbolsinit_lexerincpushusageinit_debuggermalloc.cnextfmorecorefindbucketgv.cgv_init_svtoke.cfilter_debugaoPerl_no_opmissingtermdepcomrestore_rsfpinclinePerl_skipspacefilter_getsPerl_check_unilopPerl_force_nextPerl_force_wordPerl_scan_wordPerl_force_identPerl_qPerl_sublex_startPerl_sublex_donePerl_scan_constPerl_intuit_morePerl_scan_identintuit_methodincl_perldbPerl_scan_formlinePerl_scan_heredocPerl_scan_inputsymbolPerl_scan_patPerl_scan_strset_cshPerl_checkcommaPerl_scan_substPerl_scan_transperly.cyysccsiddepop.cmodcountCvNAMEPerl_no_fh_allowedPerl_too_few_argumentsPerl_too_many_argumentsbad_typepad_findlexnullscalarbooleanPerl_modkidslist_assignmentregcomp.cregcregnextcharreganoderegbranchregtailregnoderegoptailreginsertregpieceregatomregcurlyregclassregsetutil.cmg.csave_magicrestore_magicrsignalmagic_methpackhv.cnew_hemore_hedel_hehsplithfreeentriesav.cav_reifyrun.cpp_hot.csv.cnew_svmore_svnew_xivmore_xivdel_xivnew_xnvmore_xnvdel_xnvnew_xrvmore_xrvdel_xrvnew_xpvmore_xpvdel_xpvsv_unglobnot_a_numbersv_mortalgrowpp.cdoencodesscope.cpp_ctl.clastgotoprobesortcxixdopoptosubdoparseformsortcvsortcmpdopoptolabelPerl_dopoptoevaldopoptoloopPerl_dofindlabelsave_linesPerl_doevalpp_sys.cdoformdoop.cdoio.cregexec.cregccregtryregmatchregrepeattaint.cglobals.cDynaLoader.cLastErrordl_nonlazydl_generic_private_initSaveErrordl_private_initcrtn.s_ex_text1_ex_range1_ex_shared1Perl_last_lopPerl_oopsCVPerl_pp_i_eqPerl_pp_ftrexecPerl_yysindexPerl_reglastparensocketlocalizingPerl_pp_gvsvPerl_pmtransPerl_pp_fttextPerl_lex_stuffscreamfirstPerl_pp_gtPerl_pp_nextPerl_pp_gvampergvPerl_scalarPerl_scan_numPerl_do_transPerl_pp_i_geno_wrongrefPerl_SvPerl_multi_startPerl_pp_sserventPerl_pp_dividechopsetPerl_die_wherePerl_pp_untie_startPerl_pp_leavesubPerl_mg_setPerl_thisexprPerl_pp_left_shiftPerl_sawparensPerl_no_modifysigemptysetPerl_newAVPerl_av_fillPerl_pp_lengthPerl_linklistPerl_newSVminus_pPerl_pp_padanyreadgmtimePerl_pp_seekPerl_nomemokgetpeernamedebnamePerl_sv_upgradePerl_pop_scopePerl_pp_concatstatusvaluepadPerl_localizeminus_aPerl_ck_globPerl_pp_ftatimeminus_catofatoiPerl_listkidsPerl_pp_getloginPerl_magic_existspackatolPerl_pp_gsockoptPerl_pp_printminus_lPerl_pp_joinPerl_pp_ftttyPerl_newGVOPPerl_pp_postincPerl_do_aexecsemgetminus_nPerl_taintingPerl_newLOOPEXPerl_sv_unrefPerl_pp_substrPerl_pp_eofPerl_ck_execPerl_pp_bit_xorPerl_pp_lslicecxstack_ixPerl_do_ipcctllastspbasedumplvlPerl_anPerl_oopsHVPerl_pp_recvorsPerl_lex_defernice_chunk_sizePerl_sv_reftypePerl_pp_intPerl_newXSPerl_last_unisignalstackfreadPerl_yydgotoPerl_pp_redoPerl_filter_readgconvertPerl_vtbl_amagicelemPerl_pp_definedPerl_pp_rv2svgetpwuidminus_FPerl_gp_refrmdirPerl_pp_andPerl_pp_enterwritePerl_sv_insertstrchopgetprotobynameboot_DynaLoaderPerl_hv_magicdelaymagicPerl_ck_funPerl_regsizePerl_sv_2mortalPerl_vtbl_arylenPerl_pp_gotosetpriorityPerl_ck_subrPerl_cshnamePerl_tokenbufPerl_scan_hexPerl_pp_sendtoupperPerl_pp_refgen_environperl_get_cv_endPerl_pp_aassignendprotoentPerl_rsfp_filterspadix_floorPerl_pp_multiplymemmovePerl_sv_isaPerl_pp_getsocknamePerl_lex_dojoinPerl_op_descPerl_magic_setpackPerl_pp_leavewritePerl_pp_i_nePerl_newASSIGNOPPerl_no_helemPerl_regnparPerl_simpleshmctlPerl_regendpPerl_pregcompsv_rootgetpidforkPerl_pp_execPerl_newUNOPPerl_op_freePerl_do_semopXS_DynaLoader_dl_install_xsubwarnhookPerl_pp_dbstate_iobmaxsysfdPerl_magic_setenvperl_get_avPerl_foldPerl_pp_grepstartPerl_warn_nlPerl_pp_umaskPerl_ck_lfunPerl_rninstrPerl_magic_setmgloblaststype_ex_registerreaddirPerl_vtbl_globPerl_pp_unshiftpreambledPerl_pp_ftrwritePerl_pp_ftctimecxstackPerl_AMG_namesPerl_pp_rand__flsbufPerl_yytablePerl_save_hashPerl_pp_chompPerl_newANONSUBPerl_ck_repeatPerl_pp_i_lePerl_pp_dbmclosestatcache_GLOBAL_OFFSET_TABLE_orslenPerl_pp_diePerl_utilizesetregidPerl_pp_ftpipePerl_do_msgsndPerl_newSVOPPerl_pp_pushfdpidPerl_regxendPerl_pp_renamePerl_ck_deletesleeppipePerl_pp_ftrreadPerl_pp_subtractPerl_no_funcPerl_oldoldbufptrPerl_newAVREFsigactionPerl_pp_i_ltPerl_statbufPerl_pp_eserventPerl_magic_setsigPerl_pp_uc__ctypePerl_pp_grepwhilePerl_sv_freePerl_ck_matchPerl_pp_globgetnetentPerl_curinterpsetpwentPerl_pp_acceptPerl_pp_epwentPerl_pp_forkPerl_profiledataPerl_pp_ftereadperl_get_hvlastscreamPerl_pp_snetentPerl_gidscreamnextPerl_euidPerl_pp_hexPerl_dowantarrayPerl_pp_flopPerl_sv_getsgethostbynamePerl_av_makePerl_pp_eprotoentmain_cvPerl_gv_initPerl_magic_getuvarPerl_vtbl_posfirstgvPerl_pp_ftisPerl_pp_stubmaxscreamPerl_pp_moduloPerl_pp_valuesPerl_hexdigitPerl_magic_setglobPerl_pp_gserventPerl_refkidsPerl_pp_sassignfseekPerl_hv_undefmkdirPerl_newCONDOPPerl_gv_fetchmethodPerl_maxoPerl_cxincforkprocessPerl_pp_ordPerl_pp_existsgeteuidsignalPerl_pp_eachPerl_pp_getpriorityPerl_regprecompErrorPerl_pp_tieacceptPerl_do_shmioatexitPerl_av_unshiftPerl_pp_tiedPerl_newFORMPerl_pp_sprintfexitpidstatusPerl_pp_sockpairtelldirPerl_yyerrflagPerl_sv_isobjectrandstrerrorPerl_cpytillPerl_gv_stashsvPerl_sv_newrefsetnetentPerl_pp_ggrgidPerl_pp_bindalarmperl_destructPerl_ck_svconstPerl_ck_lengthconstPerl_sv_clean_allPerl_amagic_generationPerl_pop_returnPerl_pp_callerPerl_gv_fetchfilePerl_regkindPerl_newRVPerl_save_deletePerl_magic_setdblinePerl_Gv_AMupdatePerl_pp_listenPerl_curcopperl_call_pvPerl_newOPPerl_magic_setsubstrgetloginno_myglobPerl_save_aptrPerl_messPerl_dsPerl_stackPerl_pp_methodPerl_ck_concatPerl_magic_setamagicPerl_pp_atan2Perl_regcodelogPerl_gv_checkPerl_cv_undefPerl_ck_spairPerl_magic_gettaintPerl_pp_iterPerl_ck_ftstdirtytolowerlockfrestartopPerl_pp_alarmPerl_pp_regcmaybePerl_dcPerl_yydefredPerl_push_returnmallocPerl_bufbasetimePerl_pp_dumpDBsinglePerl_pp_padavPerl_pp_complementfchownPerl_diPerl_pp_leavePerl_pp_shmgeteval_startPerl_magic_wipepacksprintfPerl_save_sptrPerl_pp_scopePerl_pp_msgrcvPerl_pp_gnbyaddrPerl_pp_exitPerl_pp_enetentsemctlPerl_pp_sselectPerl_ck_requirePerl_evalseqcddirPerl_leave_scopeperl_destruct_leveleval_rootsymlinkPerl_sv_2cvPerl_pp_utimePerl_xiv_rootpowPerl_pp_flipsocketpairperl_constructPerl_newSVREFPerl_av_undefPerl_start_subparsee_tmpnamePerl_pp_enteriterPerl_hv_deletePerl_pp_chownPerl_naopendirPerl_sub_generationsendPerl_patleavePerl_scopestackPerl_mg_findPerl_pp_indreadincgvPerl_pp_anonlistPerl_do_openPerl_timesbufPerl_pp_deletebindPerl_myPerl_pp_setpgrpPerl_padixPerl_pp_ltPerl_sv_clean_objsPerl_op_seqmaxPerl_pp_gmtimePerl_pp_spwentPerl_magic_setbmPerl_pp_resetPerl_prepend_elemPerl_vtbl_vec_initendnetentPerl_sv_clearPerl_pad_svofmtPerl_pp_leavetryPerl_pp_chdirPerl_calllistfwritePerl_pregexecPerl_ibcmpPerl_savestack_ixPerl_vtbl_uvarPerl_pp_padhvregcppushPerl_pp_lcPerl_vtbl_taintPerl_pp_lemodfPerl_pp_ftsvtxPerl_amagic_callPerl_hoistmustsetsockoptPerl_pp_tellsetgrentPerl_opPerl_retstack_maxPerl_sv_noPerl_pp_filenogetprotobynumberPerl_yyparsedupPerl_pp_postdecumasksv_countPerl_sv_unmagicPerl_fbm_instrPerl_pp_study.umulPerl_ck_selectPerl_freqPerl_save_svrefPerl_repeatcpyendserventfputsPerl_pp_ftsizeh_errnoPerl_pp_xorPerl_nextvalPerl_linestrPerl_pp_i_multiplyPerl_savestack_filbuf.mul.uremPerl_pp_timePerl_pp_predecPerl_pp_wantarraylastfdPerl_regstartpPerl_pp_gpbynumberPerl_hv_itervalPerl_pp_prtfPerl_listPerl_pp_nePerl_pp_aelemPerl_pp_egrentPerl_regboldebdelimtimePerl_pp_ftlinkPerl_pp_tmsPerl_pp_gpwuidPerl_hv_storePerl_pp_i_modulo.remPerl_do_kvPerl_pp_ssockoptPerl_warngetserventPerl_pp_popPerl_pp_ftblkPerl_pp_i_negateformfeedPerl_sv_2ioPerl_pp_posPerl_lex_casemodsrunlevelPerl_pp_shutdownPerl_bind_matchPerl_pp_powsetpgrpgetpwentsetegidPerl_oldbufptrPerl_magic_setPerl_pp_reverseftellmystack_spPerl_pp_orPerl_pp_ncmpPerl_compilingtoptargetPerl_lex_endPerl_sv_setsvPerl_scalarvoidPerl_pp_ftrownedPerl_max_intro_pendingsortstackPerl_ck_evalPerl_cv_clonePerl_pp_waitPerl_pp_ghbynamePerl_pp_chrPerl_pp_socketPerl_hv_fetchPerl_mg_freegetuidparsehooksiglongjmpPerl_newSTATEOPPerl_pp_shmreadPerl_ppaddrPerl_sv_yesPerl_av_storePerl_pp_logPerl_sv_growPerl_sublinePerl_pp_shostentin_evalPerl_pp_entertryPerl_pp_connectPerl_pp_gnetentPerl_vertPerl_fbm_compilePerl_pp_mapwhileXS_DynaLoader_dl_find_symbolPerl_lex_casestackPerl_av_fetchlinearyPerl_av_extendleftgvPerl_jmaybevsprintfPerl_pp_semgetPerl_pp_octPerl_newNULLLISTPerl_magic_setuvarsqrtPerl_sv_newmortalPerl_av_shiftPerl_pp_right_shiftungetcqsortPerl_magic_getarylenPerl_xrv_rootPerl_vtbl_dblinePerl_pp_chrootgetpwnamsawiPerl_gv_stashpvPerl_do_vopPerl_pp_ftsgidPerl_sv_setpvmainstackPerl_pp_waitpidfclosePerl_pp_bit_and___ArgvgetenvPerl_pp_srefgenPerl_pp_sgtPerl_last_lop_opPerl_sv_2ivPerl_instroldlastpmPerl_pp_cryptyydestructgetservbynamePerl_pp_ftbinaryPerl_block_startPerl_pp_scalardup2_sysconfmsgrcvPerl_ck_shiftPerl_gv_HVaddperl_call_svkillpgPerl_do_readlinesyscallwaitmystack_basePerl_pp_systemPerl_pp_enterevalPerl_filter_delPerl_do_printPerl_pp_closeDBsignalPerl_ck_listiobselectPerl_pp_seekdirmktempPerl_watchaddrPerl_sv_catpvnwaitpidPerl_pp_sinPerl_pp_ftewritePerl_save_itemPerl_pp_bit_orPerl_sv_setnvPerl_pp_ucfirstPerl_stack_spPerl_lex_brackstackPerl_pp_seqPerl_xiv_arenarootPerl_origenvironPerl_pp_mkdirDBtracestrncpyPerl_sv_blessgethostbyaddrPerl_sv_incPerl_nexttypePerl_pp_regcompPerl_pp_sgrentPerl_xpv_rootPerl_op_namePerl_pp_truncatePerl_sv_setref_pvPerl_my_unexectaintedPerl_gv_fullnamePerl_pp_unpack_DYNAMICPerl_hv_clearorigfilenamePerl_pp_sgerenameperl_allocPerl_pp_aslicePerl_pp_lineseqPerl_pp_sqrtPerl_pp_orassignPerl_pp_padsvPerl_sv_chopPerl_sv_mortalcopyPerl_pp_schopPerl_save_longPerl_pp_getpeernamePerl_sv_undefPerl_pp_rindexPerl_pp_pushrePerl_yywarnPerl_vtbl_isaPerl_pp_ftsockdowarnPerl_pp_slePerl_save_I32Perl_sv_free_arenasPerl_sv_decPerl_pp_cosstrncmpPerl_lex_startsPerl_my_pclosePerl_io_closePerl_comppad_namePerl_moreswitchesPerl_mg_magicalPerl_XpvPerl_looks_like_numbergetsockoptPerl_mg_copyPerl_vtbl_bmPerl_sv_setref_nvPerl_my_lstatPerl_my_statgetgrentPerl_hv_iterinitchdirgetpriorityPerl_deprecatePerl_pp_sltPerl_pp_anonhashPerl_sv_2nvPerl_do_chopperl_parseprintf__iobexeclchownPerl_scopestack_ixPerl_yycheckPerl_newANONHASHPerl_ck_rvconstPerl_pp_anoncodePerl_pp_getpgrpcurstashstdingvsetlocalePerl_pp_ioctlDBgvPerl_newLOOPOPArgvPerl_sig_numPerl_no_securityPerl_av_clearexecvPerl_hv_iterkeypreambleavgetprotoenterrgvPerl_vtbl_packPerl_vtbl_packelemPerl_magic_getPerl_pp_andassignPerl_pp_warnmain_rootPerl_subnamePerl_sv_setivPerl_lex_replPerl_pp_srandPerl_stack_basebeginavPerl_packagePerl_newLISTOPPerl_ck_rfunPerl_pp_negatePerl_ck_gvconstPerl_screaminstrPerl_pp_rangestrcatPerl_do_chompcryptPerl_lex_inwhatno_symrefioctlstatnamePerl_pp_msgsndPerl_regparsePerl_sv_setref_ivPerl_pp_indexPerl_pp_getcPerl_pp_ftchrPerl_newSUBperl_freePerl_magic_clearenvgetgrnamwritereallocPerl_cshlenstrrchrPerl_magic_getposXS_DynaLoader_dl_errorPerl_ninstrPerl_pp_lcfirstPerl_do_execfreePerl_xnv_rootPerl_refatan2Perl_magic_nextpackPerl_nextargvXS_DynaLoader_dl_load_filePerl_invertPerl_do_vecsetPerl_ck_splitPerl_he_delayfreePerl_pp_constPerl_lex_inpatPerl_pp_localtimePerl_av_lenPerl_av_pushPerl_osnamesendtoPerl_ck_grepPerl_newRANGEPerl_savestack_growsortstashPerl_pp_stringifysave_ivPerl_pp_fteownedPerl_gv_efullnamePerl_pp_snePerl_save_freeopPerl_pp_ghostentPerl_pad_resetPerl_pp_shmctlgetppidPerl_pp_hslicemystrksplitstrdoswitchesPerl_sv_lenfdopensbrkPerl_lex_state_exitPerl_pp_scmpPerl_do_sprintfPerl_regeolPerl_hv_iternextPerl_pp_transPerl_scopePerl_warn_reservedsv_objcountPerl_hintsPerl_save_pptrPerl_save_freepvmultilinePerl_magic_setarylenPerl_sighandlerPerl_pp_ftzeroPerl_stack_growPerl_pp_entersubPerl_pp_msggetPerl_scalarkidsfchmodPerl_applyPerl_pp_rewinddirPerl_assertrefexpPerl_bufptrPerl_regnaughtyPerl_pp_gpwent_ex_deregisterPerl_expectenvironbodytargetPerl_pp_preincPerl_pp_killPerl_yylenPerl_do_pipesawvecsrandPerl_pp_fcntlerrnoPerl_vtbl_sigPerl_yyerroroldnamePerl_regnextPerl_pp_refPerl_pp_requirePerl_pp_dbmopenPerl_pp_telldirmain_startsetserventPerl_YesunlinkPerl_yydebuggetnetbyname__cg89_usedendavPerl_lex_startPerl_pad_allocPerl_sv_setref_pvnPerl_newGVREFPerl_pp_getppidgetgrgidPerl_newLOGOPPerl_save_scalarPerl_pp_vecPerl_vtbl_amagicPerl_pp_expPerl_pp_open__cg92_usedstrchrPerl_pp_i_ncmporigargvgetpgrpgetegidtop_envPerl_newANONLISTPerl_vtbl_envPerl_sv_backoffPerl_savepvnPerl_do_eofsethostentperl_call_argvPerl_newPMOPPerl_stack_maxlstatPerl_keyworddefoutgvPerl_pp_semopPerl_do_seekPerl_newSVpvutime__fnonstd_usedperl_eval_svPerl_yylexPerl_multi_endPerl_pp_formlinePerl_pp_chmodfreePerl_save_clearsvPerl_pp_i_addPerl_pp_pushmarkshutdownPerl_pp_pipe_opmsggetPerl_dounwindgetsocknamePerl_do_msgrcvPerl_pp_gprotoentPerl_yylhsPerl_pp_lstatPerl_my_setenvPerl_pp_repeatclosePerl_pp_ehostentPerl_gp_freePerl_pp_helemPerl_pp_ghbyaddrdlevelmystack_maxPerl_pp_schompPerl_he_freePerl_do_joinPerl_pp_leaveevalPerl_sv_report_usedPerl_newHVREFPerl_ck_truncorigargcPerl_regsawbackPerl_pp_sysopenPerl_newSVnvclosedirPerl_regprevPerl_force_listPerl_variesPerl_pp_shmwritecurstnamePerl_vtbl_svPerl_pp_gpwnamPerl_ck_sortPerl_mg_clearPerl_sv_add_arenasortcopopenPerl_block_endPerl_watchokregflagsPerl_newFOROPPerl_vtbl_envelemPerl_reall_srchlensetreuidPerl_scrgvPerl_pp_av2arylenPerl_pp_shiftPerl_append_elemPerl_pp_ftsuidPerl_peepdoextractPerl_bufendPerl_save_destructorPerl_pp_sysreadstrcmpofslenPerl_sv_replacePerl_pp_returnPerl_markstack_ptrDBsubPerl_mg_lenPerl_pp_semctlPerl_savepvPerl_opargsargvoutgvPerl_taint_nottmps_floorPerl_newSVivPerl_pp_syswritePerl_magic_clearpackPerl_comppadpadnamedlsymperl_init_i18nl14nPerl_magic_setpos_edata_PROCEDURE_LINKAGE_TABLE_Perl_pp_i_subtractfopenftruncatePerl_filter_addPerl_ck_formlinePerl_pp_nextstatePerl_av_popmemsetPerl_regdummyPerl_no_sock_funcdefgvPerl_uidPerl_yyrindexPerl_wait4piddlopenPerl_do_execPerl_pidgonePerl_sv_magicPerl_pp_gsbynamefcntlPerl_append_listPerl_pp_link__fsr_init_valuePerl_pp_prototypePerl_newGVgenPerl_gen_constant_listgetgroupsPerl_no_aelemPerl_pp_rmdirPerl_siggvPerl_magic_lenPerl_pp_syscallPerl_yygindexPerl_rsfpexecvpPerl_no_usymPerl_lex_fakebrackPerl_save_freesvstrcpyXS_DynaLoader_dl_undef_symbolsPerl_nexttokeregcppopPerl_pp_setprioritygensymPerl_pp_unlinkPerl_sig_namePerl_pp_ggrentPerl_NoPerl_newBINOPPerl_pp_enterloopPerl_pp_gpbynamePerl_ck_eofPerl_pp_i_dividePerl_pp_symlinkPerl_newWHILEOPPerl_save_aryPerl_push_scopepad_reset_pendingPerl_hv_iternextsvPerl_free_tmpsPerl_markstack_maxIlocalpatchesPerl_vtbl_mglobPerl_envgvPerl_pp_enter_etextnice_chunkPerl_sv_reset_lib_versionkilltmps_max__dtoufflushPerl_in_myPerl_runopsPerl_newPVOPCmdPerl_sv_pvn_forcePerl_pp_substPerl_ck_indexPerl_pp_fteexecnrspreprocessPerl_pp_substcontPerl_ck_nullPerl_my_exitPerl_gv_fetchpvrightgvPerl_multi_closelockf_emulate_flocke_fpPerl_pp_matchsecondgvPerl_no_dir_funcPerl_vtbl_isaelemmemcmpPerl_pp_rv2cvPerl_pad_leavemyPerl_pp_quotemetachrootlast_in_gvPerl_sv_setpvnPerl_magic_setvecPerl_pp_blessPerl_pp_gelemPerl_pp_open_dirpatchlevel_ctypePerl_pp_cond_exprPerl_pp_spliceperl_runPerl_scopestack_maxPerl_save_intPerl_yylvalendpwentgetgidPerl_pad_allocmyPerl_pp_sortPerl_newSVsvPerl_newCVREFPerl_he_rootPerl_pp_readlinePerl_pp_ftfilePerl_pp_sprotoentdefstashPerl_error_countPerl_sv_2boolPerl_newHVDBlinePerl_gv_fetchmethPerl_newSLICEOPPerl_pp_ftmtimemainPerl_newPROGPerl_pp_readlinkmsgsndPerl_setenv_getixPerl_pp_nullPerl_do_closetmps_stackPerl_pp_rv2avPerl_ingroupPerl_pp_notPerl_newIOPerl_magic_getpackPerl_pp_leaveloopPerl_pp_add.udivreadlinkPerl_lex_formbrackdlmaxperl_get_svPerl_candoPerl_convertPerl_taint_envPerl_curpaddl_add_underscorePerl_yycharPerl_my_bcopy.divPerl_pp_chopPerl_warn_nosemiPerl_sv_dump__filbufchmodcoplinePerl_provide_refPerl_pp_ftdirofsop_maskPerl_pp_rcatlinePerl_pp_ggrnammemcpyinplacePerl_retstackPerl_pad_freePerl_pp_backticklastsizestrlenPerl_savestack_maxPerl_pp_rv2gvPerl_pp_mapstartPerl_pp_readPerl_oopsAVPerl_pp_undefPerl_newSVrvargvgvPerl_dump_mstatsshmatPerl_modPerl_pregfreePerl_whichsigPerl_pp_dofilemsgctlPerl_save_listlinkunsafesigsetjmpsawstudyPerl_pp_rv2hvsv_arenarootlocaltime__environ_lockrsPerl_pp_keysstatPerl_rcsidPerl_pp_absPerl_do_ipcgetperl_require_pvshmgetPerl_gv_AVaddPerl_pp_lastPerl_pp_gsbyportPerl_setdefoutPerl_sv_usepvnPerl_croakPerl_checkPerl_ck_retargetdlerrordo_undumpPerl_multi_openendhostentperldbPerl_regarglensawampersandPerl_sv_catsvseteuidPerl_lex_bracketsPerl_origalenpausePerl_vtbl_substrgetnetbyaddr_finiPerl_pp_selectPerl_sv_eqPerl_lex_expectPerl_markstack_growseekdirrecvfromPerl_pmruntimesemopsinPerl_pp_packPerl_pad_findmyPerl_fold_constantsPerl_pad_swipetruncatePerl_av_fakeshmdtPerl_reginputPerl_taint_properPerl_sv_cmpcurpmPerl_pp_listPerl_pp_splitPerl_compcvPerl_pp_closedirPerl_save_hptrPerl_magic_getglobgetservbyportstatgvperl_call_methodPerl_pp_msgctlgethostentdiehookPerl_lex_opwarn_uninitPerl_vtbl_sigelemlistensetprotoentPerl_min_intro_pendingPerl_magic_settaintPerl_pp_gePerl_comppad_name_fillPerl_pp_readdirPerl_pp_binmodefstatdebstashfprintfdebugPerl_save_nogvPerl_pp_i_gtPerl_pp_sleepPerl_my_popenPerl_hv_existsPerl_do_telltmps_ixPerl_diePerl_pp_statPerl_pp_unstackPerl_pp_eqPerl_pp_gnbynamefilemodedbargstimesPerl_magic_setisaPerl_sv_catpvPerl_pp_aelemfastcxstack_maxPerl_magicnamePerl_mg_getisattyPerl_egidPerl_cop_seqmaxPerl_sv_2pvPerl_regtillPerl_scalarseqcosPerl_markstackformtargetPerl_pmflagPerl_pp_flockPerl_retstack_ixPerl_yynerrslaststatvalPerl_no_memPerl_scan_octPerl_gv_IOaddPerl_yyvalendgrentconnect <34*</4 <14<-4</4 <04<-4 <24</4<-4<-4<-4<.4 <14<-4<-4 <04 <14 <14</4</4 <24 <04 <24<54cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMI@(#)fcntl.h 1.9 93/10/12 SMI@(#)fcntl.h 1.31 95/01/19 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMI@(#)limits.h 1.29 96/01/11 SMI@(#)fcntl.h 1.9 93/10/12 SMI@(#)fcntl.h 1.31 95/01/19 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMI@(#)limits.h 1.29 96/01/11 SMI@(#)float.h 1.13 94/07/29 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMI@(#)socket.h 1.15 95/02/24 SMI@(#)netconfig.h 1.13 95/02/24 SMI@(#)netdb.h 1.14 94/10/04 SMI@(#)pwd.h 1.17 95/08/28 SMI@(#)grp.h 1.16 95/08/28 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)fcntl.h 1.9 93/10/12 SMI@(#)fcntl.h 1.31 95/01/19 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMI@(#)ipc.h 1.15 94/09/03 SMI@(#)msg.h 1.21 94/05/02 SMI@(#)sem.h 1.20 94/09/02 SMI@(#)shm.h 1.28 96/01/23 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)fcntl.h 1.9 93/10/12 SMI@(#)fcntl.h 1.31 95/01/19 SMI@(#)socket.h 1.15 95/02/24 SMI@(#)netconfig.h 1.13 95/02/24 SMI@(#)netdb.h 1.14 94/10/04 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0cg: SC4.0 28 Jun 1996 4.0 patch 102933-08@(#)stdio.h 1.39 95/12/04 SMI@(#)feature_tests.h 1.7 94/12/06 SMI@(#)va_list.h 1.6 96/01/26 SMI@(#)ctype.h 1.19 95/01/28 SMI@(#)locale.h 1.13 93/07/09 SMI@(#)libintl.h 1.7 93/10/06 SMI@(#)setjmp.h 1.23 96/01/26 SMI@(#)param.h 1.34 95/11/05 SMI@(#)types.h 1.38 95/11/14 SMI@(#)isa_defs.h 1.7 94/10/26 SMI@(#)machtypes.h 1.9 94/11/05 SMI@(#)select.h 1.10 92/07/14 SMI@(#)time.h 2.47 95/08/24 SMI@(#)time.h 1.23 95/08/28 SMI@(#)siginfo.h 1.36 95/08/24 SMI@(#)machsig.h 1.10 94/11/05 SMI@(#)unistd.h 1.24 95/08/24 SMI@(#)stdlib.h 1.27 95/08/28 SMI@(#)string.h 1.17 95/08/28 SMI@(#)in.h 1.4 93/07/06 SMI@(#)stream.h 1.56 94/09/28 SMI@(#)vnode.h 1.53 95/08/29 SMI@(#)t_lock.h 1.42 94/11/02 SMI@(#)machlock.h 1.14 94/10/20 SMI@(#)dki_lkinfo.h 1.8 93/05/03 SMI@(#)dl.h 1.13 93/08/18 SMI@(#)sleepq.h 1.17 94/07/29 SMI@(#)turnstile.h 1.27 94/10/27 SMI@(#)pirec.h 1.11 93/12/20 SMI@(#)mutex.h 1.14 94/07/29 SMI@(#)rwlock.h 1.3 94/07/29 SMI@(#)semaphore.h 1.4 94/07/29 SMI@(#)condvar.h 1.6 94/07/29 SMI@(#)cred.h 1.18 94/12/04 SMI@(#)uio.h 1.21 94/04/22 SMI@(#)seg_enum.h 1.1 93/04/03 SMI@(#)poll.h 1.19 94/08/31 SMI@(#)strmdep.h 1.8 92/07/14 SMI@(#)byteorder.h 1.9 94/01/04 SMI@(#)stat.h 1.26 95/08/14 SMI@(#)times.h 1.9 92/08/18 SMI@(#)errno.h 1.13 95/09/10 SMI@(#)errno.h 1.15 95/01/22 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.19 95/08/28 SMI@(#)dirent.h 1.15 94/07/26 SMI@(#)signal.h 1.27 95/08/30 SMI@(#)signal.h 1.44 95/03/16 SMI@(#)procset.h 1.15 93/05/05 SMI@(#)math.h 2.5 95/02/07@(#)floatingpoint.h 2.4 94/06/09@(#)ieeefp.h 2.7 94/11/09@(#)stdarg.h 1.38 96/01/26 SMI@(#)dlfcn.h 1.14 93/10/26 SMIacomp: SC4.0 18 Oct 1995 C 4.0ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.ex_shared.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.dynamic.plt.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrperlmain.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O perlmain.c -W0,-xpmainperl.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O perl.c -W0,-xpmalloc.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O malloc.c -W0,-xpgv.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O gv.c -W0,-xptoke.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O toke.c -W0,-xpperly.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O perly.c -W0,-xpop.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O op.c -W0,-xpregcomp.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O regcomp.c -W0,-xputil.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O util.c -W0,-xpmg.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O mg.c -W0,-xphv.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O hv.c -W0,-xpav.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O av.c -W0,-xprun.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O run.c -W0,-xppp_hot.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O pp_hot.c -W0,-xpsv.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O sv.c -W0,-xppp.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O pp.c -W0,-xpscope.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O scope.c -W0,-xppp_ctl.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O pp_ctl.c -W0,-xppp_sys.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O pp_sys.c -W0,-xpdoop.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O doop.c -W0,-xpdoio.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O doio.c -W0,-xpregexec.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O regexec.c -W0,-xptaint.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O taint.c -W0,-xpglobals.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O globals.c -W0,-xpDynaLoader.cXa ; V=3.1 ; R=SC4.0 18 Oct 1995 C 4.0/export/disk1/perl5/perl5.003.5x/ext/DynaLoader; /net/crypto/export/dist/local/share/sunpro/5.x-sparc/bin/../SC4.0/bin/cc -c -O -DVERSION='"1.00"' -DXS_VERSION='"1.00"' -I../.. -DLIBC='/lib/libc.so' DynaLoader.c -W0,-xp +  ++TB / 9 $ C I8O8U  g$$o((Yx }  00 X    y\ X vvv^4I   "` p V0707010000779f000081fd00000000000000000000000149fde5fe0000003f000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/netLOAD.sh#!/bin/ksh LANG=C export LANG exec /etc/STATsrv/bin/netLOAD $1 070701000077a2000081ed00000000000000000000000149fde60600000083000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/oraENQ.sh#!/bin/ksh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.oraENQ -Timeout $1 -oraUSER oracle 070701000077a4000081a400000000000000000000000145d6c08f0000004f000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/oraENQ.sqlconnect / as sysdba select * from v$enqueue_stat where cum_wait_time > 0; exit 070701000077a8000081ed00000000000000000000000149fde60f00000084000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/oraEXEC.sh#!/bin/ksh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.oraEXEC -Timeout $1 -oraUSER oracle 070701000077a9000081ed00000000000000000000000149fde61b00000082000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/oraIO.sh#!/bin/ksh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.oraIO -Timeout $1 -oraUSER oracle 070701000077ab000081ed00000000000000000000000149fde62300000085000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/oraLATCH.sh#!/bin/ksh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.oraLATCH -Timeout $1 -oraUSER oracle 070701000077ae000081ed00000000000000000000000149fde62a00000085000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/oraSLEEP.sh#!/bin/ksh LANG=C export LANG cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX /etc/STATsrv/bin/x.oraSLEEP -Timeout $1 -oraUSER oracle 070701000077b0000081a40000000000000000000000013dc9451600000087000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/oraexec.sqlconnect / as sysdba select value from v$sysstat where name in ('user commits', 'execute count' ); select count(*) from v$session; exit 070701000077b2000081a40000000000000000000000013dc945150000014b000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/oraio.sqlconnect / as sysdba column "NAME" format A70 set lines 200 select a.name, b.phyblkrd, b.phyblkwrt, b.phyrds, b.phywrts from v$datafile a, v$filestat b where a.file# = b.file#; select a.name, b.phyblkrd, b.phyblkwrt, b.phyrds, b.phywrts from v$tempfile a, v$tempstat b where a.file# = b.file#; exit 070701000077b3000081a40000000000000000000000013dc9451600000087000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/oralatch.sqlconnect / as sysdba select total_waits, total_timeouts, time_waited, average_wait from v$system_event where event = 'latch free'; exit 070701000077b4000081a40000000000000000000000013ec1035c00000093000000200000001d00000000000000000000002300000000root/etc/STATsrv/bin/oravlatch.sqlconnect / as sysdba col name format a40 set lines 120 select sleeps, sleep1, sleep2, sleep3, sleep4, name from v$latch order by sleeps desc; exit; 070701000077b9000081ed0000000000000000000000014a94013a00000238000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/pgsqlLOAD.sh#!/bin/sh LANG=C export LANG if [ X$1 = X ] then echo "" echo "Usage:" echo " $0 Timeout" echo "" echo "NOTE: edit $0 file to set connection params, etc." echo "" exit 2 fi #=================================================================== # PostgreSQL LOAD stats directly via WebX.pgSQL #=================================================================== # Set connection params: User=username Passwd=password DB=dbname[@server:port] export User Passwd DB cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX.pgSQL /etc/STATsrv/bin/x.pgsqlLOAD -Timeout $1 070701000077bc000081ed0000000000000000000000014a94014900000233000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/pgsqlSTAT.sh#!/bin/sh LANG=C export LANG if [ X$1 = X ] then echo "" echo "Usage:" echo " $0 Timeout" echo "" echo "NOTE: edit $0 file to set connection params, etc." echo "" exit 2 fi #=================================================================== # PostgreSQL stats directly via WebX.pgSQL #=================================================================== # Set connection params: User=username Passwd=password DB=dbname[@server:port] export User Passwd DB cd /etc/STATsrv/bin exec /etc/STATsrv/bin/WebX.pgSQL /etc/STATsrv/bin/x.pgsqlSTAT -Timeout $1 070701000077bd000081ed000000000000000000000001416d74810000cff4000000200000001d00000000000000000000001c00000000root/etc/STATsrv/bin/psSTATELFD4̄4 (443344t/usr/lib/ld.so.1PB]zQnWR2Ndqg`@,[oa#"e:)s6~C*v^j57wG_yt?xT09/4VlbK{-fpDAiMh}FSUkm!r( '$%;.L3OE&I1X=+JcuH8>ZY|<\0D\ x  4 T DLTɨD2Dtx'(5 GtLhQZhchoנ@!tH4 l!x /  P"\ ("|6Մ=,HNTTZ$`՜glqx H`p8\טdנ@ -l#+<3;B1$N(`fph!x(dxHT.xXɨT 0L60=AH3 O \h4ow|y4x !@3#+ht|x (!|getoptchecklist_startreadscrwidthpsDATA_getvalpsDATA_addfreeIDXatoiatolgetpwuid_environ_endgetpid_iob__register_frame_inforeaddir_GLOBAL_OFFSET_TABLE_timeofdaypsDATA_getfreeIDX__ctypeabortpsDATA_switchatexitexitstrerrormallocsprintfputsiswprintopendirgettext_initpsDATA_addIDXpsDATAtextdomainumask.umulfputs.uremprstattime.remgetuid__register_frame_info_tablegetpwnamfclosesetbufstrncatmktempstrncpycftime_DYNAMICrenametimeNOWstrncmpprintf__iobchownsetlocaletimesubioctlgetgrnamwritereallocstrrchrstrpbrkmbtowcsyscallname__frame_state_for_exittimeSLEEPenvironperrorerrnopsActiveunlinkgetgrgidstrchrfreeoptindtimeNEXTcloseclosediropenoptarg__deregister_frame_infotimeaddstrcmpfgetsgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_fopenmemsetnowstrcpy_etext_lib_versionpsDATA_initfflushget_pnamepsDATA_addfree_ctypenanosleepmainprusage.udiv.divmemcpystrlenpsDATA_addvalstrstrstat_finiseekdirpsDATA_getfreefprintflibw.so.1SUNW_0.7libintl.so.1SUNW_0.7libposix4.so.1SUNW_0.7libc.so.1SUNW_0.7SUNWprivate_1.1libw.so.1libintl.so.1libposix4.so.1libc.so.1 =( =(' =(6? =(I NqRh&x/kpנT23a5ds{uF6g V,>8JDP:\Kh$t#7iM(oXmS9+4D(4@LxXtdRpI|n[?LUP]%E^ 8$B0y<\HhTA`HlYxZN @j0 @D# @gi!x@g@"y, @ h"@@g@g㿐@/gx @   $? 2 @!㿐㿐@/g ` @! 㿐㿀'DD #'DD*@*` @g{'쀢` ia@gu?@gi"! !@ " !@ "'D䀢@d"$ '$'"$D*"@*` @gC'耢` ia@g=?@g1 !@ " !@ " !@ "'D䀢@`"  ' '"  p'!'쀢  $' '' !@ '쀢  $'ܒ '' !@ '耢   'ؒ '' !@ '耢   'Ԓ 'ci@fc@f'쀢` ia@f?@f !@ "'䀢!d"$ '$'"$ 㿈 b@fy'쀢` ia@fs?@fg !@ "'耢!`"  ' '"  㿈 !@ `9 !@ ' !@ d""$㿈 !@ ` !@ ' !@ `"" h'D'HH ]'D" D`" !@ `  !@ " X' !@ '耢 /@ 䀢  a @"  !@ " ." "  %' '"   !@ `#v'D" D`"D " D@D"` D @ !@ " H r' !@ '耢 6D @ &D @ ````" `D@D@"`  ' ''D" D`"D " D@D"`䀢  a @"  !@ " " "  {D @>' !@ '耢 6@e'̀ #̀ ````" `D@D@J"` > ' ''D" `@dD " D@&D"`䀢  a @"  !@ " " "   㿐'DD!쀢`D!`D!` D!`  㿐'D'H'L'P'TLD!@dyD!P!@dsD#T!@dmH  P`H@P`H@P`H@PaH@ T`8H8@T`@H@@T`HHH@T`PHP@T`XHX@T``H`@T`hHh@T`pHp@TTH`"@ " TTH`"@ " TTH`"@ " TTH`Ԓ"@ " TTH`Ē"@ " TTH`Ȓ"@ " TTH`̒"@ " TTH`В"@ " а 㿐'D'HDaH@DaH@DaH@DbH@Dc8H8@Dc@H@@DcHHH@DcPHP@DcXHX@Dc`H`@DchHh@DcpHp@{DDHc@ "#DDHc@ "#DDHc@ "#DDHcԒ@ "#DDHcĒ@ "#DDHcȒ@ "#DDHc̒@ "#DDHcВ@ "#DDH`ؒ@ 2 DDH`@ " DDHa@ 2! 㿐'D'HDH ` DD沔@ " DDD@"DDH@"@ "DDH`"@ " 㿐'D'HDDH@@ "DDH`@ " D`沒 DD1M@ " DDD@"㿀 !@ `-' !@ '쀢  '$'耢  !@  a @"  a @"$ !@ a""! !@ `-' !@ '䀢  ' '  !@  a @"  a @"  !@  a @" !@ " 㿈'D!䀢`a *`" ` a"!D  D!䀢@"' D *"@ '㿈'D'HH &'쀢  * @@ D@  * @@ " @ ' 8''쀢 % * @@ D@ " * @@ `耢 ' ' * @@ D" H'D'H'''''$'"'cl @a@aal@aa@a l@ala@a'pc|@aDHl@a'?c 4T*`M 6 AAAAA@A:AAA;T;6 AAAA9@AAAAAAAAAAA6xA566 5>AA5A5A6A8AA<6?<b""b8""8b@""@b<""< "!b"" H#bD#"4" "$"b(""Lb,"",b0""0la@a$@`bL""L`""xT""t!Ԁ`Z@ X @`'`lb@`@` @`'     *  '  'bt *`:y  `  k@`?'bt@`$ aԒ"!bx *`: [b4""4`""xT""t!؀`4@ bt@  'lb@`t@`^bt@`@ + ؖ@ ""@bx *`: `""xT""t@ bt@  'lbP@`Mt@`"bt@`K'bx *`: `""xT""t@ {bt@s  'lb@`t@_bt@`'bx *`: ` *`: p  u  "!  "!"!`@_  @_'`lb@_bP""Pz`@_' '   *p" `" ,@_'  *@`"  *`p"@FbH""H`""xT""t!`4@ bt@  'lb@_tt@_Ibt@_o@ + Ȗ@ ""@bx *`: bD""D`""xT""t!܀`4@ bt@  'lc(@_+t@_bt@_&@ + P@ ""@bx *`: b "" `""xT""t@ I  +  * `" bt @^bx *`: b$""$`""xT""t@   +  * `" bt @^bx *`: Nb(""(`""xT""t@  +  * `" bt @^bx *`:  '@ 5'  bP""P"P` D@ @8@q @@"L`$",b b0 b( b$ b  bL b4 bD bH x(#@^%lha@](  @^' @^ X?lcp@]@] @]@]'@ ' *`: ?!耢` @W@'@ ' *`: ?lc@]@] @]$ $aԒ"!bL""L@]"a"` 0 ,#bD#"H"4" "b$""("b, b0 ""L'@@'@@'($@[@'@T@'  @]%'!耢`i!`b!' U!耢@lc@]X 䀢 6*`Q FGpGpGGGGpGpGpGpGGl` @]7#` l` @](l`@]  l` @]'lc@] "`lc@]"8`"`lc@\lc@\ "`lc@\m`@\"` "8`m`@\"@`m`@\"<`m` @\"` "8`m`0@\"`m`8@\"`m`@@\"8`m``@\m`p@\ a@\' m`@\W@\, @\(a@\*( @\P'$$ ( /* `"'@\_'  *`: .($  @\(  @\4'?@\*?$ '@\$  m`@[(@\c@[p 6 <@  ''  *`p@  *p @[ ' ' @[y!@[?$ '@[ } m`@[(@[c@[aM#+@[?$ '@[ Q m`@[e(@[c@[5!@[u   a"$"!'  a @"$ !@ "a@[c!Ȁ` !@ ' !@ ' '  @  ' @  '  !`S'* :`  "0` ",`"` "0` 'r"4`a@  '^" `@M  'L"$`@;  ':"(`@J  '("D`Pa@  '"H`a@|  ' "L` ",` @[ "! ' !@ ' !@ "'' !@ ' ;'  @  ' @  'ac  Qa o' ' a @"$ !@ "' !@ ' 2`!@Y !@Y !@Y @` a @"$ !@ `"' ' a @"  !@  a @" !@ " @Yh쀢 gc@Y ` l  "@"   @  l  + " * +  "`"cl @Y-cl"# #@  cl  *" * *"`` @Yb` " `"   @  ` @"la@Y㿀ma@Ya@YbX@Xb@Xb@Xb@Xc @Xc`@X#\#`#d#hcm8@X @X㿈a @X'쀢? L| @ @X =!b|*@*` @X~$"`ma@@X`@Xc@Xp @Xa|**b@p @X @X x'!耢`a"!""|mapm@X'쀢 ma@ma@ma@ma@ !@X o'@XC?'؀ ؐ *؀  *`:y  `  ؒ?' '؀  m @XJ '؀  *`:y  `  ؒ?'ܒ '*m@W  '@@X䀢 ma@x'D D@W @W'ܐ /*@`"m@W @W'쀢 !@W'耢  @Ws`@W `@ @W㿈'D'HH < @  )"|a b :bd""#"`b*@*` @W*  * *"@W$b"`ma@W<@W @W!쀢`6maD@W  maD@V &a*@*` D @W  * *!@ H`$" a"!D@W'쀢 | * *"@ D@V=?'쀤 D *`: / 쀤| * *"@ D@  @V| * *"@  D@  @Vb|*@*` H`$" b|""|mbD@Vm @a"! !耤 0| * *"@ *`*@  @Vb|*@*` **a `" b|""| "!x @V m@V# @V'܀   *`: mb(@V+`@VSc@UmbX@V@Ueܒ%!@V+'؀ mb@V`@V/c@UmbX@U@U@ܒ  @VE| @ |**b@ @U@V/ mb@U`@Uca@UmbX@U@U㿈bx *`:'耢`耢 ,cy ` ` bx""xbT'bx *`:'耢`耢 ,cy ` `*@`"bx""x*bx *`:'耢`耢 ,cy ` ` bx""xp'D''D *`:'쀢`쀢 ,cy ` `D 'D쀢  D'Dm@Uc'DD ID *`:'D* 'D쀢 =<D''D@T' '䀢 Ԑ' @* :`y  ` * *`:y  `  'a'Ā @@T ܒ 'Ā mb@T@TibP""PDe @TV'؀`mc@Tw`@Tc@TH @T9""@  :" 䀢"   '  @* :`  "!`  " !耢` "a"! a""!D㿐'DDH*&|@  * *" DH `" +  *   `?"m@h'D'H!Ā`4 !@ `' !@ ` !@ ` !@ `H` i  H` \H *`: "L` D  H@  'Hp @* :` ?H H!耢` .'HV",`  @* :` ? "L`ND J'耢 Ԁ (" Ԁ @S  'ԤԀ HԀ !ЀH!`܀  w!耢` H@ k"`H  H *: mH@S"8`lc@S"8`H`@SG'؀  mP@@RHmX`@R "`Hm``@RHmh`@R"` "8`Hmh`@R"@`Hmh`@RHmh`@R"<`H Lmp@RHmx`@@R;"` "8`/H E*`: m@R"`!H D*`: m@RH D*`:  H *`: m@R{H Lm@Rs"`HHm` $@RfH ,` Hm`,@R[mc@RU"8` H 0' 4'̒Ȑ   @]mc@R@H 8'H`<sY  '  <@Rp  <@RmmcВ@R""8`H T   @ l'H Tmc@R LH dH` * * :` "ܐ  @R<'  @R7  H Tm@Q H`db # P P@ "'H dmc@Q 㿈'H7* 2`'*"@*`* 2 '耢##'H'H` 'H  @Q  @QmcH@Qh'D'HD  <@Q'D  <@Q'DD  <@Q'D  <@Q'DD  @Q'D  @Q'̒   @Q  n@Q  n@Q :/  n@Q  :/̀   mh@P -/' *`: ܒ 'lcH@Q㿀'D'H'LD d n@QL'䀢  /*D d  /@QW'쀢 D d' 'L  'LHL@PLH *?䀢 *㾸'D'H'LH 'H `< *`^ z,y{z{{p{{|,|||||}}8}}}~~D~h~~(Ph8X|d x((X`hHx@||PD`@P'耢  lc@Pz Dn`@PqGD`@P'耢  lc@P_ Dn`@PV,D` @P'䀢  lc@PD Dn` @P;D`@P'䀢  lc@P) Dn`@P Dn`@PDn`@PDn` @PDn`@O!Ȁ`n` @PLDn`@O!Ȁ`n`P@P8Dn`@ODn`@ODn`@OD D*`: n`@ODn`@@O?'쀢   " *`ȑ2@'D Ȕ @n`@OkD *`: n`@O`D E*`: n`@OUD ؑ*`2  KD ڑ*`2  ADn`$@Ob8D 2` n`@OX.D ĕ2` n`@ON$D D*`:  D *`: n`@O< D Ln`@O2D Ln`@O(D 0' 4'  @3D 0'D`4sY  '!"@ } !@ *`2 n`@ND 8'D`<sY ܒ 'n`@ND 8'D`<sY ܒ 'ܐ  <@O'ܐ  <@O 'ܐ  <@O'ܐ  <@N'n`@N !@ !@ &% @Nn`@Nt !@ !@ &% @Nn`@N^ !@ !@ &% @Nn`@NrH!!@!!@ &% @Nn`@N\2D *`:  n`@NL"!\!@ *`: n`@N>  @n`@N2 А @n`@N& 8 @ < @ &% @NXn`@N @ @ D @ &% @NBn`@M H @ L @ &% @N,n`@M P @ T @ &% @Nn`@M X @ \ @ &% @Nn`@M ` @ d @ &% @Mn`@Mx h @ l @ &% @Mn`@Mb p @ t @ &% @Mn`@MvL  @n`@Mj@  @n`@M^4 Ԑ @n`@MR( Đ @n`@MF Ȑ @n`@M: ̐ @n`@M.lcL@M&Dn` @MD ,` Dn`,@M n`n @M(D x( @L (n n`@LD  @L "@ @L "@Dn`n`@LD T @L D`Tn`' @'H` n`@Lna@LyD d n@L'  /*D* D d' *`: Ԑ Д @L'̀  @L ̐ ' *`: "D d  P@'H` D dn`@LK D dna@LB ?D Tn@L8H `   *㿈'D'H!'쀢 DH>`lc@L'lc@L㿐'D'H'L H *`D L@    x'D'HH''' *@*`D   @L*'쀢 ,*@*`D *`: /*@*`D *`: 9*@*`D   @K @K'쀢 *@*`D `"*@*`D    @Kp@ܒ 'na@KR**D  @K! ' *@*`?D@` * *D@ `  @K; '?'?' '`H"ܰx'D'HH''' *@*`D   @Kz'쀢 ,*@*`D *`: /*@*`D *`: 9*@*`D   @J @KC'쀢 *@*`D `"*@*`D    @J@ܒ 'na0@J**D  @Jn ' *@*`?D@` * *D@ `  @J '?'?' '`H"ܰ㿐'D'H'L L *@*`H @D    㿐'D'H'L L *@*`H @D    㿈'D'H'LDHL@J'L naH@J`@J-cL@Ia@I  㿈'D'H'LDHL@Jp'L nax@I`@JcL@Ia@Ih'H'L' sY ̒ '!̐"@ T L`nn@J0/ Дn@J'/ؖn`HH@I㿈'D!耢` Dm@"` D  D *: mH@I"8`D`@I'耢  mP@@IDmX`@Iw "`Dm``@IjDmh`@Id"` "8`Dmh`@IR"@`Dmh`@IGDmh`@IA"<`na@I8Dn`@@I2$"` "8`D E*`: m@I"` D D*`: m@I"8`mc@I"`na@HD 8'D`<sY  '  <@I,  <@I)nb@Hnb@H㿐'DD` #D @*:`y  ` D 'D *`:` 㿈'D'H'L  D *`: 0 D @H  %@H  H  @L  @D'D   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @G* ?''' `      & && 㿐@/G(   @@*  @    2      2 *@ @ :  @@   㿈@/G@  "  @G+&@ @`@G$ @J z- @GG@@`  @G 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @G ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @G$ ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@F%"@F0"$&b""@F)@Fې0 ' @*!*@ * "`'0 &` @F㿐@/El&`&`&@ &` @&`&`"@㿐@/E$&`&` &` &@@&`&`"@㿐@/Eܮ  ` `"@  @F` 0 `@FXL ؠ =  @FI"7j'?$   ؐ  J zo  '  @E"㿐@/E4 ? ???㿐㿠ݸ㿠ݏ### No more memory...### alloc new psINFO: DATA[curr= %d prev= %d] IDX[curr= %d prev= %d] None...lwp_alarmlwp_sigredirectsignotifywaitinstall_utrapsetregidsetreuiddoorfaclnanosleeptimer_getoverruntimer_gettimetimer_settimetimer_deletetimer_createclock_getresclock_settimeclock_gettimesigqueuep_onlineprocessor_infoprocessor_bindauditsysacltsolsyskaioinst_syncllseekpwritepreadlwp_cond_broadcastlwp_cond_signallwp_cond_waitlwp_mutex_locklwp_mutex_unlocklwp_waitlwp_getprivatelwp_setprivatelwp_selflwp_killlwp_continuelwp_suspendlwp_exitlwp_createsetitimergetitimergettimeofdayvhanguputimesfchrootmodctllwp_sema_postlwp_sema_waityieldlwp_infosigtimedwaitfork1vtraceseteuidsysteminfoadjtimesysconfigsetegidunamerenameputpmsggetpmsgmemcntllchowngetrlimitsetrlimitclocalxmknodfxstatlxstatxstatwritevreadvfchdirvforkfpathconfmunmapmprotectmmapmincorepathconfpriocntlsysasyncacancelhrtsyssigsendsyswaitsysnfssysfstatvfsstatvfsevtrapretevsyscontextsigpendingsigactionsigaltstacksigsuspendsigprocmaskfchownfchmodgetgroupssetgroupsreadlinksymlinklstatpollputmsggetmsgsysfsgetdentsmkdirrmdirnotusedunixPCulimitfcntlchrootumaskexecvefdsyncutssysexch()uadminioctlsemsysshmsysacctsyssunmsgsyssignalgetgidsetgidplockprofiltimespipedupxenixpgrpsysfstatfskillsyncstatfsniceaccessgttysttyutimepausefstatalarmptracestimegetuidsetuidumountmountgetpidlseekstatbrkchownchmodmknodtimechdirexecunlinklinkcreatwaitcloseopenwritereadforkexitsyscallNACTnactNTOTntotREFNAMErefnameNLWPnlwpICTXictxVCTXvctxSIGSsigsI/O_CHRiochrOutputBLKoutblkInputBLKinblkStopTMstoptimeWCpuTMwcputimeEtcTMetctimeULckTMultimeKFltTMkftimeDFltTMdftimeTFltTMtftimeTrapTMtraptimeSYSCsyscNSWAPnswapPSRpsrSYSCALLPNAMEpnameCSysTMcsystimeCUsrTMcusrtimeSysTMsystimeUsrTMusrtimeargscommCOMMANDfnameWCHANwchanADDRaddrTTttyTIMESECtimesecTIMEELAPSEDetimeSTIMECLSclassNIRSSrssVSZvszSZosz%MEMpmem%CPUpcpuCcSsFfpriPRIopriSIDsidPGIDpgidPPIDppidPIDpidRGIDrgidGIDgidRUIDruidUIDuidRGROUPrgroupGROUPgroupRUSERruserUSERuser/proc/tmp/psSTAT.%dSYS_TESTjlfceAOadt:p:g:u:U:G:n:s:o:M:T:I:N:ps: warning: -n option ignored ps: no memory ps: %s is an invalid non-numeric argument for -p option ps: %s is an invalid non-numeric argument for -T option ps: %s is an invalid non-numeric argument for -I option ### no memory...ps: %s is an invalid non-numeric argument for -s option ps: %s is an invalid non-numeric argument for -g option %s/%ldps: no controlling terminal ps: can't find controlling terminal %-*s%s%*s F S UID UID PID PPID PGID SID CLS PRI C PRI NI ADDR SZ WCHAN STIME TTY TIME CMD ps: cannot open PROC directory %s ps: PIOCPSINFO on %s: %s ps: PIOCSTATUS on %s: %s ps: PIOCUSAGE on %s: %s psSTAT %s usage: %s %s %s %s %s %s %s v.4.7ps: malloc() for device table failed, %s /etc/ttysrchr/dev/term/dev/pts/dev/xt/dev.ps: not enough memory for %d devices /dev/systty/dev/syscon/dev/console/tmp/ps.XXXXXXps: mktemp("/tmp/ps.XXXXXX") failed, %s ps: Please notify your System Administrator ps: open("%s") for write failed, %s ps: rename("%s","%s") failed, %s ,=ps: unknown output format: -o %s ps: malloc() for output format failed, %s ?%2lx %c%8.8s %7.7ld %5ld%6ld%5s%4ld%3d%4d %2.2s%9lx%7ld%9lx %-8.14s%2ld:%.2ld %.*s [ %.8s ] %*lu.%lu%2.2ld %*ld## Don't use NTOT options in Normal Mode! ## Don't use NACT options in Normal Mode! %*d%*lx%*c%*.*s%7d%4d:%02d:%02d%3d.%02d%-*.*s--none-%s%-*.*s%05d__________%-.*s[ %.*s ]ps: unknown user %s ps: unknown group %s ps: psread() error on read, rbs=%d, bs=%d, %s ps: pswrite() error on write, wbs=%d, bs=%d, %s %b %d%b_%d%H:%M:%S %4ld %2ld:%.2ld ehTɨ(0`H00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$bly \ xo0o  TH Pxph`XPH@80( xph`XPH@80( xph`XH8( ph`XH80(xph`PH80( xhXH8(phhhhhh`XH8(ph`P@0 xph`XPH@80( xph`XPH@80(  H  PPPxh`PH@80 (  ph`P H8 0(  psSTAT [ -aAdeflcj ] [-o format] [-t termlist] [-T timeout] [-I init_proc_numb] [-O] [-N NamePattern] [ -u userlist ] [ -U userlist ] [ -G grouplist ] [ -p proclist ] [ -g pgrplist ] [ -s sidlist ] 'format' is one or more of: user ruser group rgroup uid ruid gid rgid pid ppid pgid sid pri opri pcpu pmem vsz rss osz nice class time etime stime f s c tty addr wchan fname comm args usrtime systime cusrtime csystime pname syscall psr nswap sysc traptime tftime dftime kftime ultime etctime wcputime stoptime inblk outblk iochr sigs vctx ictx nlwp refname ntot nact|e  e @4 (tL 8H HTX\ - et - e - e( - e - eH - e H - eT - e8( - eas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)ps.c 1.28 95/04/25 SMIGCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstr   o00-< 7H  ADDG\\MxxS[44 `TT| en tDD{LLTTTɨɨTɨˤ070701000077bf000081ed00000000000000000000000149fde633000000a9000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/psSTAT.sh#!/bin/ksh LANG=C export LANG tst=`/etc/STATsrv/bin/tst64 2> /dev/null` if [ "X$tst" = X ]; then exec /etc/STATsrv/bin/psSTAT $*; fi exec /etc/STATsrv/bin/psSTAT64 $* 070701000077c0000081ed000000000000000000000001416aa1ce00012318000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/psSTAT64ELF+2`@@8@@@X#8?x/usr/lib/sparcv9/ld.so.1 !#%&'(+./01356:<=?@ACFHILMNOQSUWXZ[\_`abdgjklnqtwyz{}  "$)*,-24789;>BDEGJKPRTVY]^cefhimoprsuvx|~pf G\2z :P00 8xV=!) ߸/@H<f@n 2`,L$  w $+ 2J jH    N4x h C %04`;BI i& o 6~`   !(`` $: DXps 4\!8  @``(' ?E0a k   x Bx    )0 ( S 0Z  H80 !$ &   CK 9kh H   < I`  94O!& T *v      2 /0 6 L@ Q ? y @  1 h   @  1 8   # 1  ;P C M e  (  `  Ep     9X  ] "X = M0 G ] d ;$ r w0  x    !(    @   @ #  >"` V [P s |           -  M R k x A   :       (8@ K`LSks   U@ ߨ$XB4AbnBpspaBWEJ.usage.usage1$XB4AbnBpspaBWEJ.psDATA_addIDX.__func__$XA4AbnBpspaBWEJ.tty$XB4AbnBpspaBWEJ.usage.usage2psDATA_getfree$XA4AbnBpspaBWEJ.fflgtimeSLEEP$XB4AbnBpspaBWEJ.usage.usage3_etext$XB4AbnBpspaBWEJ.usage.usage4$XA4AbnBpspaBWEJ.grpid$XB4AbnBpspaBWEJ.usage.usage5strncpy_fini$XA4AbnBpspaBWEJ.procdir$XB4AbnBpspaBWEJ.usage.usage6strrchr$XB4AbnBpspaBWEJ.usage.usage7sprintf_startstat$XA4AbnBpspaBWEJ.parg$XA4AbnBpspaBWEJ.cflg$XA4AbnBpspaBWEJ.ntty$XA4AbnBpspaBWEJ.tuid__ctype$XB4AbnBpspaBWEJ.checklist.__func__fcloseoptarg$XA4AbnBpspaBWEJ.maxdev$XB4AbnBpspaBWEJ.gconv.__func___GLOBAL_OFFSET_TABLE_$XA4AbnBpspaBWEJ.getdevcalled$XB4AbnBpspaBWEJ.gdev.__func__$XB4AbnBpspaBWEJ.getdevdir.__func__main$XA4AbnBpspaBWEJ.last_field$XB4AbnBpspaBWEJ.namencnt.__func____environ_locksetbuffflush_edata$XB4AbnBpspaBWEJ.ufind.__func____iobpsDATA_addfree$XB4AbnBpspaBWEJ.gdev.consflggetgrgid$XB4AbnBpspaBWEJ.pr_fields.__func__$XA4AbnBpspaBWEJ.ndevstrncmpprintfenvironchownstrcpy$XB4AbnBpspaBWEJ.prtpct.__func__$XA4AbnBpspaBWEJ.Gflgnanosleep$XA4AbnBpspaBWEJ.p1$XA4AbnBpspaBWEJ.SCALLname$XA4AbnBpspaBWEJ.tflgstrerrorpsDATA_initprstatprusage$XB4AbnBpspaBWEJ.readata.__func__strlenopendir__fsr_init_valuefgetsreaddir_environiswprint$XA4AbnBpspaBWEJ.argbuf$XB4AbnBpspaBWEJ.num.__func__$XB4AbnBpspaBWEJ.gdev.ldevlsetlocale$XB4AbnBpspaBWEJ.getdev.__func___lib_versionrename$XA4AbnBpspaBWEJ.pidpsDATA_getvalgetgrnam$XB4AbnBpspaBWEJ.search.__func__$XB4AbnBpspaBWEJ.prcom.__func__$XA4AbnBpspaBWEJ.ActiveListunlink$XB4AbnBpspaBWEJ.psActive.__func__psDATA$XB4AbnBpspaBWEJ.psDATA_getfree.__func__gettimeofdayreadtimesubfputs$XA4AbnBpspaBWEJ.npid$XB4AbnBpspaBWEJ.getarg.__func__closedir_ctypetimeNOW$XB4AbnBpspaBWEJ.psDATA_getfreeIDX.__func__$XB4AbnBpspaBWEJ.print_time.__func__seekdir$XB4AbnBpspaBWEJ.przom.__func__$XB4AbnBpspaBWEJ.syscallname.maxtimeadd$XA4AbnBpspaBWEJ.gflg$XB4AbnBpspaBWEJ.print_field.__func__memset$XA4AbnBpspaBWEJ.ngrpidpsDATA_switch$XA4AbnBpspaBWEJ.errflgnow$XB4AbnBpspaBWEJ.uconv.__func__$XA4AbnBpspaBWEJ.Mode_iob$XB4AbnBpspaBWEJ.pswrite.__func____1cG__CrunMdo_exit_code6F_v_$XA4AbnBpspaBWEJ.Uflg$XB4AbnBpspaBWEJ.usage.__func__$XB4AbnBpspaBWEJ.main.__func__$XB4AbnBpspaBWEJ.gdev.lndevgetpwuid$XB4AbnBpspaBWEJ.prtime.__func__optind$XA4AbnBpspaBWEJ.sflgputs$XB4AbnBpspaBWEJ.psDATA_addval.__func___exitscrwidth$XB4AbnBpspaBWEJ.psDATA_getval.__func__$XA4AbnBpspaBWEJ.retcodeerrnomktempclose_end$XA4AbnBpspaBWEJ.nsessid$XA4AbnBpspaBWEJ.jflg$XB4AbnBpspaBWEJ.psread.__func__get_pname___Argv$XB4AbnBpspaBWEJ.timesub.__func__$XB4AbnBpspaBWEJ.gettty.__func__$XA4AbnBpspaBWEJ.psfilegetpidstrchrpsDATA_addvalfprintf$XB4AbnBpspaBWEJ.psDATA_init.__func__psDATA_addfreeIDX$XB4AbnBpspaBWEJ.psDATA_switch.__func__$XA4AbnBpspaBWEJ.do_headerchecklist$XA4AbnBpspaBWEJ.uflggetuidpsDATA_addIDXatoitimeofdayatol$XA4AbnBpspaBWEJ.sessid__xargvperror$XA4AbnBpspaBWEJ.AflgtimeNEXT$XA4AbnBpspaBWEJ.lflgumaskwritetextdomain$XB4AbnBpspaBWEJ.get_pname.__func__fopen$XA4AbnBpspaBWEJ.SCALLnone_get_exit_frame_monitorexit$XA4AbnBpspaBWEJ.fieldsgetpwnam$XB4AbnBpspaBWEJ.wrdata.__func__cftimestrpbrk$XA4AbnBpspaBWEJ.fname_PROCEDURE_LINKAGE_TABLE_$XB4AbnBpspaBWEJ.psDATA_addfreeIDX.__func__atexitmalloc$XA4AbnBpspaBWEJ.dflg$XB4AbnBpspaBWEJ.gfind.__func__open$XB4AbnBpspaBWEJ.syscallname.__func__psActive_DYNAMICpsDATA_getfreeIDX$XB4AbnBpspaBWEJ.psDATA_addfree.__func__memcpy$XA4AbnBpspaBWEJ.pflg$XA4AbnBpspaBWEJ.devlioctl$XA4AbnBpspaBWEJ.aflgrealloc$XA4AbnBpspaBWEJ.ActiveONLY__xargcsyscallnamestrstr$XA4AbnBpspaBWEJ.stdbufstrncat$XB4AbnBpspaBWEJ.parse_format.__func__gettext$XB4AbnBpspaBWEJ.timeadd.__func__strcmpmbtowctimegetopt_initlibw.so.1SUNW_0.7libintl.so.1SUNW_0.7librt.so.1SUNW_1.2libc.so.1SUNW_0.7SUNWprivate_1.1libw.so.1libintl.so.1librt.so.1libc.so.1 =( =(  ='! =(+ Nq4`t  0{$ &, @`6ZV L@`( B@}`  3@C`F=e) 9@`E2` @`5OyH k@`/]R[ @` [`+p G@ "b`+p G@ rb`+p ?@ r`P, @`+p '? \( t(+``+p )? -`- H `?- H =--% H H#0@/ʐ`+p 7 @/Ð#`*p ? Z X `*p ? Z `@/@*@ǔ@/@/ 'G H#'G,p ,p$,p$,p$@/wh !8 aP,0 @/?@/!H ,0 t !H ,0 t!_#H`,p @ta 'G$ H_ftfG '_w_&wGG$ O_t&G,p,p@/bw瀢h !8 ah,0 @/^?@/C!H ,0 t!!H ,0 t!_#H`,p @ta  'G$ H_`(t` G '_w_ (wGG$ O_t  H'G '!H ,0 \ wh_\&wG'Gߠ '_o '!H ,0 \!wh_\&wG'G۠ '_o '!H ,0 \!w瀤h_\ wG'Gנ '_瀤o '!H ,0 \!w瀤h_\ wG'GӠ '_瀤o#I`c,p @%8a, GGGGӐ@@@.!S"@@.wh !8 aȡ,0 @.?@.}_#H`,p @ta !H'_ftfG '_w_&wG〤!O_t&Ƞ H'G0!" @._wh !8 a,0 @.[?@.@_#H`,p @ta  !H'_`(t` G '_w_ (wG뀤!O_t  H'G@!H ,0 \!h!H ,0 \!w_\&#H`,p @ta_t&_Hw_@!H ,0 \! h!H ,0 \! w_\ #H`,p @ta _t _Hw_w'G H`w__t`_D _t`!H ,0 \!h _#H`,p @ta Hc'w!H ,0 \!w߀h2_\ _\ hH!_׀h!H ,0 \!_t` _#H`,p @ta H9'__t` __t`  H0'_w_\ w߀o__t`  H"'!H ,0 \!h&hw__t`_D _t` _$`_@_$ __  @@J_#H`,p @ta H'G Htw!H ,0 \!w߀h8_D _\ hH'_D _\ h_\  wD  _$`_\ _@@_\  wD _@ː@_$` H'H _w_\ w߀ow__t`_D _t` _$`_@_$ _׀h!H ,0 \!_t` _#H`,p @ta H'__t` __t`  H'_Ǡ @@Ôw!H ,0 \!w߀h7_ߠ @@,ʒ H'H$GÀ H_\  wD  _$`_\ _@@?_\  wD _@S@_$` HB'H _w_\ w߀ow__t`_ ǐ@@, _$`_@1_$ _׀h!H ,0 \!_t` _#H`,p @ta H'__t` __t`  H' H'G@w_\" h_\"Ȁ h_\"Ѐ h _\"؀ h H' H'G wwwww__!H@@,7__!H#@@,/__$Р!@@,'_h H'_ߢ!x_"@@G_ߢ!_"А@@@_ߢ!_"@@9_ߢ!_"@@2_ע h_%8@@+_ע x_%H@@$_ע _%X@@_ע _%h@@_ע _%x@@_ע _%@@_ע _%@@_ע _%@@_צ!X\_\&($@t_צ!`\_\&0$@t_צ!h\_\&8$@t_צ!\_\&p$@t_צ!\_\&P$@t_צ!\_\&X$@t_צ!\_\&`$@t_צ!\_\&h$@t H'GӰ0ww_"_"@@Ԓ_"_"А@@͒_"_"@@ƒ_"_"@@_%8_%8@@_%H_%H@@_%X_%X@@_%h_%h@@_%x_%x@@_%_%@@_%_%@@_%_%@@_&(\_\&(@t_&0\_\&0@t_&8\_\&8@t_&p\_\&p@t_&P\_\&P@t_&X\_\&X@t_&`\_\&`@t_&h\_\&h@t_!_!@4_ \_\ @t_"R_"R@4 H'G@ww_\ _\ h _ \!沠"@t_\`$ t`_\_\ $@t_ \_\ $@t@ww_\_\ @t_ \_\ @t_\ #沢bh _ \!沠>@t_\` t` !H ,0 \!h*w!H ,0 \!wh _w_\&wo_瀤h #H``,p @\`H t`!H ,0 \!_tf#H``,p @\`t`!H ,0 t !H ,0 \!h*w!H ,0 \! w߀h _w_\ w߀o_׀h #H``,p @\` H t`(!H ,0 \!_t` #H``,p @\`t` !H ,0 t! H'G0'!? ,0 D h H(!? ,0 D h,0!? `p,0 \@h'?`p, #?``h,p @D` $`D`,0\oG H G!? ,0 D hH !@ ,0 \# H wG,0!? `p,0 \@w_Hw_0''GH( H!'G,0!E `С,0 D@GH G,0%E`Х, $@ HE'G  O' H=' ''G H)G,0!E `С,0 D@GH H&'G,0!E `С,0 D@ HG뀤 HG'G  O'GG,0%E`Х, $@ H'G 'w ' ' ' ' ' '?!E c,0  ''!L `,0 @) #F``,p @%8a, @)@@)!F `,0 @) !8 b,0 @@)!8 b,0 @)w#I`c`,p @!F `,0 @@(G_!8 b ,0 @@(?H/'3H#G`,p @D` $`H#G`,p @D` $`H #G`,p @D` $`H#G`,p @D`Ġ $`H #@`,p @$c(H#G`,p @D`Ƞ $`Ƞ #G`,p @$` #G`,p @$` #G`,p @$`ܠ #G`,p @$`ؠ #G`,p @$`Ԡ #G`,p @$`Р #G`,p @$`H#G`,p @D` $`H#G`,p @D` $`H#I`c,p @!8 bH,0 @(o@@( H#G`,p @D`̠ $`!H ,0 \ #G`,p @t`!G a,0 #G`,p @t`!@ ,0 D#, HHr@V @'ɐw7h#I`c,p @!8 bh,0 @('@@'Ò @' H ' _7G,@G  O' '#!G ,0 \ L !I `,0  @ H_7!8 bx,0 @@'#$ '#_7!G ,0 \ #< @@'w`_7_t`#@`,p @Dc, $c,!G ,0 \ L O{H#G`,p @D`ܠ $`!H ,0 \ #G`,p @t`!G a,0 #G`,p @t`!@ ,0 D#0 HHO@!G ,0 \ @!HG' ''#I`c,p @!8 b,0 @'!G ,0 \ @@'#@`,p @Dc0' $c0!G ,0 \ @'wG,0%Ga , $@!G ,0 \ L OHs!H ,0 \ #G`,p @t`!G a,0 #G`,p @t`@R!G ,0 \ @!~HG' ''#I`c,p @!8 b,0 @'!G ,0 \ @@&!G ,0 \ @'!'!G ,0 \ L OH!H ,0 \ #G`,p @t`!G a,0 #G`,p @t`@!G ,0 \ @!(HG' ''#I`c,p @!8 c,0 @&Ɛ!G ,0 \ @@&[!G ,0 \ @&ː'!G ,0 \ L OHH #@`,p @$c4H# #@`,p @$c4H #@`,p @$c4H!H ,0 \ L pO uOOH!H ,0 \ @& @%wh!8 c@,0 @&#G`,p @Da $aHx_!H ,0 \ @@% '_wG H_G,0t@G '_ ,@@&hwhH  _,`_ wG OG HG,0t@H?#G`,p @D` $`!H ,0 \ #G`,p @t`!G a,0 #G`,p @t`!@ ,0 D#8 HHO@ !G ,0 \ @ 7HG' ''#I`c,p @!8 cX,0 @%Ր!G ,0 \ @@%j#@`,p @Dc8' $c8!G ,0 \ @%ɐG,0%Ga, $@!G ,0 \ L OH#G`,p @D` $`!H ,0 \ #G`,p @t`!G a,0 #G`,p @t`!@ ,0 D#< HHO@!G ,0 \ @HG' ''#I`c,p @!8 c,0 @%[!G ,0 \ @@$#@`,p @Dc<' $c':c@, #G`b,p @\`\`!&%"l@@ єH'':cP, #G`b,p @\`\`!&%"l@@ H':c`, #G`b,p @\`\`!&%"l@@ H':cp, #G`b,p @\`\`!&%"l@@ H#:`c,p @G!H ,0 \ P@@ yH#:`c,p @G!H ,0 \ X@@ fH#:`c,p @G!H ,0 \ @@ SH#:`c,p @G!H ,0 \ p@@ @H#:`c,p @G!H ,0 \ x@@ -H#:`c,p @G!H ,0 \ @@ Hp#:`c,p @G_@@ Hb#:`c,p @G_\ @@ HS_\ 8h#:`c,p @G_\ 8@@ H#:`cȣ,p @G!B c,0 @@ ՖH+_ x@@  h !B c,0 Hww#:`cУ,p @G_@@ H_ @֔':cا, @ ]@  @ Y@  -Bcȭ- _D @@@ H_ x@ B h !B cء,0 Hw_ xw_w_ G@@'_\ h#:`c,p @GG_@@ WH#:`c,p @G_@@ IH_ !: c,0 @@ ܒw_h_L / _,` _,`_ wL H_ @@ Д'G HG@ АHH _G@wL O_L H0_  PG@@'_\ h#;``,p @GG_ @@ H#;``,p @G_ @@ ڔH#;``,p @G$ _ x@@ ʔ_D  H _hO_,`H_D  <H, < #3``|,p @ D@PTh@|0$Dd 4PL``t X\p(h0ww!@ ,0 \#Pw瀤h___@̔_\ h !; ` ,0 @ C_\ w瀤o!; `(,0 @ 50w'' G@HG_?`,0D@H H '`G@O H'G ww_D 'Ӡ 'Ϡ GӀH'_Gۥ,p,p @ ΐw߀h#_Gۥ,p,pL  0H_Gۥ,p,pL  9H_Gۥ,p,p @ }: @ rw_߀h_D _Gۥ,p,p$_Gۥ,p,p _\  @@ HDGϠ ')I c-0 !; `0,0 @ <_Gۥ,p,p @@ДG۠ GӀH'׬ _Gנ$< ,p,p ,, @@ OGנ GӀO'GӠ$ 'G۠$ 'G۠ GӀOp'G_$`GH'G ww_D 'Ӡ 'Ϡ GӀH'_Gۥ,p,p @ &w߀h#_Gۥ,p,pL  0H_Gۥ,p,pL  9H_Gۥ,p,p @͐: @ w_߀h_D _Gۥ,p,p$_Gۥ,p,p _\  @@הHDGϠ ')I c-0 !; `H,0 @_Gۥ,p,p @@ G۠ GӀH'׬ _Gנ$< ,p,p ,, @@Gנ GӀO'GӠ$ 'G۠$ 'G۠ GӀOp'G_$`GH'G0'w' G뀧@H_?`,p,pDGH H '`G뀧@O H'G0'w' G뀧@H_?`,p,pDGH H '`G뀧@O H'G0'w'G_@@ 5: '4 뀤H-#I`c,p @!; ``,0 @АG!H ,0 D @=@@^!F `,0 @ H' H'G0'w'G_@@: '4 뀤H*#I`c,p @!; `,0 @G!H ,0 D @@@!F `,0 @Dww''_w_#sYah_ w!@ ,0 \#`_$@#Tah G瀤H !B c,0 H w!B c,0 w_@@ /H%Bc, @@} /#;``ȣ,p @G͐@@n0w!@ ,0 \#Ph_!C `,0 @H4!G ,0 D H';`Ч, _` L`@8!G ,0 D H$_D! @Ӑw瀢h#;``أ,p @_\ @@H #;``,p @_D! @@H!G ,0 D H #;``,p @_D! @@#;``,p @_D @@!G ,0 D H !G ,0 D H #;``,p @_D @@ђ!G ,0 D H#;`a,p @_D @@#;`a,p @_D @@!G ,0 D ĀH!; a,0 @#;`a,p @_D `@@H4!G ,0 D H !G ,0 D H"#;`a ,p @_L e @@v!G ,0 D H #;`a(,p @_L d@@b!G ,0 D H !; a0,0 @Q!G ,0 D H !; a@,0 @@_\ Pw_\ X#sYah_ w); a`-0 _l@w_L OH'GPPpsDATA_initpsDATA_addfreepsDATA_addfreeIDXpsDATA_getfreepsDATA_getfreeIDXpsDATA_addIDXpsActivepsDATA_getvalpsDATA_addvaltimesubtimeaddpsDATA_switchsyscallnamechecklistmainusagereadatagetdevgetdevdirgdevwrdatagetargparse_formatgetttyprcomprtpctprint_timeget_pnameprint_fieldpr_fieldssearchuconvgconvufindgfindpsreadpswriteprtimeprzomnumnamencnt### No more memory...### No more memory...### alloc new psINFO: DATA[curr= %d prev= %d] IDX[curr= %d prev= %d] ### No more memory...### No more memory.../tmp/psSTAT.%dSYS_TESTjlfceAOadt:p:g:u:U:G:n:s:o:M:T:I:N:ps: warning: -n option ignored ps: no memory ttyps: %s is an invalid non-numeric argument for -p option ps: %s is an invalid non-numeric argument for -T option ps: %s is an invalid non-numeric argument for -I option ### no memory...ps: %s is an invalid non-numeric argument for -s option ps: %s is an invalid non-numeric argument for -g option jlfceAOadt:p:g:u:U:G:n:s:o:M:T:I:N:%s/%ldps: no controlling terminal ps: can't find controlling terminal %-*s%-*s%s%*s F S UID UID PID PPID PGID SID CLS PRI C PRI NI ADDR SZ WCHAN STIME TTY TIME CMD ps: cannot open PROC directory %s ps: PIOCPSINFO on %s: %s ps: PIOCSTATUS on %s: %s ps: PIOCUSAGE on %s: %s psSTAT %s usage: %s %s %s %s %s %s %s ps: malloc() for device table failed, %s /etc/ttysrchr/dev/dev.ps: not enough memory for %d devices /dev/systty/dev/syscon/dev/console/tmp/ps.XXXXXXps: mktemp("/tmp/ps.XXXXXX") failed, %s ps: Please notify your System Administrator ps: open("%s") for write failed, %s ps: Please notify your System Administrator ps: rename("%s","%s") failed, %s ps: Please notify your System Administrator ,=ps: unknown output format: -o %s ps: malloc() for output format failed, %s %2lx %c %8.8s %7.7ld %5ld%6ld%6ld%6ld%6ld%5s%4ld%3d%4d%3d %2.2s%9lx%7ld%9lx %-8.14s%2ld:%.2ld %.*s [ %.8s ] %.*s %*lu.%lu%2.2ld%2.2ld%2.2ld%6ld%*s %*s%*ld%*s%*ld%*s%*ld%*s%*ld%*ld%*ld%*ld%*ld## Don't use NTOT options in Normal Mode! %*ld## Don't use NACT options in Normal Mode! %*ld%*ld%*ld%*d%*ld%*lx%*c%*d%*ld%*ld%*ld%*d%*.*s%*.*s%*d%7d%4d:%02d:%02d%3d.%02d%3d.%02d%3d.%02d%3d.%02d%-*.*s%*d%*d%*d%3d.%02d%3d.%02d%3d.%02d%3d.%02d%3d.%02d%3d.%02d%3d.%02d%3d.%02d%*d%*d%*d%*d%*d%*d%-*s%*lx%*lx%*.*s%-*.*s%s%-*.*s%05d%-*.*s%-.*s %-*.*s%-.*s[ %.*s ] ps: unknown user %s ps: unknown group %s ps: psread() error on read, rbs=%d, bs=%d, %s ps: pswrite() error on write, wbs=%d, bs=%d, %s %*.*s%2lx %c%8.8s %7.7ld %5ld%6ld%6ld%6ld%6ld %4ld %3d%4d %2ld:%.2ld userUSERruserRUSERgroupGROUPrgroupRGROUPuidUIDruidRUIDgidGIDrgidRGIDpidPIDppidPPIDpgidPGIDsidSIDopriPRIpriPRIfFsScCpcpu%CPUpmem%MEMoszSZvszVSZrssRSSniceNIclassCLSstimeSTIMEetimeELAPSEDtimeTIMEtimesecTIMESECttyTTaddrADDRwchanWCHANfnameCOMMANDcommCOMMANDargsCOMMANDusrtimeUsrTMsystimeSysTMcusrtimeCUsrTMcsystimeCSysTMpnamePNAMEsyscallSYSCALLpsrPSRnswapNSWAPsyscSYSCtraptimeTrapTMtftimeTFltTMdftimeDFltTMkftimeKFltTMultimeULckTMetctimeEtcTMwcputimeWCpuTMstoptimeStopTMinblkInputBLKoutblkOutputBLKiochrI/O_CHRsigsSIGSvctxVCTXictxICTXnlwpNLWPrefnameREFNAMEntotNTOTnactNACT0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0oDN[f ߨ ߸x p oo+8o,X+ oo`    ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                 (08@HPX`hpx (8HXhx 08HPX`hpx (0@PXhx 0@P`p (08@P`p(08HXhpx psSTAT [ -aAdeflcj ] [-o format] [-t termlist] [-T timeout] [-I init_proc_numb] [-O] [-N NamePattern] [ -u userlist ] [ -U userlist ] [ -G grouplist ] [ -p proclist ] [ -g pgrplist ] [ -s sidlist ] 'format' is one or more of: user ruser group rgroup uid ruid gid rgid pid ppid pgid sid pri opri pcpu pmem vsz rss osz nice class time etime stime f s c tty addr wchan fname comm args usrtime systime cusrtime csystime pname syscall psr nswap sysc traptime tftime dftime kftime ultime etctime wcputime stoptime inblk outblk iochr sigs vctx ictx nlwp refname ntot nact (08@HPX`hpx (0 8@HPX`hpx PPP  (08@ HX`hpx    (08@HPX`hpxv.4.7/dev/term/dev/pts/dev/xt/dev/dev?--none-__________-none-%b %d%b_%d%H:%M:%S?None...syscallexitforkreadwriteopenclosewaitcreatlinkunlinkexecchdirtimemknodchmodchownbrkstatlseekgetpidmountumountsetuidgetuidstimeptracealarmfstatpauseutimesttygttyaccessnicestatfssynckillfstatfspgrpsysxenixduppipetimesprofilplocksetgidgetgidsignalmsgsyssyssunacctshmsyssemsysioctluadminexch()utssysfdsyncexecveumaskchrootfcntlulimitunixPCunixPCunixPCunixPCunixPCunixPCnotusednotusednotusednotusednotusednotusednotusednotusednotusedrmdirmkdirgetdentsnotusednotusedsysfsgetmsgputmsgpolllstatsymlinkreadlinksetgroupsgetgroupsfchmodfchownsigprocmasksigsuspendsigaltstacksigactionsigpendingcontextevsysevtrapretstatvfsfstatvfsnotusednfssyswaitsyssigsendsyshrtsysacancelasyncpriocntlsyspathconfmincoremmapmprotectmunmapfpathconfvforkfchdirreadvwritevxstatlxstatfxstatxmknodclocalsetrlimitgetrlimitlchownmemcntlgetpmsgputpmsgrenameunamesetegidsysconfigadjtimesysteminfonotusedseteuidvtracefork1sigtimedwaitlwp_infoyieldlwp_sema_waitlwp_sema_postnotusednotusednotusedmodctlfchrootutimesvhangupgettimeofdaygetitimersetitimerlwp_createlwp_exitlwp_suspendlwp_continuelwp_killlwp_selflwp_setprivatelwp_getprivatelwp_waitlwp_mutex_unlocklwp_mutex_locklwp_cond_waitlwp_cond_signallwp_cond_broadcastpreadpwritellseekinst_syncnotusedkaiokaiokaiokaiokaiokaiotsolsysaclauditsysprocessor_bindprocessor_infop_onlinesigqueueclock_gettimeclock_settimeclock_getrestimer_createtimer_deletetimer_settimetimer_gettimetimer_getoverrunnanosleepfacldoorsetreuidsetregidinstall_utrapnotusednotusednotusednotusednotusedsignotifywaitlwp_sigredirectlwp_alarm/proc@(#)ps.c 1.28 95/04/25 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)types.h 1.69 03/08/07 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)dirent.h 1.29 99/03/11 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)fault.h 1.13 99/08/15 SMI@(#)syscall.h 1.77 01/07/07 SMI@(#)procfs.h 1.19 00/02/14 SMI@(#)old_procfs.h 1.41 98/02/13 SMI@(#)procfs_isa.h 1.7 98/03/10 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 02/09/05 SMI@(#)wctype.h 1.18 99/08/10 SMI@(#)wctype_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.33 99/08/30 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)libw.h 1.10 96/12/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 Patch 112760-13 2004/08/10ld: Software Generation Utilities - Solaris Link Editors: 5.8-1.286.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.plt.dynamic.data.data1.bss.symtab.strtab.stab.index.stab.comment.shstrtab.stab.indexstr.stabstrXX xx "po+8+8-B++8B++xBB,X,XL2`2`H RߨߨX߸߸^fPP@ot y((H p p X8 070701000077c3000081ed0000000000000000000000014a2fe3590001c240000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/psSTAT64_10ELF+@@8@"!@@X</usr/lib/sparcv9/ld.so.1qq !&'()*+/0125679:<ABCDFGJKLMNPRTVWYZ[]^_`aghijklmp  "#$%,-.348;=>?@EHIOQSUX\bcdefno!@  1| 09C%XOT'0[0e`l t  *( 3h `@ #8'` 6  H!%p $+4  >@G`OW_ h   )h@ `%@` %p  %H `$ /,5=M'C.K 6>@P "@ b@i@p $| 0  !  '`  ,0 0 5@'`-@ d4\!0< "p@K -Y`jr`y 0d__iobunlinkpsDATA_switch_Jv_RegisterClassesgetpwuidstrchrgettimeofdayprstatpsDATA_environfprintfTimeout_GLOBAL_OFFSET_TABLE_fclosefgetspsDATA_getvalgetoptsyscallnamerename_etextstrcpyscrwidthperrorwritepsDATA_addIDXoptindfputscftimeGettext_finigetpwnam__ctypegetpidgetgrgidget_pnameiswprintsprintfstrrchrstrncatgetgrnam__deregister_frame_info_exitncpureaddir_edatapsActivemktempatoi_lib_version_PROCEDURE_LINKAGE_TABLE_errno__dso_handleatolfopensetbufgetzonenamebyidtimeSLEEPsysconfmemsettimesubstrerrorstrncpychownprusagemainpsDATA_getfreeIDXgetuidfflushpsDATA_addfreetimeaddreadpsDATA_addfreeIDXclosedir__register_frame_infooptargstrcmpopendirnanosleepatexitmbtowcpsDATA_inittimeNEXT_start_DYNAMIC_endchecklistreallocumaskmallocstrncmppsDATA_getfreepsDATA_addvalmemcpysetlocalestrpbrkstrlenseekdirtimeNOWstrstrnowlibw.so.1SUNW_0.7librt.so.1SUNW_1.2libc.so.1SUNW_1.22SUNWprivate_1.1/usr/sfw/lib =( ='y Nq)O0 @F'%p7%@3'PTX*)O @_`pQgD ;@G`%h8' 5@0`k?!6 L@e` R,>nj l@I`Sda N@]`^/@i U@$`<&"H9 (@` [#0h@6`*p 7#H @6@0, @  +0 Lถ r@@6@6@#/6(`] `@` ]X@Y" \`t\X@ ?``@]`@6]` ])@@@ /6Ю|  H`]@`]@6]  `(]^`8]@@6@ '`H''8`(p@(p@(p@(p@6w_ @  7`(p @ch@6?@6T I`(p @cp@ I`(p @cp` I`(p @c_q 'ۀH__jq*ۂ`'_jwo_pj8`(p@(p@6Hw_ @  7`(p @ch@6C?@6 I`(p @cp` I`(p @cp`  I`(p @c_q ('ۀH__߂`(q ۂ`'_߂`(wo_p`  ' I`(p @cX@w_@ _Xjwׂ`'o' I`(p @cX`w_@ _Xjwӂ`'o' I`(p @cX`w_@ _X` wς`'o' I`(p @cX` w_@ _X` w˂`'o F`(p @c@a׋8`ӛ8`ϙ8`˟8` 7`(p @c @5R0p@5w_ @  7`(p @ch@5?@5a I`(p @c_q 'ۀaH__jq*ۂ`'_jwo_pj 0"q(p@5ew_ @  7`(p @ch@5`?@5- I`(p @c_q ('〠aH__`(q `'_`(wo_p`  0 I`(p @cX` @# I`(p @cX`w I`(p @c_Xjq _pj_0 I`(p @cX`( @ I`(p @cX`(w I`(p @c_X` q (_p` _w'`Hdw__q __`8`q I`(p @cX` @  I`(p @c_q whew I`(p @cX`w_@2__X@Y@hh"_ @_ I`(p @cX`q`  I`(p @c_q wh9__q __q wh0_w_X` wo__q wh#`H_ @ .w I`(p @cX`w_@7_߂`@4'`Hh!`H$_X`_X```! _X`_@_X`_X`_@ @$`  wh_w_X` wo(w__q _`@4M_ ! __@$ _ @_ I`(p @cX`q`  I`(p @c_q wh__q __q wh?w`H_`8`w`H_a8`w`H_a8`w`H_a8`w`H_a8`w_hqw I`(p @cX`w_@2_X@_hh#_X@_h$_X`_X```! _X`_@%_X`_X`_@I @$`  wh>_w_X` wow__q __q_ ! __@)$ _ @_ I`(p @cX`q`  I`(p @c_q wh __q __q wh w_0w_Xa @_Xa @ _Xb @ _Xb @wh w_0wwwww__!@3e_a_&@3^_h_!@3W_ @wh_`P_a@J_``_b@B_`p_b@:_`_b @2_`h_h@*_`x_i@"_`_i@_`_i(@_`_i8@ _`_iH@_`_iX@_`_ih@___XaXY)!@saX___Xa`Y)!@sa`___XahY)!@sah___XaY*0!@sa___XaY*!@sa___XaY*!@sa___XaY* !@sa___XaY*(!@saw_@ww_a_a@_b_b@_b_b@_b _b @_h_h@_i_i@_i_i@_i(_i(@_i8_i8@_iH_iH@_iX_iX@_ih_ih@z___XiY)@si___XiY)@si___XiY)@si___Xj0Y*0@sj0___XjY*@sj___XjY*@sj___Xj Y* @sj ___Xj(Y*(@sj(___`P P@3`P___X`0Y 0@s`0___a!@#a @ww__X`Y @h__X`e0pq`__X@q___X@Y!@w@___X`Y !@w`@ww___X@Y@w@___X`Y @w`_X`e0ph__X`沂~q`__X@`q  I`(p @cX`@1w I`(p @cX`w_@ _w_Xjwo_ @ I`(p @c I`(p @cX`q`h _ I`(p @cX`qj I`(p @c I`(p @cX@q` I`(p @cp@ I`(p @cX` @1w I`(p @cX`(w_@ _w_X` wo_ @ I`(p @c I`(p @cX` q`(h _ I`(p @cX` q`  I`(p @c I`(p @cX`q`  I`(p @cp` 0' F`(p @b@`H% @`(p @`p F`(p @b@8`(pY@@ F`(p @b F`(p @b@`!@o`H F`(p @b@Hh  @`(p @`hX@wh  @`(p @`p8`(pYw_0''`H+'뀠`H# E`(p @c8`(pH E`(p @c8`(p! whF`'owh>''뀠`H, E`(p @c8`(pH wh& E`(p @c8`(p`H瀠`H'`'o E`(p @c8`(p!@w_߁@w_㳐w'''{''{' E`(p @aw_' I`(p @aX @01 C`(p @a @00$@04 D`(p @a( :`(p @c@0, D`(p @a(@0,  :`(p @c@0+w F`(p @c@` D`(p @a@0"8`_ :`(p @c@0'뀠H'WW`4HW(p `(p @cY@@ D`(p @aP D`(p @aP@`!@o D`(p @ap D`(p @ap@`!@o D`(p @ax D`(p @ax@`!@o D`(p @at D`(p @at@`!@o F`(p @b !o D`(p @aT D`(p @aT@`!@ D`(p @a D`(p @a` D`(p @a\ D`(p @aX D`(p @al D`(p @a| D`(p @a @!@"@""##@oN D`(p @ad D`(p @ad@`!@o= D`(p @ah D`(p @ah@`!@o, ;`(p @`  F`(p @c@a@.o D`(p @a D`(p @a@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@ F`(p @c@`Ho@ @.w_ @ ;`(p @`@o F`(p @c@a@. @.W'GG`H G8`_(@G`'Go ' D`(p @aX@@(p88p8 I`(p @aq @`0```H_ :`(p @aX@.nۂ' D`(p @aۃ8`_Y@.___q__ w_ F`(p @c F`(p @c@`!@ D`(p @aX@@(`8``O\oc D`(p @al D`(p @al@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@ F`(p @c@`Ho$@ D`(p @aX@@'@ @ ߂`' ;`(p @`P F`(p @c@a D`(p @a X@@- E`(p @bp F`(p @c@8`(p D`(p @a #@X@@.$ D`(p @aX@@(`8``Oo D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@@f D`(p @aX@@& @ ߂`' ;`(p @`8 F`(p @c@a D`(p @a X@@-T D`(p @aX@@- F`(p @c @ D`(p @aX@@(`8``Ofo D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@@ D`(p @aX@@&e @ ߂`' ;`(p @` F`(p @c@a D`(p @a X@@, D`(p @aX@@-T' D`(p @aX@@(`8``Oo I`(p @cX@@(`8`'[[`HI[(p `(p @c0Y@@ F`(p @c !o F`(p @c !o F`(p @c !o F`(p @c !o F`(p @c !o F`(p @c !o F`(p @c @o I`(p @cX@@,`@,Uw7_7 @ ;`(p @a@, D`(p @a D`(p @a@`!@ow I`(p @c_7X@@,M'G_7w?G`H G@8`(p@_?q #@_? ,@,w?_? @h ?X@)@ p@oG`ODG8`(ppo< D`(p @a D`(p @a@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@ F`(p @c@`Ho@ D`(p @aX@@%" @ ߂`' ;`(p @a( F`(p @c@a D`(p @a X@@+ E`(p @c` F`(p @c@8`(p D`(p @a #@X@@+$ D`(p @aX@@(`8``Oo D`(p @a| D`(p @a|@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@ F`(p @c @`How@- D`(p @aX@@$ @ ߂`' ;`(p @ah F`(p @c@a D`(p @a X@@+ E`(p @b F`(p @c @8`(p D`(p @a #@X@@+g$ D`(p @aX@@(`8``O o D`(p @aX D`(p @aX@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@@{`H{8`@@(p@` # D`(p @aX@ @+6 D`(p @aX@@(`8``Oo D`(p @a\ D`(p @a\@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@@S`H8`@@(p@` # D`(p @aX@ @* D`(p @aX@@(`8``Oro D`(p @a` D`(p @a`@`!@ D`(p @a I`(p @cX@q@ D`(p @a D`(p @aq@@`H8`@@(p@` # D`(p @aX@ @* D`(p @aX@@(`8``Oo I`(p @cX@w_@ww_z o D`(p @a D`(p @a@`!@o D`(p @a@`H I`(p @c@H߀`Hh@ !@  @@ @ u D`(p @a@`H__q D`(p @ad D`(p @aT@@ D`(p @ah@@ D`(p @a`@@ D`(p @a\@@ D`(p @aX@@ D`(p @a@@ D`(p @al@@ D`(p @a|@@ D`(p @a@@`H@)O C`(p @a ;`(p @a[@ @)eO @)'GG`HG8`!@)@_׀hh ;`(p @a F`(p @c@a@( @(G8`@)'@ w7_7@(`8``?H F`(p @c@`H@ M@ '@w7_7@(`8``?H ;`(p @a F`(p @c@a@( @(x___7q__`w___q F`(p @c F`(p @c@`!@ D`(p @a D`(p @a@`!@@( C`(p @a @ D`(p @aT@`H: D`(p @a` D`(p @a\ D`(p @aX D`(p @al D`(p @a D`(p @a| D`(p @ad D`(p @ah @!@""@""##@ D`(p @aT D`(p @ad@@ D`(p @ah@@`H  D`(p @a @'{@1@'@'@'{@@'@@'瀠`H @'8`8w D`(p @`X@@ D`(p @`@`Hy D`(p @`X@w_@r D`(p @`_X@h  ;`(p @b@(n_wO_O `*HE_O 8` (PwG!(p"_G  @ _G  @h2_`8`_ ;`(p @b[`@(Fh0_X@@_`8`_ ;`(p @b[`@(2h_ ;`(p @bY`@(&h_`8`_ ;`(p @b[`@(_X@wo ;`(p @b @( h D`(p @aP@`H  ;`(p @b(@' D`(p @ap@`H D`(p @aP@`H  ;`(p @b@' ;`(p @b0@'h D`(p @aP@`H  ;`(p @b@@' ;`(p @bH@' D`(p @aP@`H D`(p @ap@`Hh  ;`(p @bP@' D`(p @ax@`H  ;`(p @bX@' D`(p @at@`H  ;`(p @bh@'sh2 D`(p @aP@`H D`(p @ap@`Hh ;`(p @bx@'S D`(p @aP@`H  ;`(p @b@'A D`(p @aP@`H  ;`(p @b@'/ D`(p @ap@`H  ;`(p @b@' ;`(p @b@'_ @. C`(p @aX@@'w_ @  ;`(p @b F`(p @c@a C`(p @a X@@&1 @%O C`(p @aX@@&3O@&'KK@8`@ /)x` #@w7_@&w_A_`(`8``.HoOK8`_ǂ`@&O@&h'O8` ;`(p @b@%O @&|'ÀHoÃ8`_7!@&uh8 I`(p @a@@'Ã8`@&l` Ho`O ;`(p @c{8`@&t F`(p @c@aO@%oÃ8`@&>_@7o_7 <@' 'k'`H8`(pX@o8`(pX@&D@'kh`'ok`H Ã8`@&oIO8` ;`(p @c @%YO @%'ÀHo/É8`_7a&@%@8 I`(p @a@@'kÃ8`@%k` Ho1k`O  ;`(p @c(k8`@% F`(p @c@aO@$oÃ8`@%O8` ;`(p @cH@$O @%'ÀHoÉ8`_7h!@%z@8 I`(p @a@@'kÃ8`@%rk` Hok`O ;`(p @cPk8`@%z F`(p @c@aO@$oÃ8`@%D_7  ~_7 I`(p @cX@qj I`(p @c_7q6w7oi_7 I`(p @cX`qj I`(p @c_7q  F`(p @c@%= F`(p @c@`Hu I`(p @cX`w I`(p @cX` ww_BAw?_w@__wX@Y@h_wX`w?__wX@Y@hh_wX` wwo_X`_? I`(p @c K`(p @b'(`8``Hh%〡H D`(p @ah@`H D`(p @ad@`H  D`(p @aT@`H D`(p @ah@`Hh`'h D`(p @al@`H F`(p @c@8`כ8` E`(p @bp @@`'h D`(p @aX@`H8`{8`@=@`'h D`(p @a\@`H8`8`@!@`'hh D`(p @a`@`H8`8`@*@`'hL D`(p @a|@`H F`(p @c @8`ߛ8` E`(p @b @5@`'h& D`(p @a@`H F`(p @c@8`8` E`(p @c` @@`'〠`H D`(p @a@`H D`(p @ad@`Hh8`ϐ@ b@  C`(p @a @_X` wo I`(p @cX`wo I`(p @cp`w7_ow I`(p @cX` ww_@Bw?_w@__wX@Y@h_wX`w?__wX@Y@hh_wX` wwo__7a_7hY _?_7B F`(p @c@8`_7 @Cw7_X` wo_7 I`(p @cX`qj I`(p @c_7q ww I`(p @cX`w_@B_Y !@"t_X`a I`(p @c&@"g_X`h K`(p @b!@"Zϐ @ _X` I`(p @cX`qj I`(p @c_X`q _ww_X` wo_w@ _w I`(p @cX`(q`  I`(p @c I`(p @cX`q`( I`(p @c_oq _ϒ @"b F`(p @c @`Hh F`(p @c@`@" C`(p @a @"$ F`(p @c0X@ @; F`(p @c0 I`(p @aH I`(p @aX F`(p @c @8`Y@@ss@ F`(p @c0 I`(p @aH I`(p @aXX`(p @(p@(ps`q` I`(p @aX @! L`(p @` I`(p @aXX@q@ L`(p @` I`(p @aXX`(p @(p@(pq` I`(p @aH L`(p @`x I`(p @aH @"N F`(p @c0 F`(p @c0 F`(p @c @8`Y@@s@ I`(p @aH F`(p @c0X@q@ I`(p @aH F`(p @c0X`q` :`(p @c@!o4DEEpEEEDEEEE DEEEEEH:P,P,P,P,P,NP,BP,P,P,D<E9P,P,P,P,AM,P,P,P,P,P,P,P,P,P,P,P,;P,9;T:9IP,P,9XP,8P,;O>P,P,GX;KН  ;`(p @cpR C`(p @aI C`(p @b8@ C`(p @bp7 C`(p @b. C`(p @b% C`(p @c C`(p @ch F`(p @c@assssǐ ;`(p @c@ ) @0 D`(p @a( @ '뀠Hwh8` E`(p @a @ @ 8`@ whl E`(p @a E`(p @a@8`@@(p@t\ @& ;`(p @c I`(p @a@@8`@  F`(p @c@a@ @8` E`(p @a E`(p @a@8`@@(p0`[@@ @ 8`@ Kwh 8`@ C w_߁' F`(p @c@`Hh F`(p @c F`(p @c@`!@ E`(p @a @ ;`(p @c <`(p @`@ \w_ @$ <`(p @`@ <`(p @`@ <`(p @`(@ <`(p @`0@hߐ!_@ 7@ww_@'À`HoÉ8`_ς(@À`H_@(p88p8 I`(p @aq @`0```H Â'_ς`woÀ`O <`(p @_ϒ`0 @ _wÀ`H_@(p88p8 I`(p @aq @`0```H Â'_ǂ`wo_(@ <`(p @_ϒ`0@ @ '_@o_@ۀ`H  <`(p @`0@ wߐ_@߂ߐ@wך[@ /)@`s@_ <`(p @`8@ߐ@Bw_@$_@Bw_@_߂`_ג@߈_@ ߈_@ o_@ ww_`< H  E`(p @a D`(p @a @@ E`(p @a@@Hw E`(p @a E`(p @a@`d!@ E`(p @aw E`(p @aX@ @ E`(p @a@8`@@(p@wh E`(p @a E`(p @a@8`@@(pY@@w__p@ E`(p @aX@  <`(p @`@ F`(p @c@a E`(p @a@8` @ @ D`(p @a$@`H[ <`(p @`h_@@ <`(p @`x_@ @C D`(p @a @8`@@(p D`(p @`@_` @ D`(p @` D`(p @a @8`@@(p@_X` q  D`(p @a  D`(p @a @`!@h/_@'뀠`H E`(p @a@8`@@(p E`(p @aX@@_`@Ih[''〡HG_@(`8``/H`'o〡H! E`(p @a@8`@@(p E`(p @aX@@8`_ @h E`(p @a@8`@@(p E`(p @aX@@G_` @n E`(p @a@8`@@(p E`(p @aX@@_X` q  E`(p @a E`(p @a@`!@ <`(p @`_@ @ D`(p @a$ D`(p @a$@`!@' D`(p @a @〡H] E`(p @a@8`@@(p E`(p @aX@@G@@(p D`(p @`@  @ E`(p @a@8`@@(p E`(p @aX@@ D`(p @`G@@(p@X`s` E`(p @a E`(p @a@`!@`'o D`(p @a @  @aߐ <`(p @`@/ߐ@[w_@ _@(`8``H9 <`(p @` I`(p @a@@8`@ F`(p @c@a@ <`(p @` F`(p @c@a@h_ג%!@s'Ӏ`H: <`(p @a I`(p @a@@8`@ F`(p @c@a_ז@ <`(p @`t F`(p @c@a@hz_ג  @Ӄ8` E`(p @a @Ӌ8` E`(p @a E`(p @a@8`@@(p0`[@@Ӄ8`@_ D`(p @a(@@> <`(p @a0" I`(p @a@@8`@ F`(p @c@a_ D`(p @a(@1 <`(p @` F`(p @c@a@0 D`(p @aX@@(`8`'〠`H(〠`,H8` I`(p @aq @`0```Hh D`(p @a D`(p @aX@`q@o D`(p @aw D`(p @aX@@(`8`'〠`H.〠`,H*8` I`(p @aq @`0```H_@(@ w@ D`(p @a D`(p @aX@`q@o_(@ D`(p @aX@@(`8`'〠`H(〠`,H8` I`(p @aq @`0```Hh D`(p @a D`(p @aX@`q@oww'_@(`8`'뀠`H뀠`,H8` I`(p @aq @`0```Hh_`wo뀠`HwhS_w <`(p @_aX@w_@O_@(`8`'_)`w뀠`=HA_ww_@'Ӊ8`_ׂw__׀h_w@(p88p8 I`(p @aq @`0```H_(@o_@(p88p8 I`(p @aq @`0```H_ׂ`wo A`(p @c w A`(p @c fx_ǀ@h__X@@ @h_ǂ`wo A`(p @c fx_ǀ@ h* <`(p @ah{ F`(p @c@a_@ D`(p @a D`(p @a@`!@_wh @ww_ @& <`(p @aK I`(p @a@@8`@> F`(p @c@a@a @&_p@__ A`(p @c !@8p*b(p *bI@#`_w_w_ @_X`w__p`Ӏ`H_`'_X`@(`8``H  D`(p @` !_w_`'H'_!  D`(p @`X@ @ D`(p @` D`(p @`_qq@h D`(p @`X@_q D`(p @`_q_w_ ww_X`HhE_`H@_@' E`(p @a@〡H2G@@(p E`(p @aX@@_X`Y H@h _!Gw_ׂ@_ׂ@(p E`(p @aX@@w_wh 'o?_! <`(p @aw_w' F`(p @b@`H^ I`(p @cX`P @N I`(p @cX`X @E I`(p @cX`` @< I`(p @cX`h @3 I`(p @cX`p @* I`(p @cX`x @! I`(p @cX` @ I`(p @cX` @_`8`  @ wh_`8` _a `H D`(p @a@`H `Hwh_@ wh'_w_ (`8``?H_X`Hh F`(p @c@`H ]'_w D`(p @ad@`H _ (`8``?Hwh D`(p @a@`HY`HU'〠`H1ˀ`H- E`(p @aw_X@w_@ˀ`H__@ @ '_ woˀ`O_woˀ`H C`(p @a@H_ C`(p @a`@HhwhO D`(p @`X@@ __@ ( wh> D`(p @aP@`H'_@`8`_a:(`8`8` <`(p @aȒ @ D`(p @ap@`H  ;`(p @b@ D`(p @ap@`H'_`8`@{w_@_ <`(p @aY@@h&_`8` <`(p @aؒ@h D`(p @aP@`H_`8` <`(p @a@_`8` <`(p @a@ D`(p @aP@`H D`(p @ap@`Hh_` 8` <`(p @a@p D`(p @ax@`H_`8` <`(p @a@Z_`8` <`(p @a@N D`(p @at@`H_ah <`(p @a@9_a@8` <`(p @a@-ha D`(p @aP@`H D`(p @ap@`HhK_a?(`8``8` <`(p @b@ D`(p @aP@`H2_a>(`8`8` <`(p @b@_a>(`8``H_a;(`8`8` <`(p @b@h _ah <`(p @b@ D`(p @aP@`H&__ <`(p @bY`([`0@_Xa0@_ <`(p @b(Ya0@h  <`(p @b0@ D`(p @ap@`H _X`XX``  @ U <`(p @b@_@_X`hw_X`pe0ph_`w_h`<_i`<(p @(p!@ <`(p @bP @b D`(p @ap@`H_`  @ 'ߋ8`_` <`(p @b` @A whi_`w_`_@h5_ (`8``Hh,א_ @'ۀ`H ׃8`@ @_` <`(p @bh@  wh4ۃ8`_wo_`w D`(p @aP@`H #'h P'G_ P@'ߋ8`_` <`(p @b` @ w_07'(p00p0w_(p @(p@(p0pw_瀠ch#w'`H '8`_h` _i` (p@@!@ <`(p @bx  @w'_i`<(p @(p!@w_h`(`8`8` <`(p @c @hc8`_a@8` <`(p @b @hR?0p w뀠`H  !(`_0Pw8`_@8`_  <`(p @c @h18`_a:(`8`8` <`(p @c @h8`_a?(`8`8` <`(p @c @h _`P(p00p08`h_`R(p00p08`h8`_ <`(p @b[`0@ah8`_ <`(p @b[`0@Rh8`_ <`(p @b[`8@Ch_a>(`8``H8`_a;(`8`8` <`(p @c @)h8`8`_ah <`(p @c  @h8`8`_ah <`(p @c  @h_8`Y XY ` @hy_X`Xw_X``e0ph_ς`w F`(p @cX@_ψ!8`Bh[8` I`(p @c`8` <`(p @c @hE_X`hw_X`pe0ph_ǂ`w <`(p @c _@h-_X`hw_X`pe0ph_ǂ`w_lji`<(p @(p!@'_ǃh`(`8`8` <`(p @b@ D`(p @ap@`H  <`(p @b0@ D`(p @aP@`H  =`(p @`x@_X`hw_X`pe0ph_`w_h`<_i`<(p @(p!@ =`(p @` @n =`(p @`@f0w_ @wh'_@(`8`'G I`(p @aq @`0```Hwh_`w@(`8`'〠`Ho w_ w''''_@(`8``H:_ @'Ӏ`H wh-8`@' @ wh ӈ@Hψ@Hӈ'ς@'G_woGw_߁@/`0]Y?`?@?\o@PBP### No more memory...### alloc new psINFO: DATA[curr= %d prev= %d] IDX[curr= %d prev= %d] None...syscallexitforkreadwriteopenclosewaitcreatlinkunlinkexecchdirtimemknodchmodchownbrkstatlseekgetpidmountumountsetuidgetuidstimeptracealarmfstatpauseutimesttygttyaccessnicestatfssynckillfstatfspgrpsysxenixduppipetimesprofilplocksetgidgetgidsignalmsgsyssyssunacctshmsyssemsysioctluadminexch()utssysfdsyncexecveumaskchrootfcntlulimitunixPCnotusedrmdirmkdirgetdentssysfsgetmsgputmsgpolllstatsymlinkreadlinksetgroupsgetgroupsfchmodfchownsigprocmasksigsuspendsigaltstacksigactionsigpendingcontextevsysevtrapretstatvfsfstatvfsnfssyswaitsyssigsendsyshrtsysacancelasyncpriocntlsyspathconfmincoremmapmprotectmunmapfpathconfvforkfchdirreadvwritevxstatlxstatfxstatxmknodclocalsetrlimitgetrlimitlchownmemcntlgetpmsgputpmsgrenameunamesetegidsysconfigadjtimesysteminfoseteuidvtracefork1sigtimedwaitlwp_infoyieldlwp_sema_waitlwp_sema_postmodctlfchrootutimesvhangupgettimeofdaygetitimersetitimerlwp_createlwp_exitlwp_suspendlwp_continuelwp_killlwp_selflwp_setprivatelwp_getprivatelwp_waitlwp_mutex_unlocklwp_mutex_locklwp_cond_waitlwp_cond_signallwp_cond_broadcastpreadpwritellseekinst_synckaiotsolsysaclauditsysprocessor_bindprocessor_infop_onlinesigqueueclock_gettimeclock_settimeclock_getrestimer_createtimer_deletetimer_settimetimer_gettimetimer_getoverrunnanosleepfacldoorsetreuidsetregidinstall_utrapsignotifywaitlwp_sigredirectlwp_alarmuserUSERruserRUSERgroupGROUPrgroupRGROUPuidUIDruidRUIDgidGIDrgidRGIDpidPIDppidPPIDpgidPGIDsidSIDopriPRIprifFsScCpcpu%CPUrpcpuR%CPUcpcpuC%CPUspcpuS%CPUpmem%MEMoszSZvszVSZrssRSSNIclassCLSSTIMEetimeELAPSEDTIMEtimesecTIMESECttyTTaddrADDRwchanWCHANfnameCOMMANDcommargsusrtimeUsrTMsystimeSysTMcusrtimeCUsrTMcsystimeCSysTMpnamePNAMESYSCALLpsrPSRnswapNSWAPsyscSYSCtraptimeTrapTMtftimeTFltTMdftimeDFltTMkftimeKFltTMultimeULckTMetctimeEtcTMwcputimeWCpuTMstoptimeStopTMinblkInputBLKoutblkOutputBLKiochrI/O_CHRsigsSIGSvctxVCTXictxICTXnlwpNLWPrefnameREFNAMEntotNTOTnactNACTproj#PROJtask#TASKzoneid#ZONEzoneZONEpool#POOL/proc/tmp/psSTAT.%djlfceAOadt:p:g:u:U:G:n:s:o:M:T:I:N:ps: warning: -n option ignored ps: no memory ps: %s is an invalid non-numeric argument for -p option ps: %s is an invalid non-numeric argument for -T option ps: %s is an invalid non-numeric argument for -I option ### no memory...ps: %s is an invalid non-numeric argument for -s option ps: %s is an invalid non-numeric argument for -g option %s/%ld/psinfops: no controlling terminal ps: can't find controlling terminal %-*s%s%*s F S UID UID PID PPID PGID SID CLS PRI C PRI NI ADDR SZ WCHAN STIME TTY TIME CMD ps: cannot open PROC directory %s /psinfops: PIOCPSINFO on %s: %s /statusps: PIOCSTATUS on %s: %s /usageps: PIOCUSAGE on %s: %s psSTAT %s usage: %s %s %s %s %s %s %s (dim) v.5.0 Apr/2007 - for Solaris10+ps: malloc() for device table failed, %s /etc/ttysrchr/dev/term/dev/pts/dev/xt/dev.ps: not enough memory for %d devices /dev/systty/dev/syscon/dev/console/tmp/ps.XXXXXXps: mktemp("/tmp/ps.XXXXXX") failed, %s ps: Please notify your System Administrator ps: open("%s") for write failed, %s ps: rename("%s","%s") failed, %s ,=ps: unknown output format: -o %s ps: malloc() for output format failed, %s ?%2lx %c%8.8s %7.7ld %5ld%6ld%5s%4ld%3d%4d %2.2s%9lx%7ld%9lx %-8.14s%2ld:%.2ld %.*s [ %.8s ] %*lu.%lu%2.2ld %*ld## Don't use NTOT options in Normal Mode! ## Don't use NACT options in Normal Mode! %*d%*lx%*c%*.*s%7d%4d:%02d:%02d%5.2f%3d.%02d%-*.*s--none-%s%-*.*s%05d__________%-.*s[ %.*s ]Nnk(Bps: unknown user %s ps: unknown group %s ps: psread() error on read, rbs=%d, bs=%d, %s ps: pswrite() error on write, wbs=%d, bs=%d, %s %b %d%b_%d%H:%M:%S %4ld %2ld:%.2ld p0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o , Hx  ooo oo (08@HPX`hpx (08@HPX`hpx (0@P`hp (0@PX`px (8@PX`hx 0@P`p (0@P`p (8HXhx (08@HPXP`hpx (08 8@ HPX`hpx PPP  (08 @PX`hpx    (08@HPX`hpxpsSTAT v.5.2 (dim) Usage: psSTAT [ -aAdeflcj ] [-o format] [-t termlist] [-T timeout] [-I init_proc_numb] [-O] [-N NamePattern] [ -u userlist ] [ -U userlist ] [ -G grouplist ] [ -p proclist ] [ -g pgrplist ] [ -s sidlist ] [ -M p|u|j|t|z|l ] 'format' is one or more of: user ruser group rgroup uid ruid gid rgid pid ppid pgid sid pri opri pcpu rpcpu cpcpu spcpu pmem vsz rss osz nice class time etime stime f s c tty addr wchan fname comm args proj task zone pool usrtime systime cusrtime csystime pname syscall psr nswap sysc traptime tftime dftime kftime ultime etctime wcputime stoptime inblk outblk iochr sigs vctx ictx nlwp refname ntot nactXxH  , H ` Xhx !\0b  )X4 `CS n 8N ,zXhxi 0   d Ppx  Ո#(-h6 > L DKpP  VN_j ʨt\y   h    44lm u` = (#x X `   $)pC2h7 ݜ0@82IhS [ yPbg p Ҡv`x{p v\ x |4t0((` x dT ~( L$|C   .pz`;GUk!@ pw 1| %X'00`   *( 3h!( /6?`@F #8T'\a`h 6p Hv!%p   @`    )h @ `9%@?`L R%p W^n%Hx ` /'. 6> "j@ @[@ $| 0  !   '"`,3 @ ,F0O V_0d 5n@v`|@: d!0 "pQ@ -c` 0psSTAT64_10crti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__psSTAT.clast_fielduconvnumActiveListaflglflgnpidngrpidprtimeModepargusage7.7procdirprcomstdbuffflgufindusage6.6ActiveONLYpr_fieldsUflgparse_formatprint_timedo_headergetdevcalledpswriteprzomnttypsreadpflgp1nsessidprusagegetuidusage5.5print_fieldjflgprtpctuflgusage4.4getttygetarggconvdevlusage3.3dflgnamencntusage2.2SCALLnoneretcodegetdevndevusage1.1gfindtflgSCALLnamereadatafnamegetdevdircflgldevl.8psfilemax.0Gflgargbuflndev.9sflgsearchAflggdevwrdataconsflg.10maxdevgflgerrflg__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START___iobunlinkpsDATA_switch_Jv_RegisterClassesgetpwuidstrchrgettimeofdayprstatpsDATA_environfprintfTimeout_GLOBAL_OFFSET_TABLE_fclosefgetspsDATA_getvalgetoptsyscallnamerename_etextstrcpyscrwidthperrorpsDATA_addIDXoptindfputscftimeGettext_finigetpwnam__ctypegetpidgetgrgidget_pnameiswprintsprintfstrrchrstrncatgetgrnam__deregister_frame_info_exitncpureaddir_edatapsActivemktempatoi_lib_version_PROCEDURE_LINKAGE_TABLE_errno__dso_handleatolfopensetbufgetzonenamebyidtimeSLEEPsysconfmemsettimesubstrerrorstrncpychownmainpsDATA_getfreeIDXfflushpsDATA_addfreetimeaddpsDATA_addfreeIDXclosedir__register_frame_infooptargstrcmpopendirnanosleepatexitmbtowcpsDATA_inittimeNEXT_start_DYNAMIC_endchecklistreallocumaskmallocstrncmppsDATA_getfreepsDATA_addvalmemcpysetlocalestrpbrkstrlenseekdirtimeNOWstrstrnow@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic 123647-02 Feb 2008as: Sun Compiler Common 10 Patch 09/04/2007 @(#)ps.c 1.28 95/04/25 SMIGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)@(#)SunOS 5.10 Generic 123647-02 Feb 2008@(#)SunOS 5.10 Generic 123647-02 Feb 2008ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.489% : ; I : ;  : ; I8 I!I/ $ > $ >  I  : ;I  : ; : ; I : ;  : ; : ;I8  : ; : ;I : ;  : ; ' I : ;  : ; I8 &I : ;  : ;I8  : ;.? : ; ' I@ : ; I !4: ; I ".? : ; I@ # $4: ; I %: ; I & '.? : ; I< (.? : ; I< ).? : ;' I@ *: ;I +.? : ;' I@ ,: ;I -.? : ;I< ..? : ;I@ /4: ;I 04: ;I 1 : ;24: ;I? < 3 : ;4.: ;' @ 5.: ;' I@ 6.? : ;I< 74: ; I? < 8!94: ; I?  :!I/;4: ;I?  =GNU C 3.4.3 (csl-sol210-3_4-branch+sol_rpath)psSTAT.c/SOFT/psSTAT_10__FILEv__FILE__pad#long intFILEJhsize_tPoff_tunsigned charcharshort intint32_t=intuint8_tHshort unsigned intuint32_tJXunsigned intuint64_tLuintptr_tflong long intlong long unsigned intushort_t ]2uint_t ^Xulong_t _caddr_t a  ino_t blkcnt_t blksize_t long double id_t * suseconds_t 9 mode_t k uid_t s gid_t ye taskid_t {5 projid_t |5 poolid_t }5 zoneid_t ~5 ctid_t 5 dev_t  nlink_t  pid_t  time_t  clock_t  u_short f2 u_long hstimespec &tv_sec '#tv_nsec (#timestruc_t >>timeval 1tv_sec 2#tv_usec 3B# sigval g sival_int h sival_ptr i .__sigbits- #Xsigset_t.passwd@pw_name#pw_passwd #pw_uid!e#pw_gid"s#pw_age##pw_comment$# pw_gecos%#(pw_dir&#0pw_shell'#85group gr_name#gr_passwd #gr_gid!s#gr_mem"5# Istatst_dev#st_ino#st_modeV#st_nlink#st_uide#st_gids#st_rdev# st_size#(st_atims#0st_mtims#@st_ctims#Pst_blksize#`st_blocks#hst_fstypeI#pYwchar_tadirentd_ino#d_off#d_reclen2#d_name#)dd_fd%#dd_loc&#dd_size'#dd_buf(#DIR)O__uide#__value#__utime#__status#__stime# __kill$__cldO (__pid#__pdata#__ctid# __zoneid#$J __addr#__trapno #__pc #v__fd#__band# __faddr#__tstamps#__syscall#__nsysarg#__fault#__sysarg # __mstate #`  ,  J#__entity" # $ __pad __proc__fault  __fileJ__profv__rctl# , ; *siginfosi_signo#si_code#si_errno#si_pad# __data$ J# siginfo_t&  gW _handlerP n _sigactionU  n  g    *  t sigaction Jsa_flagsK#_funcptrW <#sa_maskX# +sigaltstackss_sp#ss_size#ss_flags#stack_t  R/word. #fltset_t/ : |@word |# X sysset_t bprocessorid_t'psetid_t fpqfpq_addr #fpq_instrX# X  whole  fpq double AfqFQu # QH a  q&prgreg_t5prgregset_t9  q%  pr_regs A pr_dregs Q pr_qregs a prfpregset pr_fr #h#pr_fsrh#pr_qcnt##pr_q_entrysize##pr_en## #pr_q #   'prfpregset_t  lwpstatusp"e"f#"g5#pr_why"h#pr_what"i# pr_cursig"j# pr_pad1"k#pr_info"l *#pr_lwppend"m#pr_lwphold"n#pr_action"o #pr_altstack"p +#pr_oldcontext"qx#8"r#pr_nsysarg"s#pr_errno"t#pr_sysarg"u #pr_rval1"v#pr_rval2"w#"x#"ys#|"zs#"{s#"|#pr_errpriv"}#pr_ustack"~x#pr_instr"#pr_reg" #pr_fpreg" #lwpstatus_t" :pstatus""#pr_nlwp"#pr_pid"#pr_ppid"# pr_pgid"#pr_sid"#pr_aslwpid"5#pr_agentid"5#pr_sigpend"# pr_brkbase"x#0pr_brksize"#8pr_stkbase"x#@pr_stksize"#H|"s#P"s#`pr_cutime"s#ppr_cstime"s#pr_sigtrace"#pr_flttrace" R#pr_sysentry" #pr_sysexit" #."#":# "#$"#"#f"#"J#pr_lwp"#JZpstatus_t"lwpsinfo"pr_flag"#"5#pr_addr"x#pr_wchan"x#pr_stype"#pr_state"#pr_sname"#pr_nice"#8"#pr_oldpri"#pr_cpu"#pr_pri"# "#$"#&T"s#(pr_time"s#8"#Hpr_name"I#Ppr_onpro" #`pr_bindpro" #dpr_bindpset" #h"#l lwpsinfo_t"k"pr_flag"#pr_nlwp"#pr_pid"#pr_ppid"# pr_pgid"#pr_sid"#pr_uid"e#pr_euid"e#pr_gid"s# pr_egid"s#$pr_addr"x#(pr_size"#0pr_rssize"#8pr_pad1" #@pr_ttydev" #H"#Ppr_pctmem"#RT"s#Xpr_time"s#hpr_ctime"s#xpr_fname"I#pr_psargs"#pr_wstat"#pr_argc"#pr_argv"x#pr_envp"x#."#pr_pad2":# "#$"#"#pr_poolid"#f"#pr_contract" 5#"!#pr_lwp"" #O psinfo_t"#?vprusage""5#pr_count"#"s#pr_create"s#pr_term"s#(pr_rtime"s#8|"s#H"s#Xpr_ttime"s#hpr_tftime"s#xpr_dftime"s#pr_kftime"s#pr_ltime"s#pr_slptime"s#pr_wtime"s#pr_stoptime"s#filltime"v#pr_minf"#pr_majf"#pr_nswap"#pr_inblk"#pr_oublk"#pr_msnd"#pr_mrcv"#pr_sigs"#pr_vctx"#pr_ictx"#pr_sysc"#pr_ioch"#filler"#s prusage_t"psINFO ))#stat)Z#usage)#next)# psINFO_t)VpsIDX()pid) #)!I#)"V#next)#\#  psIDX_t)%psDATA0)(curr))V#prev)*V#free)+V#)-#).# ])/#( bpsDATA_t)1q[psDATA_init)<$n init_proc);!free)=V!idx)>!n)?"psDATA_addfree)Z$!n!free)[V!idx)\!n)]#( !dc)a!dp)a!ic)a!ip)a"LpsDATA_addfreeIDX)y!"pn!idx)z!n){"psDATA_getfree)V"p"n!free)V"psDATA_getfreeIDX)"#n$])9psDATA_addIDX)#)n%)V mode)!idx)!curr)!prev)$)I!n)!id)&%@'8'C)')#%&@')()#')')#(X('')())n)=)*(n*)<V+psDATA_getval)H*(-n,curr)GV,prev)GV*)G,stat)G ,usage)G-timesub)O  Z )s)k-/n,curr)jV,next)jV-timeadd)l+timesub)/0n,res),sub) s+ timeadd)01n,res),add). psDATA_switch)13n/next)V/prev)V/next_idx)0) syscallname*35n no*!ret*!max* ! udata +Iuid+Je#name+K#!6gdata +Ogid+Ps#name+Q#!~field +next+!~#v+#M+ #p+# !6!def_field+v+ #M+ #p+#minwidth+#1"devl+dname+"#dev+#" +"checklist+Q56n,pid+P,keep+P/i+R/empty+R+"Gettext+k66n,msg+k+'main+o6u`n,argc+n,argv+n5/InitProc+p/Names+q' /euid_tbl+s' /neut+t /ruid_tbl+v'/nrut+w/egid_tbl+y'"/negt+z/rgid_tbl+|'"/nrgt+}/ttyp+5x/p+/c+/i+/found+2optarg+2optind+/pgerrflg+/size+X/dirp+'2/dentp+'80+'>/pdlen+3retry+D_&$/i+&%EGP/i+)/chp+*?/nms+*7&%YRU0+}/procfd+/name+7#Ws/n+/curr+V7/prev+V?/tmp_info+V}0+|0+|/save_idx+|0+y&&X8ZD/f+!~y#_le/procfd+2y/pplen+3y&&r`da<0+Ay&&a\b00+Px/i+Qy/skip+Qx&&bc0+lx#dLe$0+x''" '2!   h'Nc4(usage+ u`vn/usage1+ (  /usage2+(/ 8/usage3+(? p/usage4+(O /usage5+(_ /usage6+(o /usage7+( h(/(?1(OB(_(o<(M(5(readata+,vyPn/fd+-4)^getdev+MyP|n/fp+N)^/buf+O)d /dev_seen+P #z|/dir+^ /cp+_ /len+` )t4* getdevdir+}|~(n,dir+|/dirp+~'2/dentp+'8/statb+;/pathname+*  /filename+ *4*gdev+~(n,objptr+,statp+*/i+/leng+/start+/ldevl+* /lndev+  /consflg+ $ ;*!4+Iwrdata+ n/tmpname+I/tfname+/fd+4+getarg+ n/parga+/c+5,Eparse_format+1n,arg+0/c+2/name+30M+40p+5/df+6,E/f+7!~#/s+C !5,gettty+xLn*+w,ip+w,/i+y 5-prcom+Ln,found+*+/cp+/tp+/tm+/i+/wcnt+/length+/wchar+Y/ttyp+5/str+/pwd+-#/match+ )4.prtpct+*n,pct+)*p+)/value++/4/rprint_time+7n,tim+6*p+6.+Cday+;/r#hyphen+<#hour+=/#hcolon+># min+?/# mincolon+@# sec+A/# nullbyte+B#/+Dbuf+9Itm+C.T/un+D./cp+E/seconds+F/minutes+G/hours+H/days+I//)0C+f(n*+e*+e,size+e/argv0+g/c+g/csave+g424print_field+z(ʨn*+y,f+y!~,tp+y0p+|/pwd+}-/grp+~24/then+/cputime+/wcnt+/wchar+Y/cp+/length+/mask+//c+/csave+/buff+'>#t61{getzonenamebyid+&1/sec+/min+/hrs+&1d0+*  &2l/name+I #$0/argv0+ 42pr_fields+ʨdn*+,tp+/f+!~52search+dn,arr+2,number+,arg+/i+ 53uconv+n,utbl+3,pn+,/pwd+-/i+ /j+ /n+ /rval+   54#gconv+1 n,gtbl+04#,pn+0,/grp+224/i+3/j+3/n+4/rval+5 ! 54ufind+^ Ҡn,puid+]e,utbl+]3,n+]/i+_54gfind+lҠ4n,pgid+ks,gtbl+k4#,n+k/i+m55Upsread+z4hn,fd+y,bp+y,bs+yX/rbs+{45pswrite+hՈn,fd+,bp+,bs+X/wbs+460prtime+Ո n,st+s*p+,old+/sttim+60/starttime+6@46przom+ n*+/tm+/pwd+-56num+ݜn,s+/c+57namencnt+ݜn,cmd+,eucsize+,scrsize+/eucwcnt+/scrwcnt+/neucsz+/nscrsz+/wchar+Y#ް-scrwidth+7h7__iob7787__ctype%77errno,(9psDATA)4 '9prstat)5Z '9prusage)6 .8_'!psfile)88O (!SCALLnone* h8!SCALLname*8 p!fields+!~ !last_field+!~ !do_header+ 9!D$v+9  !ActiveONLY+ !Mode+ !retcode+  !lflg+ P!Aflg+ T/uflg+ X/Uflg+ \/Gflg+ `/aflg+ d/dflg+ h/pflg+ l/fflg+ p/cflg+ t/jflg+ x/gflg+  |/sflg+  /tflg+  /tuid+ e  /errflg+  :/argbuf+: /parg+ /p1+ ;R:/stdbuf+;A /ndev+ /maxdev+ /devl+;  !;/tty+; /ntty+ </pid+; p/npid+ /grpid+ ; /ngrpid+!  /sessid+"; `/nsessid+# /procdir+%  /getdevcalled+& ;timeofday+D %X;timeNOW+Es 0;timeNEXT+Fs 0;timeSLEEP+Gs %H;now+H ;ncpu+J  ;Timeout+K  =/ActiveList+N= < /usr/include/usr/include/iso/usr/include/sys/usr/sfw/lib/gcc/sparc-sun-solaris2.10/3.4.3/includeva_list.hstdarg_iso.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hfcntl.hpwd.hgrp.hstat.hstdlib_iso.hstdlib_c99.hdirent.hdirent.hsiginfo.hsignal.hfault.hsyscall.hprocset.hprocessor.hpset.hregset.hprocfs_isa.hcred.hpriv.hprocfs.hlocale_iso.hwctype_iso.hwchar_impl.hwchar_iso.hwctype.hlibw.hpsDATA.cscall.cpsSTAT.cerrno.h )O    X t     h        $ ( L x     h     ! !$ !D ! ! ! ! ! ! ! ! " "X "` "d "p "t " " " " " " " # #$ #, #L #p #x #| #" # # # # # $( $X $| $ $ $ $ $ $ $s %$ %$ %0( %@ %X % % % % & &0 &@ &\" &l &x & & & & & ' ' '  ', '8 '@ '` ' ' ' ' ' (  (@ (X (t ( ( ( (" ( ( ) ) ), )8 )\ )| ) ) ) ) ) ) ) ) * * * *( *@ *T *p * * * * * + +$ +D +d + + + + , ,$ ,@ ,\ ,x , , , , - - - -  -@ -` - - - - . .  .@ .` . . . . . / /, /H /d / / / / / / / 0  0( 0< 0X 0t 0 0 0 0 0 0 1 1 1  1D 1 1 2 28 2T 2x 2 3 34 3l 3 3 3*~ 3 3 4X 4 4 4 5+| 5 5$ 58 5p 5 5 5 5 5 6( 6t 6 6 6 6 6 6 6 6 6 6 7 7 7  7D 7p 7 7 7 8 8@ 8 8 9  9 9P 9X 9 9 9 9 : : :D ; ; ;L ;T ; ; ; ; <,  > >P >h > > ? ?T ? ? ? ? ? ? @h @ A AT A A A A B8 B| B B C$ C, C\ Ch C D D< D D D E  EH Ep E E E F F( Fd Fl F F F G G  G( GP GX G G H H( H0 H8 Hh Ht H IX I I J J< Jd Jl Jt J J K K K L  LD Lx L L L M, Mh M M M M NL N N N O0 O8 OH O O P P, Ph Pp P P P Q Q Q0 Q8 R R SD S S S S S T T$ T, T0 TP Tl T T T T U$ U` U U V V W W W@ Wh W W W W W W X X8 Xd X X Y YP YX Yh Y Y Y Zf Z$3 ZL Zt Z Z Z [ [, [T [t [ [ \  \4 \T \| \ \ ] ]D ]d ] ] ] ] ^ ^  ^X ^ ^ ^ _ _< _L _l _ _ _ ` `8 `d ` ` ` ` a4 a< aP a\ at a a a a b b b( b0 bd b b b b c c$ c c c c d dL dl d d d e e$ e8 eT ex e e e e f f< f f f f f f gD gH g` gh g h8 h i@ i j  j kH k k` l; l( lD lT l l l l l l m( mtt m$ m m m n nL n n n n n o, od o o o o o p  pD p q( qL q q r  r0 r r r s} s$ u` ud( v v v w4 w@ w| w w x x x y y y( y< yD yP yT yX y y y y z, zL zl z z z z z { { {$ {x { { { |8 |X |` | | | | | | | } }0 }L }p } } } } ~ ~( ~4 ~T ~ ~       |    , <         l    D  `        0 L    ( T  , 4 H x   $   " $ `             l             4 H     X x     P `     `      , P           X     $ @ L \      @ L X h l       L X       0 @ `       H     0 `      x    0 X    P x     8 `      < ` l     , d t        8 H d     0 @ l |     ( 8 D d p       L T `      \ h p       ( 8 D! `    8 @ l     T     < D       L T    h      H P       X `     , 4 @ P l     H P x        ( \ d     \ d       ` h t       ( H T   < D   8 @          ` h     D L   $ ,      t |   T \     d l      T \ ¤ ¬      0 l ü   d l Ą  $ ŀ Ť Ŵ  ( 0 d p | Ƅ ƌ ƴ     ( D p ǀ    H h ʨ ʴ     $ 8 d | ˀ ˔ ˸               , X ͜ ͨ   @ Μ ΰ μ h /        0  0 < h Ь и 0 P Ѭ   h /     $ ( < l | Ґ Ҕ Ҡ Ҹ Ҽ    $ ( 4 L ӌ ( H T \ h Ԁ  \ Ո լ մ    ր ֌ ּ     8 \ d ׌   , \ ؔ ؼ   t ٤   , T t ڬ  @ h ۠    0 < X d ܰ      H T ݈ ݐ ݜ ݴ ݼ    8 H ހ ސ ޠ ޸  x $d - $$| - $! - $"p - $" - $#8 - $)h - $*( - $- - $/ - $0 - $1| - $3h - $5 - $6 - $6> - $u` - $v\ - $yP - $|4 - $~( - $L - $  - $ - $` - $L  - $ - $ - $  - $(# - $ʨ - $d - $ - $ - $  - $Ҡ - $44 - $h  - $Ո - $  - $ - $ݜ0 - =psDATA_initsDATA_addfreepsDATA_addfreeIDXLpsDATA_getfreepsDATA_getfreeIDXpsDATA_addIDX9psActivenpsDATA_getvalpsDATA_addvalstimesubtimeadd psDATA_switch syscallname"checklist"Gettext"main/get_pname8psDATA8prstat85prusage20,TRF-; %VH7/!QAY1KX*UW=3MN("&$6.8)5B4:IC@9L+P'd  t  &| & & )  ), +4++++-8t)*-/ $*|)-@!.#HD)  Z*p_*dn+t )\)h))*&| *@)$,H)***(*)+4* -@*@ $(2DC*J)tP-!X+ ]*c$t{**-4), )+$)  & **+)(8))&  *X*L)"*4_startstrtokstrtol_environ_endfork_iob__register_frame_info_GLOBAL_OFFSET_TABLE_pipeprocessor_infoabortget_system_configatexitexitmallocpopenuname_init.umultime__register_frame_info_tablestrftimefclosedup2strncatwaitstrncpy_DYNAMICexecl__iobstrcatfindstr__frame_state_forprint_sys_configfdopen_exitenvironfreeclose__deregister_frame_infostrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset_etext_lib_versionkillmain.divmemcpystrlenperrorExitstrstrlocaltime_finip_onlinesysinfofprintfsysconflibc.so.1SUNW_0.7libc.so.1* =(4--:)\))h*)t@)+)X),)0)T)2)I)S))Q)7*;*3*-*(5*4Y*@/*LW*XV*d&*p%*|!*C*4*9*?**O*M*6*F*E+P+ B+'+$J @D# @FpI"@Fl@, @ "@9@Fa@Fb㿐@/F @   $? 2 @㿐㿐@/F ` @ 㿐㿐a@㿀'D!@F&'@ <  ZDI"@F  DI"@F!a  DI"@F DI@E!`!c! #: DI@E DI@EDI@E!DI @EDI(@E!`DI8@E!|c!|I#h?DI@@E DIX|@E'DIcpI@E'p @E @E'D   I@ED I@EIcI@E'܀ *I @'J@Eu'J@Er'D Z@Eo@EmD Z J@Ei@Ei @EhD`<a  @EWD Z J@ESD`Zc  @ETD`d  @E@ @ELD"a @EG!@ECD #:  @E; #: $!|D ܐ" @E0'Ȁ GȒ @E('̀  x@E"D"!Ȓ 'pJ @'J`('@D'@D'D!@D@DD"!D"!А @D@D'tt @DԒ @D@DJ`0JHJP @D J`X@@DI@D'ܖJp @' @DD"aDDa  Вb@@D$!J @' ; @D'ĖJJ @r' (  @DD`c:` "! @D'D@De #: $!J @@' J`'J`('@D/'@D*' J`'D @D @Dt @DP J`@_̐ @DH J`@T㿈'D'H'L'PD P" BaP D@D. 2aPH@C'쀢  P "H@C "L aPL@C'耢  P "L@C  P" 㿐'DbJD@C @C   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @B* ?''' `      & && 㿐@/B   @@*  @    2      2 *@ @ :  @@   㿈@/B  "  @B&@ @`@B @J z- @B@@`  @BԐ 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @B| ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @B ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@A"@A"$&b""@A@A0 ' @*!*@ * "`'0 &` @A㿐@/A$&`&`&@ &` @&`&`"@㿐@/Aܮ&`&` &` &@@&`&`"@㿐@/A  ` `"@  @A` 0 `@AXL ؠ =  @A~"7j'?$   ؐ  J zo  '  @A>"㿐@/@ ? ???㿐㿠㿠V%s %s %s %s %s %s %d/%d MHz%d MHz %d MB E$ %d KB E$ %s %d CPUs %6.2f GB memory %d MB memory @/usr/sbin/prtconf -pv | /usr/bin/head -20 | /usr/bin/grep 'banner-name:' r%x%H:%M:%S/etc/release SC banner-name: '/usr/sbin/prtconfprtconf-vpsys child: exec failedclock-frequency:ecache-line-size:ecache-size:ecache-nlines:name: sys: kill failedsys: wait error%s eh+4++-8))-+00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t000000000000= &| &o to  pd ),   +|e  e `4 (L 8H H(TX| - et - e( - e( - e 8 - e#H - e$,H - e$t - e8$( - ed  t  &| & & )  ), +4++++-8/ &+*+8+F\k+~+p-8|-P) ) H-L`4  8(++;(TFQ|Z(cn-0|&&+&p++t)*-/ *| -@!#H&)  <*pA*dP+V h)\o)ht){)*&| *@)$,H)***(*)+4*-@*@$(D+*2)t8-!@+ E*K$tc*j*p-4w), )+$)  & **+)(8))& *X*L) *4sysGCCcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummysys.cbufferframe.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.s_start_START_strtokstrtol_environ_endfork_iob__register_frame_info_GLOBAL_OFFSET_TABLE_pipeprocessor_infoabortget_system_configatexitexitmallocpopenuname_init.umultime__register_frame_info_tablestrftimefclose_END_dup2strncatwaitstrncpy_DYNAMICexecl__iobstrcatfindstr__frame_state_forprint_sys_configfdopen_exitenvironfreeclose__deregister_frame_infostrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset_etext_lib_versionkillmain.divmemcpystrlenperrorExitstrstrlocaltime_finip_onlinesysinfofprintfsysconfas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4'dd<'Qk-yɀ.Ijƀ(=^y,",ƀ:ـ?EJ ܀%+N5aBvG]v!>#U'k>DEɀJ߀NO P$U;^S_mnow}׀~  / M k - . > р? @ A C ,D AE UG kH I J a b րc d l m 7n Ro m u Հ   2   - C Y m ǀ ߀  4H^r8ڀ-%K-5 R<pEKPUɀZ߀`a bc1H^tрR2Lgɀ҂*.Iay9S]'̀Y/u"$C+If߀7 /M E d ـ 9!!!Հ""a#!#u##$$B$]%π%$*D*D+D,%$%$2&1DD2D3D6D7D:$D?TDBxDCDEDHDIDJDL@DN\DRpDTDUDXDYDZD[D\ Da<Da<&'3&;4<&F$D&G$g &afDDgDhDrDw$Dx4DyHDzlD}DDDDD,DHDTDdDDDDDD\DtDDDDDDD DD,D@DhDpDxDDDDDDDD DD D8DXDtDDDDD DD,D`DhDDDDDDD$D@DhDDDDDD&nh&i&j&k&l&l&ŀl&̀l&݀l&l&m'n' n'ox''pt'2rp';$'<$'KD'VH'bL'nPDDDD$D,D8DdD|DDDDDDDDD $D ,D 8D 8''8'$@'$('DDDD$D0'$8'(!-P'd`, d`"d`,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$i`)@h)@h )$4)$~)@})@} )$L)*<$*O@*m@ *w@ *$H*$(*@*$T*$|*@*@*@*@+ @+$+$+0@+<$+=$'(+N@&+Y$+Z$R+s@Q+}@Q+$(+$ 8+@}+@}+@~+@~+$+$#+@,@,$H,$ $,,7@ ,E@ ,Q$H,R$$t,r@,$,$4$,@3,@3,$(,(P-,d&.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpsys.c/SOFT/sys/sys.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/sys/feature_tests.h/usr/include/sys/va_list.h__va_list:t(3,1)=(3,2)=*(0,19)size_t:t(1,1)=(0,4)__longlong_t:t(1,2)=(0,6)off_t:t(1,3)=(0,3)off64_t:t(1,4)=(1,2)fpos_t:t(1,5)=(0,3)fpos64_t:t(1,6)=(1,2)FILE:t(1,7)=(1,8)=s16_cnt:(0,1),0,32;_ptr:(1,9)=*(0,11),32,32;_base:(1,9),64,32;_flag:(0,11),96,8;_file:(0,11),104,8;;/usr/include/stdlib.hdiv_t:t(4,1)=(4,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(4,3)=(4,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;lldiv_t:t(4,5)=(4,6)=s16quot:(0,6),0,64;rem:(0,6),64,64;;uid_t:t(4,7)=(0,3)wchar_t:t(4,8)=(0,3)/usr/include/string.h/usr/include/sys/utsname.hutsname:T(6,1)=s1285sysname:(6,2)=ar(0,0);0;256;(0,2),0,2056;nodename:(6,2),2056,2056;release:(6,2),4112,2056;version:(6,2),6168,2056;machine:(6,2),8224,2056;;/usr/include/unistd.h/usr/include/sys/types.h/usr/include/sys/isa_defs.h/usr/include/sys/machtypes.h_physadr_t:T(10,1)=s4r:(10,2)=ar(0,0);0;0;(0,1),0,32;;physadr_t:t(10,3)=(10,4)=*(10,1)_label_t:T(10,5)=s8val:(10,6)=ar(0,0);0;1;(0,1),0,64;;label_t:t(10,7)=(10,5)lock_t:t(10,8)=(0,11)/usr/include/sys/int_types.hint8_t:t(11,1)=(0,2)int16_t:t(11,2)=(0,8)int32_t:t(11,3)=(0,1)int64_t:t(11,4)=(0,6)uint8_t:t(11,5)=(0,11)uint16_t:t(11,6)=(0,9)uint32_t:t(11,7)=(0,4)uint64_t:t(11,8)=(0,7)intmax_t:t(11,9)=(11,4)uintmax_t:t(11,10)=(11,8)intptr_t:t(11,11)=(0,1)uintptr_t:t(11,12)=(0,4)int_least8_t:t(11,13)=(0,2)int_least16_t:t(11,14)=(0,8)int_least32_t:t(11,15)=(0,1)int_least64_t:t(11,16)=(0,6)uint_least8_t:t(11,17)=(0,11)uint_least16_t:t(11,18)=(0,9)uint_least32_t:t(11,19)=(0,4)uint_least64_t:t(11,20)=(0,7)longlong_t:t(8,1)=(0,6)u_longlong_t:t(8,2)=(0,7)uchar_t:t(8,3)=(0,11)ushort_t:t(8,4)=(0,9)uint_t:t(8,5)=(0,4)ulong_t:t(8,6)=(0,5)caddr_t:t(8,7)=(8,8)=*(0,2)daddr_t:t(8,9)=(0,3)cnt_t:t(8,10)=(0,8)paddr_t:t(8,11)=(8,6)use_t:t(8,12)=(8,3)sysid_t:t(8,13)=(0,8)index_t:t(8,14)=(0,8)ino_t:t(8,15)=(8,6)blkcnt_t:t(8,16)=(0,3)fsblkcnt_t:t(8,17)=(8,6)fsfilcnt_t:t(8,18)=(8,6)ino64_t:t(8,19)=(8,2)blkcnt64_t:t(8,20)=(8,1)fsblkcnt64_t:t(8,21)=(8,2)fsfilcnt64_t:t(8,22)=(8,2) :T(8,23)=eB_FALSE:0,B_TRUE:1,;boolean_t:t(8,24)=(8,23)pad64_t:t(8,25)=(11,4)upad64_t:t(8,26)=(11,8)offset_t:t(8,27)=(8,1)u_offset_t:t(8,28)=(8,2)len_t:t(8,29)=(8,2)diskaddr_t:t(8,30)=(8,1)lloff_t:t(8,31)=(8,32)=u8_f:(8,27),0,64;_p:(8,33)=s8_u:(0,3),0,32;_l:(1,3),32,32;;,0,64;;lldaddr_t:t(8,34)=(8,35)=u8_f:(8,30),0,64;_p:(8,36)=s8_u:(0,3),0,32;_l:(8,9),32,32;;,0,64;;k_fltset_t:t(8,37)=(8,6)id_t:t(8,38)=(0,3)useconds_t:t(8,39)=(8,5)major_t:t(8,40)=(8,6)minor_t:t(8,41)=(8,6)pri_t:t(8,42)=(0,8)o_mode_t:t(8,43)=(8,4)o_dev_t:t(8,44)=(0,8)o_uid_t:t(8,45)=(8,4)o_gid_t:t(8,46)=(8,45)o_nlink_t:t(8,47)=(0,8)o_pid_t:t(8,48)=(0,8)o_ino_t:t(8,49)=(8,4)key_t:t(8,50)=(0,1)mode_t:t(8,51)=(8,6)gid_t:t(8,52)=(4,7)nlink_t:t(8,53)=(8,6)dev_t:t(8,54)=(8,6)pid_t:t(8,55)=(0,3)pthread_t:t(8,56)=(0,4)pthread_key_t:t(8,57)=(0,4)_pthread_mutex:T(8,58)=s24__pthread_mutex_flags:(8,59)=s8__pthread_mutex_flag:(8,60)=ar(0,0);0;3;(11,5),0,32;__pthread_mutex_type:(11,7),32,32;;,0,64;__pthread_mutex_lock:(8,61)=u8__pthread_mutex_lock64:(8,62)=s8__pthread_mutex_pad:(8,63)=ar(0,0);0;7;(11,5),0,64;;,0,64;__pthread_mutex_owner64:(8,26),0,64;;,64,64;__pthread_mutex_data:(8,26),128,64;;pthread_mutex_t:t(8,64)=(8,58)_pthread_cond:T(8,65)=s16__pthread_cond_flags:(8,66)=s8__pthread_cond_flag:(8,60),0,32;__pthread_cond_type:(11,7),32,32;;,0,64;__pthread_cond_data:(8,26),64,64;;pthread_cond_t:t(8,67)=(8,65)_pthread_attr:T(8,68)=s4__pthread_attrp:(3,2),0,32;;pthread_attr_t:t(8,69)=(8,68)_pthread_mutexattr:T(8,70)=s4__pthread_mutexattrp:(3,2),0,32;;pthread_mutexattr_t:t(8,71)=(8,70)_pthread_condattr:T(8,72)=s4__pthread_condattrp:(3,2),0,32;;pthread_condattr_t:t(8,73)=(8,72)_once:T(8,74)=s32__pthread_once_pad:(8,75)=ar(0,0);0;3;(8,26),0,256;;pthread_once_t:t(8,76)=(8,74)ssize_t:t(8,77)=(0,1)time_t:t(8,78)=(0,3)clock_t:t(8,79)=(0,3)clockid_t:t(8,80)=(0,1)timer_t:t(8,81)=(0,1)unchar:t(8,82)=(0,11)ushort:t(8,83)=(0,9)uint:t(8,84)=(0,4)ulong:t(8,85)=(0,5)hostid_t:t(8,86)=(0,3)u_char:t(8,87)=(0,11)u_short:t(8,88)=(0,9)u_int:t(8,89)=(0,4)u_long:t(8,90)=(0,5)_quad:T(8,91)=s8val:(8,92)=ar(0,0);0;1;(0,3),0,64;;quad:t(8,93)=(8,91)/usr/include/sys/select.h/usr/include/sys/time.htimeval:T(13,1)=s8tv_sec:(8,78),0,32;tv_usec:(0,3),32,32;;timezone:T(13,2)=s8tz_minuteswest:(0,1),0,32;tz_dsttime:(0,1),32,32;;/usr/include/sys/types.hitimerval:T(13,3)=s16it_interval:(13,1),0,64;it_value:(13,1),64,64;;timespec:T(13,4)=s8tv_sec:(8,78),0,32;tv_nsec:(0,3),32,32;;timespec_t:t(13,5)=(13,4)timestruc_t:t(13,6)=(13,4)itimerspec:T(13,7)=s16it_interval:(13,4),0,64;it_value:(13,4),64,64;;itimerspec_t:t(13,8)=(13,7)hrtime_t:t(13,9)=(8,1)/usr/include/time.htm:T(15,1)=s36tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;;/usr/include/sys/time.h/usr/include/sys/siginfo.hsigval:T(17,1)=u4sival_int:(0,1),0,32;sival_ptr:(3,2),0,32;;sigevent:T(17,2)=s24sigev_notify:(0,1),0,32;_sigev_un:(17,3)=u4_sigev_signo:(0,1),0,32;_sigev_notify_function:(17,4)=*(17,5)=f(0,19),0,32;;,32,32;sigev_value:(17,1),64,32;_sigev_pad1:(0,1),96,32;_sigev_notify_attributes:(3,2),128,32;_sigev_pad2:(0,1),160,32;;/usr/include/sys/machsig.h/usr/include/sys/time.hsiginfo:T(17,6)=s128si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(17,7)=u116__pad:(17,8)=ar(0,0);0;28;(0,1),0,928;__proc:(17,9)=s16__pid:(8,55),0,32;__pdata:(17,10)=u12__kill:(17,11)=s8__uid:(4,7),0,32;__value:(17,1),32,32;;,0,64;__cld:(17,12)=s12__utime:(8,79),0,32;__status:(0,1),32,32;__stime:(8,79),64,32;;,0,96;;,32,96;;,0,128;__fault:(17,13)=s12__addr:(3,2),0,32;__trapno:(0,1),32,32;__pc:(8,7),64,32;;,0,96;__file:(17,14)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(17,15)=s116__faddr:(8,7),0,32;\__tstamp:(13,6),32,64;__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;__sysarg:(17,16)=ar(0,0);0;7;(0,3),128,256;__mstate:(17,17)=ar(0,0);0;16;(0,3),384,544;;,0,928;;,96,928;;siginfo_t:t(17,18)=(17,6)k_siginfo:T(17,19)=s28si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(17,20)=u16__proc:(17,21)=s16__pid:(8,55),0,32;__pdata:(17,22)=u12__kill:(17,23)=s8__uid:(4,7),0,32;__value:(17,1),32,32;;,0,64;__cld:(17,24)=s12__utime:(8,79),0,32;__status:(0,1),32,32;__stime:(8,79),64,32;;,0,96;;,32,96;;,0,128;__fault:(17,25)=s12__addr:(3,2),0,32;__trapno:(0,1),32,32;__pc:(8,7),64,32;;,0,96;__file:(17,26)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(17,27)=s16__faddr:(8,7),0,32;__tstamp:(13,6),32,64;\__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;;,0,128;;,96,128;;k_siginfo_t:t(17,28)=(17,19)sigqueue:T(17,29)=s40sq_next:(17,30)=*(17,29),0,32;sq_info:(17,28),32,224;sq_func:(17,31)=*(17,32)=f(0,19),256,32;sq_backptr:(3,2),288,32;;sigqueue_t:t(17,33)=(17,29)/usr/include/sys/select.hfd_mask:t(12,1)=(0,3)fds_mask:t(12,2)=(0,3)fd_set:T(12,3)=s128fds_bits:(12,4)=ar(0,0);0;31;(0,3),0,1024;;fd_set:t(12,5)=(12,3)/usr/include/sys/unistd.h/usr/include/sys/systeminfo.h/usr/include/sys/processor.h/usr/include/sys/procset.hidtype:T(24,1)=eP_PID:0,P_PPID:1,P_PGID:2,P_SID:3,P_CID:4,P_UID:5,P_GID:6,P_ALL:7,P_LWPID:8,;idtype_t:t(24,2)=(24,1)idop:T(24,3)=ePOP_DIFF:0,POP_AND:1,POP_OR:2,POP_XOR:3,;idop_t:t(24,4)=(24,3)procset:T(24,5)=s20p_op:(24,4),0,32;p_lidtype:(24,2),32,32;p_lid:(8,38),64,32;p_ridtype:(24,2),96,32;p_rid:(8,38),128,32;;procset_t:t(24,6)=(24,5)processorid_t:t(23,1)=(0,1)processor_info_t:t(23,2)=(23,3)=s56pi_state:(0,1),0,32;pi_processor_type:(23,4)=ar(0,0);0;15;(0,2),32,128;pi_fputypes:(23,5)=ar(0,0);0;31;(0,2),160,256;pi_clock:(0,1),416,32;;/usr/include/signal.h/usr/include/sys/signal.hsigset_t:t(26,1)=(26,2)=s16__sigbits:(26,3)=ar(0,0);0;3;(0,5),0,128;;k_sigset_t:t(26,4)=(26,5)=s8__sigbits:(26,6)=ar(0,0);0;1;(0,5),0,64;;sigaction:T(26,7)=s32sa_flags:(0,1),0,32;_funcptr:(26,8)=u4_handler:(26,9)=*(26,10)=f(0,19),0,32;_sigaction:(26,11)=*(26,12)=f(0,19),0,32;;,32,32;sa_mask:(26,1),64,128;sa_resv:(10,6),192,64;;sigaltstack:T(26,13)=s12ss_sp:(3,2),0,32;ss_size:(1,1),32,32;ss_flags:(0,1),64,32;;stack_t:t(26,14)=(26,13)signotify_id:T(26,15)=s12sn_pid:(8,55),0,32;sn_index:(0,1),32,32;sn_pad:(0,1),64,32;;signotify_id_t:t(26,16)=(26,15)sigstack:T(26,17)=s8ss_sp:(3,2),0,32;ss_onstack:(0,1),32,32;;sig_atomic_t:t(25,1)=(0,1)conf:T(0,20)=s400time_str:(0,21)=ar(0,0);0;29;(0,2),0,240;date_str:(0,21),240,240;sys_name:(0,21),480,240;os_name:(0,22)=ar(0,0);0;99;(0,2),720,800;arch_name:(0,21),1520,240;plat_name:(0,21),1760,240;chip_name:(0,21),2000,240;banner_name:(0,22),2240,800;mem_size:(0,1),3040,32;sys_freq:(0,1),3072,32;cpu_freq:(0,1),3104,32;cpu_ecache:(0,1),3136,32;ncpus:(0,1),3168,32;;system_config_t:t(0,23)=(0,20)main:F(0,1)print_sys_config:F(0,19)log:p(0,24)=*(1,7)conf:(0,25)=*(0,23)mem:(0,13)get_system_config:F(0,19)conf:p(0,25)timestamp:(8,78)date:(0,26)=*(15,1)sys_struct:(6,1)fp:(0,24)fd:(10,6)status:(0,1)i:(0,1)line_size:(0,1)nlines:(0,1)which:(0,1)delim:(8,8)junk:(8,8)stuff:(8,8)buffer:(23,2)pid:(8,55)f:(0,24)findstr:F(8,8)fp:p(0,24)str1:p(8,8)str2:p(8,8)which:p(0,27)=*(0,1)bufptr1:(8,8)bufptr2:(8,8)perrorExit:F(0,19)str:p(8,8)buffer:S(0,28)=ar(0,0);0;127;(0,2)frame.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10) | dd  po t t -  7   AG&|&|M&&S&&[[) ) `),), e+4+4n++t++{++++T-8-8-4@F5t9;`$ ;| VV;XT070701000077d0000081ed0000000000000000000000013fd0546e0000642c000000200000001d00000000000000000000001b00000000root/etc/STATsrv/bin/tailXELF 4_4 (4433448ll/usr/lib/ld.so.15BA65'3=(*0;-@<:.79$"#%4?2!,+)1&/8>        4 T lp t @! H64 LRPX^ejq w,}8Hl@(!DlT \&3 - :A ,@F8M T Z_startatoi_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepabortfseekatexitexitmalloc_init.umulfputs__register_frame_info_table_DYNAMIC__iob__frame_state_for_exitenvironfree__deregister_frame_infostrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset_etext_lib_versionfflushmainmemcpystrlen_finifprintflibc.so.1SYSVABI_1.3libc.so.1b7̳l.&'0A8+<#%5(4 ?,*8>D2P$\9 @D# @CF!@C@, @ "@9@C@C㿐@/CЮ @   $? 2 @㿐㿐@/CH ` @ 㿐H'D'H' 'D  HaF@C?@C H 'D   H @@C'䀢  ''F@Cu'쀢 HaF@C_Fb@Cba@Ca@Ca '   @CW' !,@CR  @C=a@C<' @C9䀢  Fb@C&a@C%' '   ( "@    (@?("@*``"?""??  " 2` 㿐   "  ɔ @   @8 ` &&'㿀 '  @' &  '& @B* ?''' `      & && 㿐@/B   @@*  @    2      2 *@ @ :  @@   㿈@/B  "  @B2&@ @`@B+ @J z- @B$@@`  @B 2&`   * **` @  &` ݒ`` @&`J@ z В 㿀@  @A ?@& ?'k.'@*!Γ*@ 88t88$Tt000000000000000000000000000000  * **` @   &  * @ &   **  *` @  &s QO @Az ' @ *a* @_" =@ W*a53 @ *a*`@ G"`$" 6a;&` 36a,&`@A2"@A:"$&b""@A3@A40 ' @*!*@ * "`'0 &` @A㿐@/@@&`&`&@ &` @&`&`"@㿐@/@&`&` &` &@@&`&`"@㿐@/@Ⱞ  ` `"@  @@` 0 `@@XL ؠ =  @@ɔ"7j'?$   ؐ  J zo  '  @@"㿐@/@ ? ???㿐㿠㿠nUsage: %s filename [Timeout] r%s WAITING:: cannot open file: %s tailX ==> Nothing... ehlp(0 00<0H0T0`0l0x0000000000000x  o o  T   |e  e l4 (L 8H H4TX - et$ - e4 - e( - eD - eH - e8H - e - e8( - e       4 T lp%)7E `[ `j}  p  ,( 0 HLl4D#(4D4TO$Zc4lwh((|  t@! H!4 7=PCIPU\ b,hn8Hl@(!DlT  \3  +2 ,@78> E KtailXcrti.svalues-Xa.ccrtstuff.cp.2__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummyobject.7frame_dummytailX.cgcc2_compiled.frame.c.LLC0.LLC1fde_insertobjectsdecode_sleb128decode_uleb128execute_cfa_insnextract_cie_info__FRAME_BEGIN__count_fdesframe_initadd_fdesfind_fdecrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.s_start_START_atoi_environ_end_iob__register_frame_info_GLOBAL_OFFSET_TABLE_sleepabortfseekatexitexitmalloc_init.umulfputs__register_frame_info_table_END__DYNAMIC__iob__frame_state_for_exitenvironfree__deregister_frame_infostrcmpfgets_edata_PROCEDURE_LINKAGE_TABLE_fopenmemset_etext_lib_versionfflushmainmemcpystrlen_finifprintfas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.8.1as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris/ELF (3.0); <I4, dl"dl,<;eπA݀(B]~ڀ(<F]uzЀ.À . -z<?n ,!!#q$b$%v% %5%K %`%h&j&'=2'Q3'e4'y5'6'( (L()&)|$il)@h)@h )$4)$~)@})@} )$L)*<$*O@*m@ *w@ *$H*$4*@*$T*$*@*@*@*@+ @+$+$$+0@+<$+=$'4+N@&+Y$+Z$R+s@Q+}@Q+$(+$D+@}+@}+@~+@~+$+$+@,@,$H,$ 8,7@ ,E@ ,Q$H,R$,r@,$,$4,@3,@3,$(,(P,d(.interp.hash.dynsym.dynstr.SUNW_version.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/space/respin/usr/src/lib/libc; /ws/on297-tools/SUNWspro/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -Iinc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/space/respin/proto/root_sparc/usr/include -c port/gen/values-Xa.c -W0,-xpframe.c/ext1/SOURCES/gcc-2.8.1/./frame.cgcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0;-1;long unsigned int:t(0,5)=r(0,5);0;-1;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.hconfig/sparc/xm-sol2.hconfig/sparc/xm-sysv4.htm.hconfig/sparc/sol2-sld.hconfig/sparc/sol2.hconfig/sparc/sysv4.hconfig/sparc/sparc.hcmodel:T(8,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(8,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_SPARCLET:7,PROCESSOR_TSC701:8,PROCESSOR_V8PLUS:9,PROCESSOR_V9:10,PROCESSOR_ULTRASPARC:11,;sparc_cpu_select:T(8,3)=s16string:(8,4)=*(0,2),0,32;name:(8,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(8,5)=eNO_REGS:0,FPCC_REGS:1,GENERAL_REGS:2,FP_REGS:3,EXTRA_FP_REGS:4,GENERAL_OR_FP_REGS:5,GENERAL_OR_EXTRA_FP_REGS:6,ALL_REGS:7,LIM_REG_CLASSES:8,;sparc_args:T(8,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;config/svr4.hconfig/xm-svr4.hdefaults.hgansidecl.hdwarf2.hdwarf_tag:T(13,1)=eDW_TAG_padding:0,DW_TAG_array_type:1,DW_TAG_class_type:2,DW_TAG_entry_point:3,DW_TAG_enumeration_type:4,DW_TAG_formal_parameter:5,DW_TAG_imported_declaration:8,DW_TAG_label:10,DW_TAG_lexical_block:11,DW_TAG_member:13,DW_TAG_pointer_type:15,DW_TAG_reference_type:16,DW_TAG_compile_unit:17,DW_TAG_string_type:18,DW_TAG_structure_type:19,DW_TAG_subroutine_type:21,DW_TAG_typedef:22,DW_TAG_union_type:23,DW_TAG_unspecified_parameters:24,DW_TAG_variant:25,DW_TAG_common_block:26,DW_TAG_common_inclusion:27,DW_TAG_inheritance:28,DW_TAG_inlined_subroutine:29,DW_TAG_module:30,DW_TAG_ptr_to_member_type:31,\DW_TAG_set_type:32,DW_TAG_subrange_type:33,DW_TAG_with_stmt:34,DW_TAG_access_declaration:35,DW_TAG_base_type:36,DW_TAG_catch_block:37,DW_TAG_const_type:38,DW_TAG_constant:39,DW_TAG_enumerator:40,DW_TAG_file_type:41,DW_TAG_friend:42,DW_TAG_namelist:43,DW_TAG_namelist_item:44,DW_TAG_packed_type:45,DW_TAG_subprogram:46,DW_TAG_template_type_param:47,DW_TAG_template_value_param:48,DW_TAG_thrown_type:49,DW_TAG_try_block:50,DW_TAG_variant_part:51,DW_TAG_variable:52,DW_TAG_volatile_type:53,DW_TAG_MIPS_loop:16513,DW_TAG_format_label:16641,DW_TAG_function_template:16642,DW_TAG_class_template:16643,;dwarf_form:T(13,2)=eDW_FORM_addr:1,DW_FORM_block2:3,DW_FORM_block4:4,DW_FORM_data2:5,DW_FORM_data4:6,DW_FORM_data8:7,DW_FORM_string:8,DW_FORM_block:9,DW_FORM_block1:10,DW_FORM_data1:11,DW_FORM_flag:12,DW_FORM_sdata:13,DW_FORM_strp:14,DW_FORM_udata:15,DW_FORM_ref_addr:16,DW_FORM_ref1:17,DW_FORM_ref2:18,DW_FORM_ref4:19,DW_FORM_ref8:20,DW_FORM_ref_udata:21,DW_FORM_indirect:22,;dwarf_attribute:T(13,3)=eDW_AT_sibling:1,DW_AT_location:2,DW_AT_name:3,DW_AT_ordering:9,DW_AT_subscr_data:10,DW_AT_byte_size:11,DW_AT_bit_offset:12,DW_AT_bit_size:13,DW_AT_element_list:15,DW_AT_stmt_list:16,DW_AT_low_pc:17,DW_AT_high_pc:18,DW_AT_language:19,DW_AT_member:20,DW_AT_discr:21,DW_AT_discr_value:22,DW_AT_visibility:23,DW_AT_import:24,DW_AT_string_length:25,DW_AT_common_reference:26,DW_AT_comp_dir:27,DW_AT_const_value:28,DW_AT_containing_type:29,DW_AT_default_value:30,DW_AT_inline:32,DW_AT_is_optional:33,DW_AT_lower_bound:34,DW_AT_producer:37,\DW_AT_prototyped:39,DW_AT_return_addr:42,DW_AT_start_scope:44,DW_AT_stride_size:46,DW_AT_upper_bound:47,DW_AT_abstract_origin:49,DW_AT_accessibility:50,DW_AT_address_class:51,DW_AT_artificial:52,DW_AT_base_types:53,DW_AT_calling_convention:54,DW_AT_count:55,DW_AT_data_member_location:56,DW_AT_decl_column:57,DW_AT_decl_file:58,DW_AT_decl_line:59,DW_AT_declaration:60,DW_AT_discr_list:61,DW_AT_encoding:62,DW_AT_external:63,DW_AT_frame_base:64,DW_AT_friend:65,DW_AT_identifier_case:66,DW_AT_macro_info:67,DW_AT_namelist_items:68,DW_AT_priority:69,DW_AT_segment:70,DW_AT_specification:71,\DW_AT_static_link:72,DW_AT_type:73,DW_AT_use_location:74,DW_AT_variable_parameter:75,DW_AT_virtuality:76,DW_AT_vtable_elem_location:77,DW_AT_MIPS_fde:8193,DW_AT_MIPS_loop_begin:8194,DW_AT_MIPS_tail_loop_begin:8195,DW_AT_MIPS_epilog_begin:8196,DW_AT_MIPS_loop_unroll_factor:8197,DW_AT_MIPS_software_pipeline_depth:8198,DW_AT_MIPS_linkage_name:8199,DW_AT_MIPS_stride:8200,DW_AT_MIPS_abstract_name:8201,DW_AT_MIPS_clone_origin:8202,DW_AT_MIPS_has_inlines:8203,DW_AT_sf_names:8449,DW_AT_src_info:8450,DW_AT_mac_info:8451,DW_AT_src_coords:8452,DW_AT_body_begin:8453,DW_AT_body_end:8454,;dwarf_location_atom:T(13,4)=eDW_OP_addr:3,DW_OP_deref:6,DW_OP_const1u:8,DW_OP_const1s:9,DW_OP_const2u:10,DW_OP_const2s:11,DW_OP_const4u:12,DW_OP_const4s:13,DW_OP_const8u:14,DW_OP_const8s:15,DW_OP_constu:16,DW_OP_consts:17,DW_OP_dup:18,DW_OP_drop:19,DW_OP_over:20,DW_OP_pick:21,DW_OP_swap:22,DW_OP_rot:23,DW_OP_xderef:24,DW_OP_abs:25,DW_OP_and:26,DW_OP_div:27,DW_OP_minus:28,DW_OP_mod:29,DW_OP_mul:30,DW_OP_neg:31,DW_OP_not:32,DW_OP_or:33,DW_OP_plus:34,DW_OP_plus_uconst:35,DW_OP_shl:36,DW_OP_shr:37,\DW_OP_shra:38,DW_OP_xor:39,DW_OP_bra:40,DW_OP_eq:41,DW_OP_ge:42,DW_OP_gt:43,DW_OP_le:44,DW_OP_lt:45,DW_OP_ne:46,DW_OP_skip:47,DW_OP_lit0:48,DW_OP_lit1:49,DW_OP_lit2:50,DW_OP_lit3:51,DW_OP_lit4:52,DW_OP_lit5:53,DW_OP_lit6:54,DW_OP_lit7:55,DW_OP_lit8:56,DW_OP_lit9:57,DW_OP_lit10:58,DW_OP_lit11:59,DW_OP_lit12:60,DW_OP_lit13:61,DW_OP_lit14:62,DW_OP_lit15:63,DW_OP_lit16:64,DW_OP_lit17:65,DW_OP_lit18:66,DW_OP_lit19:67,DW_OP_lit20:68,DW_OP_lit21:69,DW_OP_lit22:70,DW_OP_lit23:71,\DW_OP_lit24:72,DW_OP_lit25:73,DW_OP_lit26:74,DW_OP_lit27:75,DW_OP_lit28:76,DW_OP_lit29:77,DW_OP_lit30:78,DW_OP_lit31:79,DW_OP_reg0:80,DW_OP_reg1:81,DW_OP_reg2:82,DW_OP_reg3:83,DW_OP_reg4:84,DW_OP_reg5:85,DW_OP_reg6:86,DW_OP_reg7:87,DW_OP_reg8:88,DW_OP_reg9:89,DW_OP_reg10:90,DW_OP_reg11:91,DW_OP_reg12:92,DW_OP_reg13:93,DW_OP_reg14:94,DW_OP_reg15:95,DW_OP_reg16:96,DW_OP_reg17:97,DW_OP_reg18:98,DW_OP_reg19:99,DW_OP_reg20:100,DW_OP_reg21:101,DW_OP_reg22:102,DW_OP_reg23:103,DW_OP_reg24:104,\DW_OP_reg25:105,DW_OP_reg26:106,DW_OP_reg27:107,DW_OP_reg28:108,DW_OP_reg29:109,DW_OP_reg30:110,DW_OP_reg31:111,DW_OP_breg0:112,DW_OP_breg1:113,DW_OP_breg2:114,DW_OP_breg3:115,DW_OP_breg4:116,DW_OP_breg5:117,DW_OP_breg6:118,DW_OP_breg7:119,DW_OP_breg8:120,DW_OP_breg9:121,DW_OP_breg10:122,DW_OP_breg11:123,DW_OP_breg12:124,DW_OP_breg13:125,DW_OP_breg14:126,DW_OP_breg15:127,DW_OP_breg16:128,DW_OP_breg17:129,DW_OP_breg18:130,DW_OP_breg19:131,DW_OP_breg20:132,DW_OP_breg21:133,DW_OP_breg22:134,DW_OP_breg23:135,DW_OP_breg24:136,\DW_OP_breg25:137,DW_OP_breg26:138,DW_OP_breg27:139,DW_OP_breg28:140,DW_OP_breg29:141,DW_OP_breg30:142,DW_OP_breg31:143,DW_OP_regx:144,DW_OP_fbreg:145,DW_OP_bregx:146,DW_OP_piece:147,DW_OP_deref_size:148,DW_OP_xderef_size:149,DW_OP_nop:150,;dwarf_type:T(13,5)=eDW_ATE_void:0,DW_ATE_address:1,DW_ATE_boolean:2,DW_ATE_complex_float:3,DW_ATE_float:4,DW_ATE_signed:5,DW_ATE_signed_char:6,DW_ATE_unsigned:7,DW_ATE_unsigned_char:8,;dwarf_array_dim_ordering:T(13,6)=eDW_ORD_row_major:0,DW_ORD_col_major:1,;dwarf_access_attribute:T(13,7)=eDW_ACCESS_public:1,DW_ACCESS_protected:2,DW_ACCESS_private:3,;dwarf_visibility_attribute:T(13,8)=eDW_VIS_local:1,DW_VIS_exported:2,DW_VIS_qualified:3,;dwarf_virtuality_attribute:T(13,9)=eDW_VIRTUALITY_none:0,DW_VIRTUALITY_virtual:1,DW_VIRTUALITY_pure_virtual:2,;dwarf_id_case:T(13,10)=eDW_ID_case_sensitive:0,DW_ID_up_case:1,DW_ID_down_case:2,DW_ID_case_insensitive:3,;dwarf_calling_convention:T(13,11)=eDW_CC_normal:1,DW_CC_program:2,DW_CC_nocall:3,;dwarf_inline_attribute:T(13,12)=eDW_INL_not_inlined:0,DW_INL_inlined:1,DW_INL_declared_not_inlined:2,DW_INL_declared_inlined:3,;dwarf_discrim_list:T(13,13)=eDW_DSC_label:0,DW_DSC_range:1,;dwarf_line_number_ops:T(13,14)=eDW_LNS_extended_op:0,DW_LNS_copy:1,DW_LNS_advance_pc:2,DW_LNS_advance_line:3,DW_LNS_set_file:4,DW_LNS_set_column:5,DW_LNS_negate_stmt:6,DW_LNS_set_basic_block:7,DW_LNS_const_add_pc:8,DW_LNS_fixed_advance_pc:9,;dwarf_line_number_x_ops:T(13,15)=eDW_LNE_end_sequence:1,DW_LNE_set_address:2,DW_LNE_define_file:3,;dwarf_call_frame_info:T(13,16)=eDW_CFA_advance_loc:64,DW_CFA_offset:128,DW_CFA_restore:192,DW_CFA_nop:0,DW_CFA_set_loc:1,DW_CFA_advance_loc1:2,DW_CFA_advance_loc2:3,DW_CFA_advance_loc4:4,DW_CFA_offset_extended:5,DW_CFA_restore_extended:6,DW_CFA_undefined:7,DW_CFA_same_value:8,DW_CFA_register:9,DW_CFA_remember_state:10,DW_CFA_restore_state:11,DW_CFA_def_cfa:12,DW_CFA_def_cfa_register:13,DW_CFA_def_cfa_offset:14,DW_CFA_MIPS_advance_loc8:29,DW_CFA_GNU_window_save:45,DW_CFA_GNU_args_size:46,;dwarf_source_language:T(13,17)=eDW_LANG_C89:1,DW_LANG_C:2,DW_LANG_Ada83:3,DW_LANG_C_plus_plus:4,DW_LANG_Cobol74:5,DW_LANG_Cobol85:6,DW_LANG_Fortran77:7,DW_LANG_Fortran90:8,DW_LANG_Pascal83:9,DW_LANG_Modula2:10,DW_LANG_Mips_Assembler:32769,;dwarf_macinfo_record_type:T(13,18)=eDW_MACINFO_define:1,DW_MACINFO_undef:2,DW_MACINFO_start_file:3,DW_MACINFO_end_file:4,DW_MACINFO_vendor_ext:255,;include/stddef.hptrdiff_t:t(14,1)=(0,1)size_t:t(14,2)=(0,4)wchar_t:t(14,3)=(0,3)wint_t:t(14,4)=(0,4)frame.hframe_state:T(15,1)=s532cfa:(15,2)=*(0,19),0,32;eh_ptr:(15,2),32,32;cfa_offset:(0,3),64,32;args_size:(0,3),96,32;reg_or_offset:(15,3)=ar(0,0);0;101;(0,3),128,3264;cfa_reg:(0,9),3392,16;retaddr_column:(0,9),3408,16;saved:(15,4)=ar(0,0);0;101;(0,2),3424,816;;frame_state:t(15,5)=(15,1)object:T(15,6)=s24pc_begin:(15,2),0,32;pc_end:(15,2),32,32;fde_begin:(15,7)=*(15,8)=xsdwarf_fde:,64,32;fde_array:(15,9)=*(15,7),96,32;count:(14,2),128,32;next:(15,10)=*(15,6),160,32;;sword:t(0,20)=(0,1)uword:t(0,21)=(0,4)uaddr:t(0,22)=(0,4)saddr:t(0,23)=(0,1)ubyte:t(0,24)=(0,11)dwarf_cie:T(0,25)=s12length:(0,21),0,32;CIE_id:(0,20),32,32;version:(0,24),64,8;augmentation:(0,26)=ar(0,0);0;-1;(0,2),72,0;;dwarf_fde:T(15,8)=s16length:(0,21),0,32;CIE_delta:(0,20),32,32;pc_begin:(15,2),64,32;pc_range:(0,22),96,32;;fde:t(0,27)=(15,8)cie_info:T(0,28)=s20augmentation:(8,4),0,32;eh_ptr:(15,2),32,32;code_align:(0,1),64,32;data_align:(0,1),96,32;ra_regno:(0,4),128,32;;frame_state_internal:T(0,29)=s536s:(15,1),0,4256;saved_state:(0,30)=*(0,29),4256,32;;decode_uleb128:f(15,2)buf:P(0,31)=*(0,11)r:P(0,32)=*(0,4)decode_sleb128:f(15,2)buf:P(0,31)r:P(0,33)=*(0,1)unaligned:T(0,34)=u8p:(15,2),0,32;b2:(0,9),0,16;b4:(0,4),0,32;b8:(0,7),0,64;;fde_insert:f(0,19)array:P(0,35)=*(0,36)=*(0,27)i:P(14,2)this_fde:P(0,36)count_fdes:f(14,2)this_fde:P(0,36)add_fdes:f(0,19)this_fde:P(0,36)array:P(0,35)i_ptr:P(0,37)=*(14,2)beg_ptr:P(0,38)=*(15,2)end_ptr:P(0,38)frame_init:f(0,19)ob:P(15,10)find_fde:f(0,36)pc:P(15,2)extract_cie_info:f(15,2)f:P(0,36)c:P(0,39)=*(0,28)execute_cfa_insn:f(15,2)p:P(15,2)state:P(0,30)info:P(0,39)pc:P(0,38)__register_frame_info:F(0,19)begin:P(15,2)ob:P(15,10)__register_frame_info_table:F(0,19)begin:P(15,2)ob:P(15,10)__deregister_frame_info:F(0,19)begin:P(15,2)__frame_state_for:F(0,40)=*(15,1)pc_target:P(15,2)state_in:P(0,40)objects:S(15,10)   o -  7    A GMS{[44 `TT ellnt{TpphlF$,S')X$ )|\ 01;2,070701000077d1000081ed00000000000000000000000139d78c1600002470000000200000001d00000000000000000000001b00000000root/etc/STATsrv/bin/tst64ELF+ @0@8@@@X   00`/usr/lib/sparcv9/ld.so.18&3-)%2 (/67*1'45#,!.$+0"Xx    @ X              H   d%.3 I`PU mr  Tx  !  1 8 E  4JY  _ __1cH__CimplKcplus_fini6F_v__start_environ_end_GLOBAL_OFFSET_TABLE_atexitexit_get_exit_frame_monitorputs_init_ex_register64___Argv_DYNAMIC__1cG__CrunVdo_exit_code_in_range6Fpv1_v___1cG__CrunMdo_exit_code6F_v__ex_deregister64_exitenviron_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etext_lib_versionmain__environ_lock_fini__1cH__CimplKcplus_init6F_v_libc.so.1SUNW_0.7libc.so.1| =(X' `, P H7 * $ + `"#-% [`+p @ r`إ, @`+p ' \ఀ t+``+p ) -`- Ю `?- Ю =--% М#0@`+p  @! `*p  Z  `*p  Z 耐@@!@ @@P a*0 @P@[Z?Z?@@D|P@[][Z?Z Z]耤mainSolaris 64bit0o0o0o0o   x  oyo o`   oo 0P0Xx    @ X              HUh)  4  >Ebu     d ` 38  T> M[d   !     4%  + tst64crti.s_ex_shared0_cpp_finidata0_ex_range0_ex_text0crt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.ctst64.ccrtn.s_ex_shared1_ex_range1_ex_text1__1cH__CimplKcplus_fini6F_v__start_START__environ_end_GLOBAL_OFFSET_TABLE_atexitexit_get_exit_frame_monitorputs_init_ex_register64___Argv_END__DYNAMIC__1cG__CrunVdo_exit_code_in_range6Fpv1_v___1cG__CrunMdo_exit_code6F_v__ex_deregister64_exitenviron_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etext_lib_versionmain__environ_lock_fini__1cH__CimplKcplus_init6F_v_ <H4*@(#)stdio.h 1.69 98/07/13 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)isa_defs.h 1.16 99/05/25 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/30 SMIacomp: Sun WorkShop 6 2000/06/19 C 5.1 Patch 109491-02ld: Software Generation Utilities - Solaris-ELF (4.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.cpp_finidata.rela.data.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.cpp_finidata.data.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrtst64.cXa ; V=3.1 ; R=Sun WorkShop 6 2000/06/19 C 5.1 Patch 109491-02/usr/T; /opt/SUNWspro/bin/../WS6/bin/cc -xarch=v9 -c tst64.c -W0,-xpmainXX xxd @  o - `= @ @P X X0[ `e  k Tq  w      `HHP@/H(0 X6070701000077d5000081a40000000000000000000000014b609886000024da000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/x.EasySTAT<@-- * EasySTAT kit * """"""""""""""""""""""""""""""""""""""""""""""""" * part of dim_STAT tool * http://dimitrik.free.fr * * v.1.4 -- Mar.2009: added COMPRESS=gzip env and $STATS * v.1.5 -- Jun.2009: * -- added TIMER=yes env * -- new pid list of forked processes (ps -f) + ListPID() * v.1.6 -- Aug.2009: fixed ps tty error * v.1.7 -- Aug.2009: * -- if Hours is zero => loop forever & don't create a new directory.. * -- trap SIGTERM & SIGINT signals !! * -- trap SIGINT in <@shell> !! to disable Control-C break on start collect!! * -- Sep.2009: * -- all $BatchLOAD calls containing a full params in case a new collect should be created!! * -- SIGUSR1: switch LoadDATA.sh, then create a new one... * -- manage a possible interrup on <@sleep> !!! :-) * -- add .EasySTAT.pid file!! * -- check if there is another EasySTAT instance already running in the same $(Dir) !!! * v.1.8 -- Dec.2009: include hostname within a data file! * v.1.9 -- Jan.2010: add output Log option * -- added PID in trap messages (trace/debug) * -- added fflush on (require WebX v.7.8+) --@> <@VER>= "EasySTAT (dim) v.1.9" <@function> SigExit <@call> StopCollect <@if> filled Compress <@shell> $(Compress) $(Dir)/$(OutBase).* 2>&1 >/dev/null & *------------------------------------------------------------- * EXIT $(VER) #$(X_PID) // Terminated by Signal *------------------------------------------------------------- <@unlink> $(Dir)/.EasySTAT.pid <@quit> <@end> <@function> SigTrap( sig ) $(\n) * #$(X_PID) * !! Got Terminate Signal !! (#$(sig)) * """""""""""""""""""""""""""""""""""""" $(\n) <@GoExit>= yes <@if> !filled Starting <@call> SigExit <@end> <@function> SigSwitch <@GoSwitch>= yes <@end> <@function> WARNING( msg ) $(\n)##---------------------------------------------------------------- ## WARNING !!! ## $(msg) ##----------------------------------------------------------------$(\n) <@end> <@function> getHOST <@popen> pp "hostname" "r" sst <@if> $(sst) == 0 <@fgets> pp Host 200 sst <@pclose> pp <@end> <@function> InitCollect <@if> !exist "/etc/STATsrv/bin" <@error> ## STAT-service is not installed on this server!!! <@if> !exist "/etc/STATsrv/bin/x.Timer" <@error> ## Old version or STAT-service is not properly installed on this server!!! <@No>= 0 <@STATS>= {$(env:STATS)} <@if> !filled STATS <@error> ## No STATS given to collect!!! <@while> words STATS ";" <@CMD>= {$(STATS)} <@if> !filled CMD <@continue> <@No>++ <@while> words CMD "!" <@if> !filled Stat$(No)_Name <@set> Stat$(No)_Name $(CMD) <@set> Stat$(No)_CMD "$(CMD)" <@end> <@replace> Stat$(No)_CMD "%i" $(Timeout) <@end> <@if> !filled Stat1_Name <@error> ## Wrong STATS list: [$(STATS)] <@if> !filled Stat1_CMD <@error> ## Wrong STATS list: [$(STATS)] <@if> "$(Hours)" != 0 <@Dir>= "$(Dir)/$(dt2str:X_DT:yyyy_mm_dd).$(Host).$(X_PID)" <@shell> mkdir -p $(Dir) 2>&1 >/dev/null <@if> !exist $(Dir) <@error> ## Cannot create output Dir: $(Dir) <@NEW>= yes <@if> exist $(Dir)/.EasySTAT.pid <@fopen> fp $(Dir)/.EasySTAT.pid "r" sst <@fgets> fp buff 300 sst <@fclose> fp <@buff>= $(word:buff:1) <@if> exist /proc/$(buff) <@error> ## Be sure there is no other EasySTAT already running!!! check/remove $(Dir)/.EasySTAT.pid <@end> <@unlink> $(Dir)/.EasySTAT.pid <@file> $(Dir)/.EasySTAT.pid $(X_PID) <@end> <@end> <@function> SwitchLOAD <@if> exist $(Dir)/LoadDATA.sh <@shell> mv $(Dir)/LoadDATA.sh $(Dir)/LoadDATA.sh-saved-$(dt2str:X_DT:yyyy_mm_dd.hh_mi) <@end> <@function> AddLoad <@if> !filled NEW <@file> $(Dir)/LoadDATA.sh $BatchLOAD -cmd ADD -ID 0 -base $BASE -file `pwd`/$(Fname) -skip1 yes -host $HOST -title "$TITLE" -isec $(Timeout) -start $(dt2str:X_DT:yyyymmddhhmiss) <@end> <@return> 0 <@end> <@NEW>= "" <@TITLE>= "$(Title)" <@replace> TITLE " " "~" <@call> SwitchLOAD <@file> $(Dir)/LoadDATA.sh # -------------------------------------------------------------- # BatchLOAD script # auto-generated by $(VER) # $(dt2str:X_DT:yyyy-mm-dd hh:mi) # -------------------------------------------------------------- # Load parameters # -------------------------------------------------------------- BatchLOAD=$(Batch) BASE=$(Base) TITLE="$(TITLE)" HOST=$(Host) # Start Load # --------------------------------------------------------------- $BatchLOAD -cmd ADD -ID 0 -base $BASE -file `pwd`/$(Fname) -skip1 yes -title "$TITLE" -host $HOST -isec $(Timeout) -start $(dt2str:X_DT:yyyymmddhhmiss) <@end> <@end> <@function> ListPID( fname, ppid, pid, list ) <@pid>= "" <@list>= "" <@fopen> fptmp $(fname) "r" sst <@while> <@fgets> fptmp buff 400 sst <@if> $(sst) != 0 <@break> <@replace> buff "$(\t)" " " <@if> "$(word:buff:3)" == $(ppid) <@pid>= $(word:buff:2) <@if> exist /proc/$(pid) <@list>;= " $(pid)" <@end> <@end> <@fclose> fptmp <@pid>= "$(list)" <@while> words pid <@list>;= "$(call:ListPID( $(fname), $(pid) ))" <@end> <@return> "$(list)" <@end> <@-- Note: pid/ppid params are used just for safe local naming --@> <@function> RunCollect( pid, ppid ) <@OutBase>= "$(Host)_data.$(dt2str:X_DT:yyyy_mm_dd.hh@mi)" <@replace> OutBase "@" "H" * STAT Collect #$(Loop) ==> $(OutBase)... starting... <@No>= 0 <@while> <@No>++ <@if> !filled Stat$(No)_Name <@break> <@Fname>= "$(OutBase).$(Stat$(No)_Name)" <@unlink> $(Dir)/$(Fname) <@file> $(Dir)/$(Fname) ==> DTSET $(dt2str:X_DT:yyyy-mm-dd hh:mi:ss) ==> STAT $(Stat$(No)_Name) <@end> <@call> AddLoad <@shell> trap "" INT; { $(Stat$(No)_CMD) 2>/dev/null $(Timer) >> $(Dir)/$(Fname) & } ; sleep 1; ps -eo uid,pid,ppid,fname > $(Dir)/$(Fname).pid ; echo $$ > $(Dir)/$(Fname).ppid <@ppid>= "" <@fopen> fptmp $(Dir)/$(Fname).ppid "r" sst <@fgets> fptmp ppid 40 sst <@fclose> fptmp <@if> filled ppid <@pid>= "$(call:ListPID( $(Dir)/$(Fname).pid, $(ppid) ))" <@if> !filled pid <@call> WARNING( "Cannot identify PID for command: $(Stat$(No)_CMD) !!!" ) <@shell> rm $(Dir)/$(Fname).ppid ; echo "$(pid)" > $(Dir)/$(Fname).pid <@else> <@call> WARNING( "Cannot identify PPID for command: $(Stat$(No)_CMD) !!!" ) <@end> <@end> * STAT Collect #$(Loop) ==> processing... <@end> <@function> StopCollect <@No>= 0 <@while> <@No>++ <@if> !filled Stat$(No)_Name <@break> <@Fname>= "$(OutBase).$(Stat$(No)_Name)" <@pid>= "" <@fopen> fptmp $(Dir)/$(Fname).pid "r" sst <@fgets> fptmp pid 400 sst <@fclose> fptmp <@while> words pid <@shell> kill $(pid) > /dev/null 2>&1 <@end> <@unlink> $(Dir)/$(Fname).pid <@file> $(Dir)/$(Fname) $(\n)==> END <@end> <@end> <@end> <@function> MainLoop *------------------------------------------------------------- * $(VER) *------------------------------------------------------------- <@call> InitCollect Output DIR: $(Dir) Stat interval: $(Timeout) sec. Duration: $(Hours) hours *--------------: Title: $(Title) Host: $(Host) Base: $(Base) Batch: $(Batch) COMPRESS: $(Compress) TIMER: $(Timer) *------------------------------------------------------------- <@Loop>= 1 <@Sdt>= $(X_DT) <@if> "$(lower:Timer)" == yes <@Timer>= " | /etc/STATsrv/bin/Timer.sh $(Timeout) 2>/dev/null " <@-- Set a signal trap --@> <@option> signal SIGTERM SigTrap <@option> signal SIGINT SigTrap <@option> signal SIGUSR1 SigSwitch <@-- Main Loop --@> <@while> <@Sdt>+= 3600 <@Starting>= yes <@call> RunCollect <@if> $(Loop) == 1 <@shell> /etc/STATsrv/bin/sysinfo.sh 2>&1 > $(Dir)/SysINFO_$(Host)_$(dt2str:X_DT:YYYYMMDD_HHMI).html & <@Starting>= "" <@if> filled GoExit <@call> SigExit <@while> <@sleep> $(expr: $(Sdt) - $(X_DT)) <@-- Keep 1 hour interval --@> <@if> filled GoSwitch <@call> SwitchLOAD <@GoSwitch>= "" <@NEW>= yes <@end> <@if> $(expr: $(Sdt) - $(X_DT)) like "-*" <@break> <@end> <@call> StopCollect <@if> filled Compress <@shell> $(Compress) $(Dir)/$(OutBase).* 2>&1 >/dev/null & <@if> "$(Hours)" != 0 <@if> icmp $(Loop) >= $(Hours) <@break> <@end> <@Loop>++ <@end> *------------------------------------------------------------- * EXIT $(VER) *------------------------------------------------------------- <@unlink> $(Dir)/.EasySTAT.pid <@end> <@if> !filled Timeout <@Timeout>= 15 <@if> !filled Base <@Base>= EasySTAT <@if> !filled Host <@call> getHOST <@if> !filled Host <@Host>= Host.$(X_PID) <@if> !filled Title <@Title>= "EasySTAT Collect $(dt2str:X_DT:YYYY-MM-DD)-#$(X_PID)" <@if> !filled Batch <@Batch>= "/apps/ADMIN/BatchLOAD" <@if> !filled Hours <@Hours>= 8 <@if> !filled Dir <@Dir>= "/var/tmp" <@if> !filled Log <@Log>= [$(env:LOG)] <@if> !filled Compress <@Compress>= [$(env:COMPRESS)] <@if> !filled Timer <@Timer>= [$(env:TIMER)] <@if> icmp $(X_VERSION)0 < 7800 <@error> "You need WebX v.7.8 or higher to run this code correctly..." <@if> filled Log ** $(VER) : all output is sent to $(Log) <@file> $(Log) <@option> fflush on <@call> MainLoop <@end> <@else> <@call> MainLoop <@end> 070701000077d8000081a40000000000000000000000013c45f81b0000053a000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/x.SysINFO<@SysInfo>= {$(env:SYSINFO)} <@if> !filled SysInfo <@error> SYSINFO is empty!
$(dt2str:X_DT:yyyy-mm-dd hh:mi)

<@popen> pp "hostname" "r" sst <@fgets> pp uname 200 sst <@pclose> pp

SysINFO: $(uname)

<@popen> pp "uname -a" "r" sst <@fgets> pp uname 200 sst <@pclose> pp $(uname)

<@Ref>= $(X_DT)_$(X_PID) <@No>= 1
    <@while> words SysInfo ";" <@Name>= "" <@Command>= "" <@while> words SysInfo "!" <@Command>= {$(SysInfo)} <@if> !filled Name <@Name>= {$(SysInfo)} <@end>
  • $(Name) <@No>++ <@end>

<@No>= 1 <@while> words SysInfo ";" <@Name>= "" <@Command>= "" <@while> words SysInfo "!" <@Command>= {$(SysInfo)} <@if> !filled Name <@Name>= {$(SysInfo)} <@end>

$(Name)

  <@popen> pp "$(Command)" "r" sst
  <@while>
    <@fgets> pp buff 500 sst
    <@if> $(sst) != 0  <@break>
$(buff)
  <@end>
  <@pclose> pp
  <@No>++
<@end> 070701000077d9000081a40000000000000000000000013b36563c00000616000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/x.T3stat<@function> OpenSTAT( pno, name ) <@if> $(name) like "*@*" <@User>= "" <@Passwd>= "" <@while> words name "@" <@T3_Name$(pno)>= "$(name)" <@if> !filled User <@while> words name ":" <@if> !filled User <@User>= "$(name)" <@Passwd>= "$(name)" <@end> <@end> <@end> <@else> <@User>= "$(DefaultUSER)" <@Passwd>= "$(DefaultPASSWD)" <@T3_Name$(pno)>= "$(name)" <@end> <@popen> pp$(pno) "T3stat -l $(User) -p $(Passwd) -i $(Timeout) -r $(T3_Name$(pno))" "r" sst <@fgets> pp$(pno) buff 400 sst <@if> $(sst) != 0 <@error> Cannot get STAT(s) from $(T3_Name$(pno))!... <@end> <@function> PrintSTAT( pno ) <@while> <@fgets> pp$(pno) buff 400 sst <@if> $(sst) != 0 <@error> Broken STAT(s) connection to $(T3_Name$(pno))!... <@if> icmp $(len:buff) < 5 <@continue> <@replace> buff "$(\n)" "" <@if> "$(buff)" like "*Read*" <@if> !filled Header <@Header>= "$(buff)" <@continue> <@end> $(T3_Name$(pno))$(\t)$(buff) <@break> <@end> <@end> <@chdir> $(DIR) <@T3names>= "$(env:T3names)" <@DefaultUSER>= $(env:DefaultUSER) <@DefaultPASSWD>= $(env:DefaultPASSWD) <@if> !filled T3names <@error> No T3 names given!... <@if> !filled Timeout <@error> No Timeout given!... <@Header>= "" <@No>= 1 <@while> words T3names " ," <@call> OpenSTAT( $(No), "$(T3names)" ) <@No>++ <@end> <@while> $(\n)Name $(Header) <@No>= 1 <@while> <@if> !filled T3_Name$(No) <@break> <@call> PrintSTAT( $(No) ) <@No>++ <@end> <@end> 070701000077db000081a40000000000000000000000014a3177410000035e000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/x.Timer<@-- * * EasySTAT (dim) Timer * =================================================== * Timer logic: * - if time difference between 2 lines output is higher than Max: ==> DTSET to sync time! * - if time difference between 2 lines output is higher than Min: ...: print time * * v.1.0 -- Jun.2009 * --@> <@if> !filled Timeout <@error> ## Timeout is not filled !!! <@Min>= $(Timeout) <@Min>/= 2 <@if> $(Min) == 0 <@Min>= 1 <@Max>= $(expr: $(Timeout)*2) <@Last>= $(X_DT) <@while> <@fgets> stdin buff 600 sst <@if> $(sst) != 0 <@break> <@Curr>= $(X_DT) <@Diff>= $(expr: $(Curr) - $(Last)) <@if> icmp $(Diff) > $(Max) <> ==> DTSET $(dt2str:Curr:yyyy-mm-dd hh:mi:ss) ==> LOGMSG WARNING: Timer data resync!! <@end> <@if> icmp $(Diff) > $(Min) <<$(dt2str:Curr:hh:mi:ss)>> <@end> $(buff) <@Last>= $(Curr) <@end> 070701000077dd000081a40000000000000000000000014bb981460000074c000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/x.UDPstat<@-- UDP Traffic Monitoring for dim_STAT (dim) v.1.0 Jan.2010 --@> <@Empty>= "none 0 0 0 $(\n)" <@function> setVAL( name, val ) <@if> name vlike "*tcp*" <@return> 0 <@if> Names vlike " *$(name)* " <@return> 0 <@Names>;= " $(name) " <@set> $(name)_Val $(val) <@if> !filled $(name)_Val_prev <@set> $(name)_Val_prev $(val) <@if> $(expr: $($(name)_Val) - $($(name)_Val_prev)) like "-*" <@set> $(name)_Val_prev $($(name)_Val) <@return> 0 <@end> <@function> getSTAT <@-- # netstat -s | grep -i udp UDP udpInDatagrams =254621339 udpInErrors = 0 udpOutDatagrams =228512263 udpOutErrors = 0 tcpInErrs = 0 udpNoPorts =1130659 udpInCksumErrs = 21770 udpInOverflows =46245996 udpInCksumErrs = 0 udpInOverflows = 0 # --@> <@Names>= "" <@popen> pp { netstat -s | grep -i udp } "r" sst <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> icmp $(len:buff) < 5 <@break> <@replace> buff "$(\t)" " " <@replace> buff "UDP" "" <@replace> buff "=" " " <@call> setVAL( $(word:buff:1), $(word:buff:2 ) ) <@call> setVAL( $(word:buff:3), $(word:buff:4 ) ) <@end> <@pclose> pp <@end> <@chdir> $(DIR) <@if> !filled Timeout <@Timeout>= 10 <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@while> <@call> getSTAT UDP-stat Tot# Delta Val/s <@while> words Names <@Line>= "$(Names) " <@v1>= $($(Names)_Val) <@v2>= $(expr: ($($(Names)_Val) - $($(Names)_Val_prev))) <@v3>= $(expr: $(v2) / $(Timeout).0 ) $(printf:%-20s:Names) $(printf:%10d:v1) $(printf:%7d:v2) $(printf:%10.2f:v3) <@set> $(Names)_Val_prev $($(Names)_Val) <@end> $(Empty) <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 070701000077de000081a400000000000000000000000148650313000001da000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/x.chldPID<@function> ListCHLDS( PID ) <@popen> pp_chlds$(PID) "ps -e -o pid,ppid,args" "r" sst <@if> $(sst) != 0 <@return> -1 <@while> <@fgets> pp_chlds$(PID) buff 200 sst <@if> $(sst) != 0 <@break> <@if> "$(word:buff:2)" == $(PID) <@set> chld_$(PID) $(word:buff:1) <@call> ListCHLDS( $(chld_$(PID)) ) $(chld_$(PID)) --> $(PID) <@end> <@end> <@pclose> pp_chlds$(PID) <@end> <@if> !filled PID <@error> ### PID is not filled! <@call> ListCHLDS( $(PID) ) 070701000077df000081a40000000000000000000000013aa7bf34000004a2000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/x.harSTAT<@if> !filled Timeout <@error> ### Timeout is not filled... <@popen> pp "har 1" "r" sst <@if> $(sst) != 0 <@error> ### Cannot pipe har... <@Name>= "mips bus cpi dcm icm ecm dsr isr fsr bsr" <@function> getVALS <@if> $(No) == 1 <@no>= 1 <@while> words Name <@set> $(Name) $(word:buff:$(no)) <@no>++ <@end> <@return> <@end> <@no>= 1 <@while> words Name <@set> $(Name) $(expr: $($(Name)) + $(word:buff:$(no))) <@no>++ <@end> <@end> <@function> printVALS <@if> !filled Hdr <@Hdr>= 1 <@if> $(Hdr) == 1 mips bus cpi dcm icm ecm dsr isr fsr bsr <@end> <@Hdr>= $(expr: ($(Hdr) + 1) % 20) <@no>= 1 <@Line>= "" <@while> words Name <@Val>= "$(expr: $($(Name)) / $(Timeout).0)" <@Line>= "$(Line) $(printf:%7.2f:Val)" <@no>++ <@end> $(Line) <@end> <@while> <@No>= 1 <@while> <@fgets> pp buff 200 sst <@if> $(sst) != 0 <@pclose> pp <@quit> <@end> <@if> {$(buff)} like "*mips*" <@continue> <@call> getVALS <@if> $(No) == $(Timeout) <@break> <@No>++ <@end> <@call> printVALS <@end> 070701000077e3000081a40000000000000000000000013aed8d9f0000055a000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/x.harSTATus3<@if> !filled Timeout <@error> ### Timeout is not filled... <@popen> pp "har 1" "r" sst <@if> $(sst) != 0 <@error> ### Cannot pipe har... <@Name>= "mips bus mflops cpi dcm icm ecm itlb dtlb brr mbr dsr isr fsr bsr" <@function> getVALS <@if> $(No) == 1 <@no>= 1 <@while> words Name <@set> $(Name) $(word:buff:$(no)) <@if> $($(Name)) == NaN <@set> $(Name) -$(Timeout) <@no>++ <@end> <@return> <@end> <@no>= 1 <@while> words Name <@if> $(word:buff:$(no)) == NaN <@continue> <@set> $(Name) $(expr: $($(Name)) + $(word:buff:$(no))) <@no>++ <@end> <@end> <@function> printVALS <@if> !filled Hdr <@Hdr>= 1 <@if> $(Hdr) == 1 mips bus mflops cpi dcm icm ecm itlb dtlb brr mbr dsr isr fsr bsr <@end> <@Hdr>= $(expr: ($(Hdr) + 1) % 20) <@no>= 1 <@Line>= "" <@while> words Name <@Val>= $(expr: $($(Name)) / $(Timeout).0) <@Line>;= " $(printf:%6.1f:Val)" <@no>++ <@end> $(Line) <@end> <@while> <@No>= 1 <@while> <@fgets> pp buff 300 sst <@if> $(sst) != 0 <@pclose> pp <@quit> <@end> <@if> {$(buff)} like "*mips*" <@continue> <@replace> buff "$(\t)" " " <@call> getVALS <@if> $(No) == $(Timeout) <@break> <@No>++ <@end> <@call> printVALS <@end> 070701000077e5000081a40000000000000000000000014a2fa9d100000565000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/x.harSTATv2<@if> !filled Timeout <@error> ### Timeout is not filled... <@popen> pp "har2 1" "r" sst <@if> $(sst) != 0 <@error> ### Cannot pipe har... <@Name>= "mips bus mflops cpi dcm icm ecm itlb dtlb brr mbr dsr isr fsr bsr" <@function> getVALS <@if> $(No) == 1 <@no>= 1 <@while> words Name <@set> $(Name) $(word:buff:$(no)) <@if> $(Name) vlike "*NaN*" <@set> $(Name) -$(Timeout) <@no>++ <@end> <@return> <@end> <@no>= 1 <@while> words Name <@if> $(word:buff:$(no)) like "*NaN*" <@continue> <@set> $(Name) $(expr: $($(Name)) + $(word:buff:$(no))) <@no>++ <@end> <@end> <@function> printVALS <@if> !filled Hdr <@Hdr>= 1 <@if> $(Hdr) == 1 mips bus mflops cpi dcm icm ecm itlb dtlb brr mbr dsr isr fsr bsr <@end> <@Hdr>= $(expr: ($(Hdr) + 1) % 20) <@no>= 1 <@Line>= "" <@while> words Name <@Val>= $(expr: $($(Name)) / $(Timeout).0) <@Line>;= " $(printf:%6.1f:Val)" <@no>++ <@end> $(Line) <@end> <@while> <@No>= 1 <@while> <@fgets> pp buff 300 sst <@if> $(sst) != 0 <@pclose> pp <@quit> <@end> <@if> {$(buff)} like "*mips*" <@continue> <@replace> buff "$(\t)" " " <@call> getVALS <@if> $(No) == $(Timeout) <@break> <@No>++ <@end> <@call> printVALS <@end> 070701000077e7000081a40000000000000000000000014a2f8eb400000e60000000200000001d00000000000000000000002400000000root/etc/STATsrv/bin/x.innodbIOSTAT<@-- * InnoDB IOSTAT * """"""""""""""""""""""""""""""""" * source: http://blogs.sun.com/realneel/entry/inniostat_innodb_io_statistics * * Adoption for dim_STAT by Dimitri (dim) KRAVTCHUK * added features: * -- autocheck for a new mysqld * -- print zeros if there is no mysqld running * -- print an online flag! * v.1.3 * * LICENSE: GPLv2 --@> <@-- # These values are hardcoded from Innodb sources. --@> <@set> OS_FILE_READ 10 <@set> OS_FILE_WRITE 11 <@set> OS_FILE_LOG 256 <@set> OS_AIO_SIMULATED_WAKE_LATER 512 <@VER>= v.1.3 <@function> CheckPID( pid ) <@popen> ppPID "pgrep -n mysqld" "r" sst <@pid>= "" <@fgets> ppPID pid 64 sst <@pclose> ppPID <@if> !filled pid <@return> -1 <@return> $(pid) <@end> <@function> OpenPIPE( pid, interval, fname ) <@fname>= /tmp/innodbIO.$(X_PID) <@unlink> $(fname) <@file> $(fname) #pragma D option destructive dtrace:::BEGIN { reads = 0; writes = 0; wlog = 0; wdbl = 0; wother = 0; rprefetch = 0; rnormal = 0; calc_read = 0; rrs = 0; rws = 0; to_print = 0; } pid$(pid)::fil_io:entry { self->is_log = arg0 & $(OS_FILE_LOG); self->type = arg0 & ~$(OS_AIO_SIMULATED_WAKE_LATER) & ~$(OS_FILE_LOG); self->read = (self->type == $(OS_FILE_READ)) ? 1 : 0; self->write = (self->type == $(OS_FILE_WRITE)) ? 1 : 0; reads += self->read ? 1 : 0; writes += self->write ? 1 : 0; wlog += (self->is_log && self->write) ? 1 : 0; wdbl += (self->write && !self->is_log && (arg1 != 0)) ? 1 : 0; wother += (self->write && !self->is_log && (arg1 == 0)) ? 1 : 0; rprefetch += (self->read && (arg1 == 0)) ? 1 : 0; rnormal += (self->read && (arg1 != 0)) ? 1 : 0; } io:::start { rrs += args[0]->b_flags & B_READ ? 1 : 0; rws += args[0]->b_flags & B_WRITE ? 1 : 0; } tick-$(interval)sec { printf("%6d %6d %6d %6d %6d %6d %6d %6d %6d\n", rrs/$(interval), rws/$(interval), reads/$(interval), writes/$(interval), rnormal/$(interval), rprefetch/$(interval), wlog/$(interval), wdbl/$(interval), wother/$(interval)); reads = 0; writes = 0; wlog = 0; wdbl = 0; wother = 0; rprefetch = 0; rnormal = 0; calc_read = 0; rrs = 0; rws = 0; } <@end> <@popen> pp "/usr/sbin/dtrace -qs $(fname) 2>/dev/null" "r" sst <@if> $(sst) != 0 <@return> -1 <@return> 0 <@end> <@function> PrintLINE( line, online ) <@if> !filled Head <@Head>= 0 <@if> $(expr: $(Head) % 20) == 0 __physical__ ___Innodb___ ___read/s___ _____write/s_____ On r/s w/s r/s w/s data pre log dblbuf dflush Line <@Head>= 0 <@end> <@Head>++ <@if> !filled line <@line>= " 0 0 0 0 0 0 0 0 0" <@online>= 0 <@if> filled PID <@if> $(PID) != -1 <@online>= 1 <@end> $(line) $(online) <@if> filled fname <@unlink> $(fname) <@end> <@function> Usage( err ) $(X_PAGE) $(VER) ERROR: $(err)$(\n) Usage: # WebX $(X_PAGE) -Timeout N <@end> <@if> !exist /usr/sbin/dtrace <@error> ## DTrace binary is not found!! <@if> !filled Timeout <@error> ## Not filled Timeout!! <@if> icmp $(Timeout) < 1 <@error> ## Bad Timeout value: $(Timeout) <@-- MAIN LOOP --@> <@while> <@PID>= $(call:CheckPID) <@if> $(PID) == -1 <@call> PrintLINE <@sleep> $(Timeout) <@continue> <@end> <@if> $(call:OpenPIPE( $(PID), $(Timeout) )) == -1 <@call> PrintLINE <@sleep> $(Timeout) <@continue> <@end> <@CurrPID>= $(PID) <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@pclose> pp <@break> <@end> <@call> PrintLINE( "$(buff)" ) <@PID>= $(call:CheckPID) <@if> $(CurrPID) != $(PID) <@pclose> pp <@break> <@end> <@end> <@end> 070701000077ee000081a40000000000000000000000014babc65d00003a75000000200000001d00000000000000000000002200000000root/etc/STATsrv/bin/x.innodbSTAT<@-- (dim) MySQL InnoDB stats ** v.1.0 -- primary version Dec.2008 ** v.1.1 -- primary version Jan.2009 +MB/s ** v.1.2 -- primary version Jan.2009 +Pool hit rate +Insert buffers ** v.1.3 -- add env:MYSQL_CONNECT ** v.1.4 -- adopted to double-num-32bit log sequence ** v.1.5 -- add self-connection option (env: USER=.., PASSWD=.., HOST=host:port) ** v.1.6 -- fix connection loss trap!! Apr.2009 ** v.1.7 -- add server OnLine value ** v.1.8 -- seems LRU stats are not implemented on all InnoDB versions, so commented! -- disconnect on error !!! -- hash index buffers/cells fixed for 5.1 / 5.0 ** v.1.9 -- History Len + DML delay (dim) Jun.2009 ** v.1.10 - Purge + FLush extentions (dim) Aug.2009 ** v.2.0 -- Code redesigned in Stat sections (dim) Nov.2009 -- as not every engine print status in the same order! ** v.2.1 -- dicsard all values when DB is set offline (dim) Nov.2009 ** v.2.2 -- (dim) Mar.2010 -- check mysql version! -- the syntax was changed since mysql 5.5 !! -- removed (commented) MYSQL_CONNECT code ** v.2.3 -- adoptions for innodb 1.1 -- NEXT_LINE check --@> <@VER>= v.2.2 <@if> icmp $(X_VERSION)0 < 7300 <@error> You need WebX v.7.3 or higher to make work this code correctly.. <@function> Trap_SQLERR <@ERR>= 1 <@end> <@-- Check DB version, value is not a parameter, but safe variable --@> <@function> CheckDB( value ) <@ERR>= "" <@value>= "" <@InnoQuery>= "" <@sql> show variables like 'version'; <@end> <@if> filled ERR <@sqlexec> disconnect; <@return> -1 <@end> <@-- Since MySQL 5.5 the syntax was changed!.. --@> <@replace> value "." " " <@if> icmp $(word:value:1) >= 5 <@if> icmp $(word:value:2) >= 5 <@InnoQuery>= "show engine innodb status;" <@return> 0 <@end> <@end> <@InnoQuery>= "show innodb status;" <@return> 0 <@end> <@function> NextLINE <@NEXT_LINE>= "" <@fgets> pp NEXT_LINE 500 sst <@end> <@function> ScanData( match ) <@while> <@if> filled NEXT_LINE <@buff>= "$(NEXT_LINE)" <@NEXT_LINE>= "" <@else> <@fgets> pp buff 500 sst <@if> $(sst) != 0 <@break> <@end> <@replace> buff "," " " <@replace> buff ";" " " <@if> buff vlike "$(match)" <@return> 0 <@end> <@buff>= "0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0" <@-- If line is missing, server is probably offline.. --@> <@OnLine>= 0 <@return> -1 <@end> <@function> PrintLine( name, val ) $(printf:%-30s:name) $(val) <@end> <@function> SetVal( name, diff, desc, value ) <@if> value vlike "-*" <@value>= -2 <@if> !filled $(name)_NAME <@set> $(name)_NAME "$(desc)" <@set> $(name)_DIFF "$(diff)" <@AllStats>;= " $(name)" <@end> <@set> $(name) $(value) <@end> <@function> PrintStats <@call> PrintLine( $(\n)STAT-name, STAT-value ) <@call> PrintLine( db-server-online, $(OnLine) ) <@while> words AllStats <@if> "$($(AllStats)_DIFF)" != 1 <@call> PrintLine( "$($(AllStats)_NAME)", $($(AllStats)) ) <@continue> <@end> <@call> PrintLine( "$($(AllStats)_NAME)", $($(AllStats)) ) <@if> !filled $(AllStats)_prev <@set> $(AllStats)_prev $($(AllStats)) <@if> $(expr: $($(AllStats)) - $($(AllStats)_prev) - 0.0) like "-*" <@set> $(AllStats)_prev $($(AllStats)) <@call> PrintLine( "$($(AllStats)_NAME)/sec", $(expr: ($($(AllStats)) - $($(AllStats)_prev))/$(Timeout).0 ) ) <@set> $(AllStats)_prev $($(AllStats)) <@end> <@end> <@function> GetData_TRANSACTIONS <@call> ScanData( "History list*" ) <@call> SetVal( Hist_len, 0, "History-len", $(word:buff:4) ) <@end> <@function> GetData_SEMAPHORES <@call> ScanData( "OS*WAIT*ARRAY*" ) <@call> SetVal( WT_ARR_res, 1, "Wait-Array-reservations", $(word:buff:7) ) <@call> SetVal( WT_ARR_sig, 1, "Wait-Array-signals", $(word:buff:10) ) <@call> ScanData( "Mutex*spin*waits*" ) <@call> SetVal( MTX_spins, 1, "Mutex-spin-waits", $(word:buff:4) ) <@call> SetVal( MTX_rounds, 1, "Mutex-rounds", $(word:buff:6) ) <@call> SetVal( MTX_os, 1, "Mutex-OS-waits", $(word:buff:9) ) <@call> ScanData( "RW-shared*spins*" ) <@call> SetVal( RWS_spins, 1, "RW-shared-spins", $(word:buff:3) ) <@call> SetVal( RWS_os, 1, "RW-shared-OS-waits", $(word:buff:6) ) <@call> SetVal( RWE_spins, 1, "RW-excl-spins", $(word:buff:9) ) <@call> SetVal( RWE_os, 1, "RW-excl-OS-waits", $(word:buff:12) ) <@end> <@function> GetData_FILE_IO <@call> ScanData( "*OS file reads*" ) <@call> SetVal( OS_read, 1, "OS-file-reads", $(word:buff:1) ) <@call> SetVal( OS_write, 1, "OS-file-writes", $(word:buff:5) ) <@call> SetVal( OS_fsync, 1, "OS-fsyncs", $(word:buff:9) ) <@end> <@function> GetData_INSERT_BUFFER <@call> ScanData( "Ibuf: size*" ) <@call> SetVal( IBUF_size, 0, "Insert-Buffer-size", $(word:buff:3) ) <@call> SetVal( IBUF_flen, 0, "Insert-Buffer-free-len", $(word:buff:7) ) <@call> SetVal( IBUF_sgsize, 0, "Insert-Buffer-seg-size", $(word:buff:10) ) <@-- InnoDB 1.1* --@> <@zz>= $(word:buff:11) <@if> filled zz <@call> SetVal( IBUF_merges, 0, "Insert-Buffer-merges", $(zz) ) <@call> NextLINE <@if> NEXT_LINE vlike "*inserts*" <@-- Innodb 1.0.* --@> <@call> ScanData( "*inserts*" ) <@call> SetVal( IBUF_ins, 0, "Insert-Buffer-inserts", $(word:buff:1) ) <@call> SetVal( IBUF_mrec, 0, "Insert-Buffer-merged-recs", $(word:buff:3) ) <@call> SetVal( IBUF_merges, 0, "Insert-Buffer-merges", $(word:buff:6) ) <@end> <@call> ScanData( "Hash table*" ) <@call> SetVal( HIDX_size, 0, "Hash-Index-size", $(word:buff:4) ) <@if> buff vlike "* cells *" <@call> SetVal( HIDX_ncell, 0, "Hash-Index-cells", $(word:buff:7) ) <@call> SetVal( HIDX_nbuff, 0, "Hash-Index-buffers", $(word:buff:11) ) <@else> <@call> SetVal( HIDX_nbuff, 0, "Hash-Index-buffers", $(word:buff:8) ) <@end> <@end> <@function> GetData_LOG <@call> ScanData( "*Log sequence *" ) <@L1>= $(word:buff:4) <@L0>= $(word:buff:5) <@if> filled L0 <@L1>= $(expr: $(L1) * 4294967296.0 + $(L0)) <@call> ScanData( "*Log flushed *" ) <@L2>= $(word:buff:5) <@L0>= $(word:buff:6) <@if> filled L0 <@L2>= $(expr: $(L2) * 4294967296.0 + $(L0)) <@call> ScanData( "*Last checkpoint *" ) <@L3>= $(word:buff:4) <@L0>= $(word:buff:5) <@if> filled L0 <@L3>= $(expr: $(L3) * 4294967296.0 + $(L0)) <@call> SetVal( LOG_age, 0, "Log-age", $(expr: 0.00 + $(L1) - $(L2)) ) <@call> SetVal( LOG_ageMB, 0, "Log-age-MB", $(expr: (0.00 + $(L1) - $(L2))/1024/1024 ) ) <@call> SetVal( CHK_age, 0, "Checkpoint-age", $(expr: 0.00 + $(L1) - $(L3)) ) <@call> SetVal( CHK_ageMB, 0, "Checkpoint-age-MB", $(expr: (0.00 + $(L1) - $(L3))/1024/1024 ) <@call> ScanData( "* log * done*" ) <@call> SetVal( LOG_io, 1, "Log-writes", $(word:buff:1) ) <@call> SetVal( LOG_MB, 1, "Log-writes-MB", $(expr: $(L1)/1024/1024.0) ) <@end> <@function> GetData_BUFFER_POOL <@call> ScanData( "Total memory*" ) <@call> SetVal( Tot_mem, 0, "Total-memory-MB", $(expr:$(word:buff:4)/1024/1024) ) <@call> SetVal( Add_pool, 0, "Additional-pool-MB", $(expr:$(word:buff:9)/1024/1024) ) <@call> ScanData( "Dictionary memory*" ) <@call> SetVal( Dict_mem, 0, "Dictionary-memory-KB", $(expr:$(word:buff:4)/1024) ) <@call> ScanData( "Buffer pool*" ) <@call> SetVal( Buff_pool, 0, "Buffer-pool-size", $(word:buff:4) ) <@call> ScanData( "Free*" ) <@call> SetVal( Buff_free, 0, "Free-buffers", $(word:buff:3) ) <@call> ScanData( "Database*" ) <@call> SetVal( Buff_data, 0, "Database-pages", $(word:buff:3) ) <@call> NextLINE <@if> NEXT_LINE vlike "Old*" <@call> SetVal( Buff_old, 0, "Old-db-pages", $(word:NEXT_LINE:4) ) <@NEXT_LINE>= "" <@end> <@call> ScanData( "Modified*" ) <@call> SetVal( Buff_modif, 0, "Modified-db-pages", $(word:buff:4) ) <@call> ScanData( "Pages read*" ) <@call> SetVal( Pages_r, 1, "Pages-read", $(word:buff:3) ) <@call> SetVal( Pages_c, 1, "Pages-create", $(word:buff:5) ) <@call> SetVal( Pages_w, 1, "Pages-write", $(word:buff:7) ) <@call> ScanData( "*uffer pool*" ) <@if> buff vlike "Buffer*" <@call> SetVal( Buff_hit, 0, "Buffer-pool-hit", $(expr: $(word:buff:5) * 100.0 / $(word:buff:7) ) ) <@else> <@call> SetVal( Buff_hit, 0, "Buffer-pool-hit", 0 ) <@end> <@-- Seems to be not implemented on every engine implementation... <@call> ScanData( "LRU len*" ) <@call> SetVal( LRU_len, 0, "LRU-len", $(word:buff:3) ) <@call> SetVal( LRU_zlen, 0, "LRU-unzip-len", $(word:buff:6) ) --@> <@end> <@function> GetData_ROW_OPERATIONS <@call> ScanData( "*queries inside*" ) <@call> SetVal( Q_inside, 0, "Queries-inside", $(word:buff:1) ) <@call> SetVal( Q_queue, 0, "Queries-in-queue", $(word:buff:5) ) <@call> ScanData( "Number of rows*" ) <@call> SetVal( Rows_ins, 1, "Rows-insert", $(word:buff:5) ) <@call> SetVal( Rows_upd, 1, "Rows-update", $(word:buff:7) ) <@call> SetVal( Rows_del, 1, "Rows-delete", $(word:buff:9) ) <@call> SetVal( Rows_sel, 1, "Rows-read", $(word:buff:11) ) <@end> <@function> GetData_PURGE <@call> ScanData( "History len*" ) <@call> SetVal( Hist_len, 0, "History-len", $(word:buff:3) ) <@call> ScanData( "DML Delay*" ) <@call> SetVal( DML_delay, 0, "DML-delay", $(word:buff:3) ) <@call> SetVal( DML_delay_max, 0, "DML-delay-max", $(word:buff:5) ) <@call> SetVal( DML_delayed, 1, "DML-delayed", $(word:buff:7) ) <@call> ScanData( "Purge calls:*" ) <@call> SetVal( Purge_calls, 1, "Purge-calls", $(word:buff:3) ) <@call> SetVal( Purge_exec, 1, "Purge-exec", $(word:buff:5) ) <@call> SetVal( Purge_sleeps, 1, "Purge-sleeps", $(word:buff:7) ) <@call> SetVal( Purged_pages, 1, "Purged-pages", $(word:buff:9) ) <@call> ScanData( "Flush calls:*" ) <@call> SetVal( Flush_calls, 1, "Flush-calls", $(word:buff:3) ) <@call> SetVal( Flush_exec, 1, "Flush-exec", $(word:buff:5) ) <@call> SetVal( Flushed_pages, 1, "Flushed-pages", $(word:buff:7) ) <@call> ScanData( "Called-by *" ) <@call> SetVal( Flush_recv_calls, 1, "Flush-calls@recovery", $(word:buff:3) ) <@call> SetVal( Flush_redo_calls, 1, "Flush-calls@redolog", $(word:buff:5) ) <@call> SetVal( Flush_LRU_calls, 1, "Flush-calls@LRU", $(word:buff:7) ) <@call> SetVal( Flush_master_calls, 1, "Flush-calls@master", $(word:buff:9) ) <@call> SetVal( Flush_ahead_calls, 1, "Flush-calls@ahead", $(word:buff:11) ) <@call> SetVal( Flush_dirtypct_calls, 1, "Flush-calls@dirty-pct", $(word:buff:13) ) <@end> <@function> DescSTAT( name, patt, func ) <@add> STAT $(name) <@set> $(name)_PATT "$(patt)" <@set> $(name)_FUNC $(func) <@end> <@function> GetInit <@clear> STAT* <@call> DescSTAT( TRX, "TRANSACTIONS*", GetData_TRANSACTIONS ) <@call> DescSTAT( SEM, "SEMAPHORES*", GetData_SEMAPHORES ) <@call> DescSTAT( FILE_IO, "FILE I/O*", GetData_FILE_IO ) <@call> DescSTAT( INS_BUFF, "INSERT BUFFER*", GetData_INSERT_BUFFER ) <@call> DescSTAT( LOG, "LOG*", GetData_LOG ) <@call> DescSTAT( POOL, "BUFFER POOL*", GetData_BUFFER_POOL ) <@call> DescSTAT( ROW_OP, "ROW OPERATIONS*", GetData_ROW_OPERATIONS ) <@call> DescSTAT( PURGE, "PURGE STATUS*", GetData_PURGE ) <@end> <@function> GetData <@call> ScanData( "-----*" ) <@while> <@fgets> pp buff 500 sst <@if> $(sst) != 0 <@break> <@while> values STAT <@if> buff vlike "$($(STAT)_PATT)" <@-- debug: ==> $(STAT) --@> <@call> $($(STAT)_FUNC) <@break> <@end> <@end> <@end> <@if> $(OnLine) == 1 <@return> 0 <@-- Discard all values if DB is offline --@> <@while> words AllStats <@clear> "$(AllStats)*" <@end> <@clear> AllStats <@return> -1 <@end> <@function> Usage( err ) $(\n)innodbSTAT (dim) $(VER) ## ERROR: $(err) $(\n) Usage: $ WebX.mySQL5 $(X_PAGE) -Timeout Nsec -Host server:port -User user -Passwd password NOTE: values also may be given as env variables Example: $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat -Passwd SecretPass or: $ Passwd=SecretPass $ export Passwd $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat <@-- $(\n)innodbSTAT (dim) $(VER) ## ERROR: $(err) $(\n) Usage: $ WebX $(X_PAGE) -Timeout N -MYSQL_CONNECT "MySQL client connect string.." or: $ WebX.mySQL5 $(X_PAGE) -Timeout N -Host server:port -User user -Passwd password NOTE: values also may be given as env variables Example: $ WebX $(X_PAGE) -Timeout 10 -MYSQL_CONNECT "/usr/bin/mysql -S /tmp/sock.mysql" or: $ MYSQL_CONNECT="/usr/bin/mysql -S /tmp/sock.mysql" $ export MYSQL_CONNECT $ WebX $(X_PAGE) -Timeout 10 or: $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat -Passwd SecretPass or: $ Passwd=SecretPass $ export Passwd $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat --@> <@quit> <@end> <@function> Loop_MYSQL_CONNECT <@-- ** Loop if MYSQL_CONNECT ** --@> <@if> $(X_PROG) == WebX <@if> !filled MYSQL_CONNECT <@MYSQL_CONNECT>= [$(env:MYSQL_CONNECT)] <@if> !filled MYSQL_CONNECT <@call> Usage( " is not filled!" ) <@while> <@popen> pp [ echo "show innodb status \\G" | $(MYSQL_CONNECT) ] "r" sst <@if> $(sst) != 0 <@call> Usage( [Cannot start $(MYSQL_CONNECT)] ) <@OnLine>= 1 <@call> GetData <@call> PrintStats <@call> ScanData( "dim_STAT" ) <@-- just read data till the end... --@> <@pclose> pp <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> <@end> <@end> <@-- ** Init setup ** --@> <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@call> GetInit <@if> !filled Timeout <@call> Usage( "Timeout is not filled!" ) <@-- ** Loop with User/Passwd/Host ** --@> <@if> !filled Host <@Host>= [$(env:Host)] <@if> !filled Host <@call> Usage( " is not filled!" ) <@if> !filled User <@User>= [$(env:User)] <@if> !filled User <@call> Usage( " is not filled!" ) <@if> !filled Passwd <@Passwd>= [$(env:Passwd)] <@if> !filled Passwd <@call> Usage( " is not filled!" ) <@X_BASE>= "@$(Host)" <@X_USER>= "$(User)" <@X_PASSWD>= "$(Passwd)" <@Fname>= /tmp/X_stat.$(X_PID) <@-- Setup SQL/Connection Error trap --@> <@sqltrap> OFF <@option> sql_trap function Trap_SQLERR <@while> <@if> !filled InnoQuery <@call> CheckDB <@ERR>= "" <@status>= "" <@if> filled InnoQuery <@sql> $(InnoQuery) <@end> <@if> filled ERR <@sqlexec> disconnect; <@InnoQuery>= "" <@end> <@end> <@file> $(Fname) $(status) <@end> <@fopen> pp $(Fname) "r" sst <@unlink> $(Fname) <@if> $(sst) != 0 <@call> Usage( [Cannot get InnoDB status] ) <@OnLine>= 1 <@call> GetData <@call> PrintStats <@fclose> pp <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 070701000077ef000081a40000000000000000000000013fbd1a8c00000973000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/x.jvmGC<@-- * * dim_STAT JVM GC monitor v.1.0 * (dim) --@> <@if> !filled Timeout <@error> ## Timeout is not filled... <@if> !filled logGC <@error> ## GC log file is not filled... <@function> ScanGC <@if> filled Reset <@MemMAX>= 0 <@MemMIN>= 0 <@MemAVG>= 0 <@MemCUR>= 0 <@Reset>= "" <@end> <@replace> buff "Full GC" "FullGC" <@replace> buff "K" "" <@replace> buff "->" " " <@replace> buff "(" " " <@replace> buff "[" "" <@replace> buff ")" " " <@replace> buff "]" "" <@replace> buff "," " " <@Time>= $(word:buff:5) <@Mem>= $(word:buff:2) <@MemCUR>= $(word:buff:3) <@MemFIX>= $(word:buff:4) <@if> icmp $(MemMAX) < $(Mem) <@MemMAX>= $(Mem) <@if> $(MemMIN) == 0 <@MemMIN>= $(MemCUR) <@if> icmp $(MemMIN) > $(MemCUR) <@MemMIN>= $(MemCUR) <@MemAVG>+= $(Mem) <@-- Buff:: $(buff) --@> <@if> buff vlike "*Full*" <@CountFGC>++ <@TimeFGC>= $(expr: $(TimeFGC) + $(Time)) <@else> <@CountGC>++ <@TimeGC>= $(expr: $(TimeGC) + $(Time)) <@end> <@end> <@function> PrintGC <@cnt>= $(expr: $(CountGC) + $(CountFGC)) <@if> $(cnt) != 0 <@MemAVG>= $(expr: $(MemAVG) / $(cnt)) <@TTimeFGC>= $(expr: $(TTimeFGC) + $(TimeFGC)) <@TTimeGC>= $(expr: $(TTimeGC) + $(TimeGC)) <@TCountFGC>+= $(CountFGC) <@TCountGC>+= $(CountGC) $(MemFIX) $(MemMAX) $(MemMIN) $(MemAVG) $(MemCUR) $(CountGC) $(TCountGC) $(TimeGC) $(TTimeGC) $(CountFGC) $(TCountFGC) $(TimeFGC) $(TTimeFGC) <@TimeGC>= 0 <@TimeFGC>= 0 <@CountGC>= 0 <@CountFGC>= 0 <@Reset>= yes <@-- reset values only in case we got some new GC info... --@> <@end> MemFIX MemMAX MemMIN MemAVG MemNOW GC-Calls GC-TotCalls GC-Time GC-TotTime FGC-Calls FGC-TotCalls FGC-Time FGC-TotTime <@NextDT>= $(X_DT) <@NextDT>+= $(Timeout) <@TimeGC>= 0 <@TimeFGC>= 0 <@TTimeGC>= 0 <@TTimeFGC>= 0 <@CountGC>= 0 <@CountFGC>= 0 <@TCountGC>= 0 <@TCountFGC>= 0 <@MemFIX>= 0 <@MemMAX>= 0 <@MemMIN>= 0 <@MemAVG>= 0 <@MemCUR>= 0 <@Sec>= $(expr: $(Timeout) / 3) <@if> $(Sec) == 0 <@Sec>= 1 <@popen> pp "/etc/STATsrv/bin/tailX $(logGC) $(Sec)" "r" sst <@if> $(sst) != 0 <@error> ## Cannot popen $(logGC)... <@while> <@fgets> pp buff 500 sst <@if> $(sst) != 0 <@break> <@if> buff vlike "*GC*sec*" <@call> ScanGC <@if> icmp $(X_DT) < $(NextDT) <@continue> <@NextDT>+= $(Timeout) <@call> PrintGC <@end> 070701000077f0000081a400000000000000000000000144638a0300000c83000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/x.jvmSTAT<@-- jvmstat v.2.0 wrapper by (dim) Apr-2004 v.3.1 May-2006 v.4.0 to keep a lot of JVM in parallel + jvmstat 3.0 / JDK 5.0 --@> <@function> Init_ENV <@NameMASK>= "$(env:NAME_MASK)" <@if> !filled NameMASK <@NameMASK>= "*" <@No>= 1 <@while> <@Replace>= "$(env:REPLACE_STR$(No))" <@if> !filled Replace <@break> <@Old_$(No)>= $(word:Replace:1) <@New_$(No)>= $(word:Replace:2) <@No>++ <@end> <@end> <@Vals>= "S0C S1C S0U S1U EC EU OC OU PC PU YGC YGCT FGC FGCT GCT" <@DeltaVals>= " YGC YGCT FGC FGCT GCT " <@function> showSTAT( Name, stats ) <@Numb>++ <@No>= 1 <@replace> stats "$(\t)" " " <@while> words Vals <@set> $(Vals) $(word:stats:$(No)) <@No>++ <@end> <@if> !filled $(Name)_GCT <@while> words DeltaVals <@set> $(Name)_$(DeltaVals) 0 <@end> <@end> <@GCT_tm>= $(expr: $(GCT) - $($(Name)_GCT)) <@if> $(GCT_tm) like "-*" <@GCT_tm>= $(GCT) <@while> words DeltaVals <@set> $(Name)_$(DeltaVals) 0 <@end> <@end> <@Line>= "$(Name)" <@while> words Vals <@if> DeltaVals vlike "* $(Vals) *" <@Line>;= " $(expr: $($(Vals)) - $($(Name)_$(Vals)))" <@continue> <@end> <@Line>;= " $($(Vals))" <@end> $(Line) $(expr: 100 * $(GCT_tm) / $(Timeout)) <@while> words DeltaVals <@set> $(Name)_$(DeltaVals) $($(DeltaVals)) <@end> <@end> <@function> newJVM( pid ) <@popen> pp_$(pid) "jstat -gc $(PID) $(TM) 100" "r" sst <@fgets> pp_$(pid) buff 500 sst <@fgets> pp_$(pid) buff 500 sst <@if> $(sst) != 0 <@return> -1 <@PPs>;= " $(pid) " <@return> 0 <@end> <@function> loadSTAT( pid ) <@PPa>;= " $(pid) " <@fgets> pp_$(pid) buff 500 sst <@if> $(sst) == 0 <@return> 0 <@pclose> pp_$(pid) <@replace> PPs " $(pid) " "" <@return> $(call:newJVM( $(pid) ) ) <@end> <@function> Recycle <@PP>= "$(PPs)" <@while> words PP <@if> PPa vlike "* $(PP) *" <@continue> <@replace> PPs " $(PP) " "" <@pclose> pp_$(PP) <@end> <@PPa>= "" <@end> <@chdir> $(DIR) <@if> !filled Timeout <@error> ## Timeout is not filled! <@TM>= $(expr: $(Timeout) * 900) <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@call> Init_ENV <@while> $(\n) JVM S0C S1C S0U S1U EC EU OC OU PC PU YGC YGCT FGC FGCT GCT GCT% <@popen> pp "jps" "r" sst <@Numb>= 0 <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@PID>= $(word:buff:1) <@Jcmd>= $(word:buff:2) <@if> "$(Jcmd)" == "Jps" <@continue> <@if> "$(Jcmd)" == "Jstat" <@continue> <@if> "$(Jcmd)" == "--" <@continue> <@if> "$(Jcmd)" !like "$(NameMASK)" <@continue> <@Nm>= "$(Jcmd)" <@No>= 1 <@while> <@if> !filled Old_$(No) <@break> <@replace> Nm "$(Old_$(No))" "$(New_$(No))" <@No>++ <@end> <@Nm>= $(cut:10:Nm) <@if> $(call:loadSTAT( $(PID) )) == 0 <@call> showSTAT( $(Nm)-$(PID), "$(buff)" ) <@end> <@pclose> pp <@call> Recycle none $(Numb) 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 070701000077f1000081a400000000000000000000000142553a31000003a2000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/x.killSTAT<@function> KillCHLDS( PID ) <@popen> pp_chlds$(PID) "ps -e -o pid,ppid" "r" sst <@if> $(sst) != 0 <@error> Cannot kill my child-process(es)... <@while> <@fgets> pp_chlds$(PID) buff 200 sst <@if> $(sst) != 0 <@break> <@if> "$(word:buff:2)" == $(PID) <@set> chld_$(PID) $(word:buff:1) <@call> KillCHLDS( $(chld_$(PID)) ) *** KILL: $(chld_$(PID)) --> $(PID) <@shell> kill $(chld_$(PID)) >/dev/null 2>&1; <@end> <@end> <@pclose> pp_chlds$(PID) <@end> <@if> !filled cmd <@error> ### cmd is not filled! * *==> KILLSTAT: $(cmd) * <@popen> pp "ps -e -o pid,args" "r" <@while> <@fgets> pp buff 200 sst <@if> $(sst) != 0 <@break> <@pid>= $(word:buff:1) <@if> "$(pid)" == $(X_PID) <@continue> <@if> buff vlike "*x.killSTAT*" <@continue> <@if> buff vlike "*$(cmd)*" *** KILL ==> $(buff) <@call> KillCHLDS( $(pid) ) <@shell> kill $(pid) >/dev/null 2>&1; <@end> <@end> <@pclose> pp 070701000077f2000081a40000000000000000000000014a97a8ef0000115d000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/x.mysqlLOAD<@-- (dim) MySQL Server LOAD stats -- oriented multi-host monitoring ** v.1.0 -- primary version Aug.2009 ** v.1.1 -- Aug.2009 : enforce disconnect in CheckDB !! --@> <@VER>= v.1.1 <@if> icmp $(X_VERSION)0 < 7300 <@error> You need WebX v.7.3 or higher to make work this code correctly.. <@-- stats/delta: --@> <@ValDelta>= "Aborted_clients Aborted_connects Connections Slow_queries Table_locks_waited Com_rollback" <@-- stats/sec: --@> <@ValSec>= "Bytes_received Bytes_sent Com_commit Com_delete Com_insert \ Com_select Com_update Innodb_data_fsyncs Innodb_data_reads Innodb_data_writes \ Innodb_log_writes Innodb_os_log_fsyncs Key_reads Key_writes Questions" <@-- stats val: --@> <@ValNumb>= "Threads_connected Innodb_buffer_pool_pages_dirty Innodb_buffer_pool_pages_free \ Key_blocks_not_flushed Open_files Open_tables" <@Header>= "On Sessions InnDirty InnoFree KeyDirty OpFiles OpTables \ ByteRx/s ByteTx/s Commit/s Delete/s Insert/s Select/s Update/s InnDsy/s InnDrd/s InnDwr/s InnLwr/s InnLsy/s Key_Rd/s Key_Wr/s Query/s AbrtClnt AbrtConn Connects SlowReqs TabLckWt Rollback" <@function> Trap_SQLERR <@ERR>= 1 <@end> <@function> CheckDB <@ERR>= "" <@sql> show databases; <@end> <@if> filled ERR <@sqlexec> disconnect; <@return> -1 <@end> <@sql> show global status; <@end> <@if> !filled ERR <@StatusQuery>= "show global status like" <@return> 0 <@end> <@ERR>= "" <@sql> show status; <@end> <@if> filled ERR <@return> -1 <@StatusQuery>= "show status like" <@return> 0 <@end> <@-- SetVal: diff => 0 - as it, 1 - diff, 2 - diff/sec --@> <@function> SetVal( name, diff, value ) <@-- DEBUG == Name: $(name) Value: $(value) (diff: $(diff)) --@> <@if> value vlike "-*" <@if> $(value) != -1 <@value>= -2 <@end> <@if> !filled $(name)_CURR <@set> $(name)_CURR "$(value)" <@set> $(name)_PREV "$(value)" <@add> AllStats "$(name)" <@end> <@set> $(name)_CURR $(value) <@if> $(diff) != 0 <@set> $(name) $(expr: $($(name)_CURR) - $($(name)_PREV)) <@set> $(name)_PREV $($(name)_CURR) <@if> $(name) vlike "-*" <@set> $(name) 0 <@if> $(diff) == 2 <@set> $(name) $(expr: $($(name)) / $(Timeout).0) <@else> <@set> $(name) $(value) <@end> <@end> <@function> PrintStats <@Line>= " $(OnLine) " <@while> values AllStats <@Line>;= "$(printf:%8.2f:$(AllStats)) " <@end> $(Line) <@end> <@function> GetData <@ERR>= "" <@OnLine>= 0 <@while> words ValNumb <@value>= "" <@sql> $(StatusQuery) '$(ValNumb)'; <@end> <@if> !filled value <@value>= -1 <@call> SetVal( "$(ValNumb)", 0, $(value) ) <@end> <@while> words ValSec <@value>= "" <@sql> $(StatusQuery) '$(ValSec)'; <@end> <@if> !filled value <@value>= -1 <@call> SetVal( "$(ValSec)", 2, $(value) ) <@end> <@while> words ValDelta <@value>= "" <@sql> $(StatusQuery) '$(ValDelta)'; <@end> <@if> !filled value <@value>= -1 <@call> SetVal( "$(ValDelta)", 1, $(value) ) <@end> <@if> filled ERR <@sqlexec> disconnect; <@StatusQuery>= "" <@else> <@OnLine>= 1 <@end> <@end> <@function> Usage( err ) $(\n)mysqlLOAD (dim) $(VER) ## ERROR: $(err) $(\n) Usage: $ WebX.mySQL5 $(X_PAGE) -Timeout N -Host server:port -User user -Passwd password NOTE: values also may be given as env variables Example: $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat -Passwd SecretPass or: $ Passwd=SecretPass $ export Passwd $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat <@quit> <@end> <@-- ** Init setup ** --@> <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@if> !filled Timeout <@call> Usage( "Timeout is not filled!" ) <@if> !filled Host <@Host>= [$(env:Host)] <@if> !filled Host <@call> Usage( " is not filled!" ) <@if> !filled User <@User>= [$(env:User)] <@if> !filled User <@call> Usage( " is not filled!" ) <@if> !filled Passwd <@Passwd>= [$(env:Passwd)] <@if> !filled Passwd <@call> Usage( " is not filled!" ) <@X_BASE>= "@$(Host)" <@X_USER>= "$(User)" <@X_PASSWD>= "$(Passwd)" <@OnLine>= 0 <@-- Setup SQL/Connection Error trap --@> <@sqltrap> OFF <@option> sql_trap function Trap_SQLERR <@-- ** Main Loop ** --@> $(Header) <@while> <@if> !filled StatusQuery <@call> CheckDB <@call> GetData <@call> PrintStats <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 070701000077f4000081a40000000000000000000000014a97a86400001012000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/x.mysqlSTAT<@-- (dim) MySQL Server stats ** v.1.0 -- primary version Mar.2009 ** v.1.1 -- added "delta" ** v.1.2 -- fix error/disconnect traps!! Apr.2009 ** v.1.3 -- StatusQuery, OnLine fixes.. ** v.1.4 -- fixed WebX version req. ** v.1.5 -- disconnect on error and recheck status query syntax!! ** v.1.6 -- Aug.2009 : enforced disconnect in CheckDB too !! --@> <@VER>= v.1.6 <@if> icmp $(X_VERSION)0 < 7300 <@error> You need WebX v.7.3 or higher to make work this code correctly.. <@function> Trap_SQLERR <@ERR>= 1 <@end> <@function> CheckDB <@ERR>= "" <@sql> show databases; <@end> <@if> filled ERR <@sqlexec> disconnect; <@return> -1 <@end> <@sql> show global status; <@end> <@if> !filled ERR <@StatusQuery>= "show global status;" <@return> 0 <@end> <@ERR>= "" <@sql> show status; <@end> <@if> filled ERR <@return> -1 <@StatusQuery>= "show status;" <@return> 0 <@end> <@function> PrintLine( name, val ) $(printf:%-40s:name) $(val) <@end> <@function> SetVal( name, diff, desc, value ) <@if> value vlike "-*" <@if> $(value) != -1 <@value>= -2 <@end> <@if> !filled $(name)_NAME <@set> $(name)_NAME "$(desc)" <@set> $(name)_DIFF "$(diff)" <@add> AllStats "$(name)" <@end> <@set> $(name) $(value) <@end> <@function> PrintStats <@call> PrintLine( $(\n)STAT-name, STAT-value ) <@call> PrintLine( db-server-online, $(OnLine) ) <@while> values AllStats <@if> "$($(AllStats)_DIFF)" != 1 <@call> PrintLine( "$($(AllStats)_NAME)", $($(AllStats)) ) <@continue> <@end> <@call> PrintLine( "$($(AllStats)_NAME)", $($(AllStats)) ) <@if> !filled $(AllStats)_prev <@set> $(AllStats)_prev $($(AllStats)) <@if> $(expr: $($(AllStats)) - $($(AllStats)_prev) - 0.0) like "-*" <@set> $(AllStats)_prev $($(AllStats)) <@call> PrintLine( "$($(AllStats)_NAME)/delta", $(expr: ($($(AllStats)) - $($(AllStats)_prev)) ) ) <@call> PrintLine( "$($(AllStats)_NAME)/sec", $(expr: ($($(AllStats)) - $($(AllStats)_prev))/$(Timeout).0 ) ) <@set> $(AllStats)_prev $($(AllStats)) <@end> <@end> <@function> GetData <@ERR>= "" <@OnLine>= 0 <@sql> $(StatusQuery) <@if> !filled value <@continue> <@if> fmt value float <@call> SetVal( "$(variable_name)", 1, "$(variable_name)", $(value) ) <@continue> <@end> <@if> "$(value)" == OFF <@call> SetVal( "$(variable_name)", 0, "$(variable_name)", 0 ) <@continue> <@end> <@if> "$(value)" == ON <@call> SetVal( "$(variable_name)", 0, "$(variable_name)", 1 ) <@continue> <@end> <@call> SetVal( "$(variable_name)", 0, "$(variable_name)", -1 ) <@end> <@if> filled ERR <@sqlexec> disconnect; <@StatusQuery>= "" <@else> <@OnLine>= 1 <@end> <@end> <@function> Usage( err ) $(\n)mysqlSTAT (dim) $(VER) ## ERROR: $(err) $(\n) Usage: $ WebX.mySQL5 $(X_PAGE) -Timeout N -Host server:port -User user -Passwd password NOTE: values also may be given as env variables Example: $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat -Passwd SecretPass or: $ Passwd=SecretPass $ export Passwd $ WebX.mySQL5 $(X_PAGE) -Timeout 10 -Host dbhost:5123 -User stat <@quit> <@end> <@-- ** Init setup ** --@> <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@if> !filled Timeout <@call> Usage( "Timeout is not filled!" ) <@if> !filled Host <@Host>= [$(env:Host)] <@if> !filled Host <@call> Usage( " is not filled!" ) <@if> !filled User <@User>= [$(env:User)] <@if> !filled User <@call> Usage( " is not filled!" ) <@if> !filled Passwd <@Passwd>= [$(env:Passwd)] <@if> !filled Passwd <@call> Usage( " is not filled!" ) <@X_BASE>= "@$(Host)" <@X_USER>= "$(User)" <@X_PASSWD>= "$(Passwd)" <@OnLine>= 0 <@-- Setup SQL/Connection Error trap --@> <@sqltrap> OFF <@option> sql_trap function Trap_SQLERR <@-- ** Main Loop ** --@> <@while> <@if> !filled StatusQuery <@call> CheckDB <@if> filled StatusQuery <@call> GetData <@call> PrintStats <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 070701000077f5000081a4000000000000000000000001486d08520000065a000000200000001d00000000000000000000001e00000000root/etc/STATsrv/bin/x.oraENQ<@-- Global params --@> <@Vals>= 7 <@Empty>= "none 0 0 0 0 0 0$(\n)" <@function> getSTAT <@Names>= "" <@popen> pp { su - $(oraUSER) -c "sqlplus /nolog @/etc/STATsrv/bin/oraENQ.sql" } "r" sst <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> buff vlike "*SQL*Plus*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> buff vlike "*----*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> icmp $(len:buff) < 5 <@break> <@replace> buff "$(\t)" " " <@Name>= $(word:buff:2) <@Names>;= " $(Name)" <@no>= 3 <@while> <@set> $(Name)_Val$(no) $(word:buff:$(no)) <@if> !filled $(Name)_Val$(no)_prev <@set> $(Name)_Val$(no)_prev $(word:buff:$(no)) <@if> icmp $($(Name)_Val$(no)) < $($(Name)_Val$(no)_prev) <@set> $(Name)_Val$(no)_prev $($(Name)_Val$(no)) <@if> $(no) == $(Vals) <@break> <@no>++ <@end> <@end> <@pclose> pp <@end> <@chdir> $(DIR) <@if> !filled Timeout <@Timeout>= 10 <@if> !filled oraUSER <@oraUSER>= oracle <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@while> EQ-Name REQ-Tot# Waits REQ-Ok# REQ-Err# WaitTM <@call> getSTAT <@while> words Names <@Line>= "$(Names) " <@no>= 3 <@while> <@Line>;= " $(expr: ($($(Names)_Val$(no)) - $($(Names)_Val$(no)_prev)))" <@set> $(Names)_Val$(no)_prev $($(Names)_Val$(no)) <@if> $(no) == $(Vals) <@break> <@no>++ <@end> $(Line) <@end> $(Empty) <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 07070100007825000081a4000000000000000000000001486d082a0000076d000000200000001d00000000000000000000001f00000000root/etc/STATsrv/bin/x.oraEXEC<@function> getSTAT <@buff>= "0 0 0 0 0 0 0 0" <@popen> pp { su - $(oraUSER) -c "sqlplus /nolog @/etc/STATsrv/bin/oraexec.sql" } "r" sst <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*SQL*Plus*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*----*" <@break> <@end> <@fgets> pp commits 400 sst <@fgets> pp execs 400 sst <@replace> commits "$(\t)" " " <@replace> execs "$(\t)" " " <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*----*" <@break> <@end> <@fgets> pp sessions 400 sst <@if> $(sst) == 0 <@replace> sessions "$(\t)" " " <@buff>= "$(commits) $(execs) $(sessions)" <@end> <@while> <@fgets> pp trash 400 sst <@if> $(sst) != 0 <@break> <@end> <@pclose> pp <@if> {$(buff)} like "*[A-Za-z]*" <@buff>= "0 0 0 0 0 0 0" <@return> "$(buff)" <@end> <@chdir> $(DIR) <@Data>= {$(call:getSTAT)} <@no>= 1 <@if> !filled Timeout <@Timeout>= 10 <@if> !filled oraUSER <@oraUSER>= oracle <@while> words Data <@set> Val$(no) $(Data) <@set> Val$(no)_prev $(Data) <@if> $(no) == 2 <@break> <@no>++ <@end> <@Vnumb>= $(no) Commit/sec CommitsTot Exec/s ExecTot Sessions <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@while> <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@Data>= {$(call:getSTAT)} <@no>= 1 <@while> words Data <@set> Val$(no) $(Data) <@if> $(no) == 2 <@break> <@no>++ <@end> <@Line>= "" <@no>= 1 <@while> <@if> icmp $(Val$(no)) < $(Val$(no)_prev) <@set> Val$(no)_prev $(Val$(no)) <@Line>;= " $(expr: ($(Val$(no)) - $(Val$(no)_prev)) / $(Timeout).0 ) $(Val$(no))" <@set> Val$(no)_prev $(Val$(no)) <@if> $(no) == $(Vnumb) <@break> <@no>++ <@end> $(Line) $(word:Data:3) <@end> 07070100007826000081a4000000000000000000000001486d08a600000933000000200000001d00000000000000000000001d00000000root/etc/STATsrv/bin/x.oraIO<@function> getFname( fullname, fname ) <@replace> fullname "/" " " <@while> words fullname <@fname>= $(fullname) <@end> <@return> $(fname) <@end> <@function> ActiveFILE <@if> $(pbR) != $(CNT_$(Name)_pbR) <@return> 0 <@if> $(pbW) != $(CNT_$(Name)_pbW) <@return> 0 <@if> $(pbRS) != $(CNT_$(Name)_pbRS) <@return> 0 <@if> $(pbWS) != $(CNT_$(Name)_pbWS) <@return> 0 <@return> -1 <@end> <@function> getFSTAT <@popen> pp { su - $(oraUSER) -c "sqlplus /nolog @/etc/STATsrv/bin/oraio.sql 2>&1" } "r" sst <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*SQL*Plus*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} !like "/*/*" <@continue> <@replace> buff "$(\t)" " " <@Name>= $(word:buff:1) <@Name>= $(call:getFname( $(Name) )) <@pbR>= $(word:buff:2) <@pbW>= $(word:buff:3) <@pbRS>= $(word:buff:4) <@pbWS>= $(word:buff:5) <@if> !filled CNT_$(Name) <@set> CNT_$(Name) yes <@set> CNT_$(Name)_pbR 0 <@set> CNT_$(Name)_pbW 0 <@set> CNT_$(Name)_pbRS 0 <@set> CNT_$(Name)_pbWS 0 <@end> <@if> $(call:ActiveFILE) != 0 <@continue> <@Line>= {$(Name) \ $(expr: ( $(pbR) - $(CNT_$(Name)_pbR) )/$(Timeout).0) \ $(expr: ( $(pbW) - $(CNT_$(Name)_pbW) )/$(Timeout).0) \ $(expr: ( $(pbR) + $(pbW) - $(CNT_$(Name)_pbR) - $(CNT_$(Name)_pbW) )/$(Timeout).0) \ $(expr: $(pbR) + $(pbW) ) \ $(expr: ( $(pbRS) - $(CNT_$(Name)_pbRS) )/$(Timeout).0) \ $(expr: ( $(pbWS) - $(CNT_$(Name)_pbWS) )/$(Timeout).0) \ $(expr: ( $(pbRS) + $(pbWS) - $(CNT_$(Name)_pbRS) - $(CNT_$(Name)_pbWS) )/$(Timeout).0) \ $(expr: $(pbRS) + $(pbWS) ) } $(Line) <@set> CNT_$(Name)_pbR $(pbR) <@set> CNT_$(Name)_pbW $(pbW) <@set> CNT_$(Name)_pbRS $(pbRS <@set> CNT_$(Name)_pbWS $(pbWS) <@end> <@pclose> pp <@end> <@chdir> $(DIR) <@if> !filled Timeout <@error> ### Empty Timeout!!! <@if> !filled oraUSER <@oraUSER>= oracle <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@while> DATAFILE Rblk/sec Wblk/sec Blk/sec BLK Reads/sec Writes/sec IO/sec IOOPS zero.dbf 0 0 0 0 0 0 0 0 <@call> getFSTAT $(\n) <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 0707010000782b000081a4000000000000000000000001486d08b500000643000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/x.oraLATCH<@function> getFSTAT <@buff>= "0 0 0 0" <@popen> pp { su - $(oraUSER) -c "sqlplus /nolog @/etc/STATsrv/bin/oralatch.sql" } "r" sst <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*SQL*Plus*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*----*" <@break> <@end> <@fgets> pp buff 400 sst <@if> $(sst) == 0 <@replace> buff "$(\t)" " " <@replace> buff " ." "0." <@replace> buff " ," "0." <@replace> buff "," "." <@end> <@pclose> pp <@if> {$(buff)} like "*[A-z]*" <@buff>= "0 0 0 0" <@return> "$(buff)" <@end> <@chdir> $(DIR) <@Data>= {$(call:getFSTAT)} <@no>= 1 <@if> !filled Timeout <@Timeout>= 10 <@if> !filled oraUSER <@oraUSER>= oracle <@while> words Data <@set> Val$(no) $(Data) <@set> Val$(no)_prev $(Data) <@if> $(no) == 3 <@break> <@no>++ <@end> <@Vnumb>= $(no) Waits/sec WaitsTot Touts/s ToutsTot Twaited/s TwaitedTot AvgWait <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@while> <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@Data>= {$(call:getFSTAT)} <@no>= 1 <@while> words Data <@set> Val$(no) $(Data) <@if> $(no) == 3 <@break> <@no>++ <@end> <@Line>= "" <@no>= 1 <@while> <@if> icmp $(Val$(no)) < $(Val$(no)_prev) <@set> Val$(no)_prev $(Val$(no)) <@Line>;= " $(expr: ($(Val$(no)) - $(Val$(no)_prev)) / $(Timeout).0 ) $(Val$(no))" <@set> Val$(no)_prev $(Val$(no)) <@if> $(no) == $(Vnumb) <@break> <@no>++ <@end> $(Line) $(word:Data:4) <@end> 0707010000782d000081a4000000000000000000000001486d08e1000007fb000000200000001d00000000000000000000002000000000root/etc/STATsrv/bin/x.oraSLEEP<@-- Global params --@> <@Vals>= 5 <@Empty>= "none 0 0 0 0 0 0$(\n)" <@function> getSTAT <@Names>= "" <@popen> pp { su - $(oraUSER) -c "sqlplus /nolog @/etc/STATsrv/bin/oravlatch.sql | head -15" } "r" sst <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> {$(buff)} like "*SQL*Plus*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> buff vlike "*SLEEP*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> buff vlike "*----*" <@break> <@end> <@while> <@fgets> pp buff 400 sst <@if> $(sst) != 0 <@break> <@if> icmp $(len:buff) < 10 <@continue> <@replace> buff "$(\t)" " " <@-- <@replace> buff " ." "0." <@replace> buff " ," "0." <@replace> buff "," "." --@> <@Name>= $(word:buff:$(expr:$(Vals)+1))_$(word:buff:$(expr:$(Vals)+2))_$(word:buff:$(expr:$(Vals)+3)) <@if> $(Name) == "__" <@continue> <@Names>;= " $(Name)" <@no>= 1 <@while> <@set> $(Name)_Val$(no) $(word:buff:$(no)) <@if> !filled $(Name)_Val$(no)_prev <@set> $(Name)_Val$(no)_prev $(word:buff:$(no)) <@if> icmp $($(Name)_Val$(no)) < $($(Name)_Val$(no)_prev) <@set> $(Name)_Val$(no)_prev $($(Name)_Val$(no)) <@if> $(no) == $(Vals) <@break> <@no>++ <@end> <@end> <@pclose> pp <@end> <@chdir> $(DIR) <@if> !filled Timeout <@Timeout>= 10 <@if> !filled oraUSER <@oraUSER>= oracle <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@while> Name SleepsTot Sleeps/sec Sleep1/sec Sleep2/sec Sleep3/sec Sleep4/sec <@call> getSTAT <@while> words Names <@Line>= "$(Names) $($(Names)_Val1)" <@no>= 1 <@while> <@Line>;= " $(expr: ($($(Names)_Val$(no)) - $($(Names)_Val$(no)_prev)) / $(Timeout).0 )" <@set> $(Names)_Val$(no)_prev $($(Names)_Val$(no)) <@if> $(no) == $(Vals) <@break> <@no>++ <@end> $(Line) <@end> $(Empty) <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 07070100007830000081a40000000000000000000000014a93bb2b00000dd8000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/x.pgsqlLOAD<@-- (dim) PostgreSQL Server LOAD stats -- single line, multi-host oriented ==> useful info: http://www.westnet.com/~gsmith/content/postgresql/chkp-bgw-83.htm ** v.1.0 -- primary version May.2009 ** v.1.1 -- improved version Aug.2009 --@> <@VER>= v.1.1 <@if> icmp $(X_VERSION)0 < 7300 <@error> You need WebX v.7.3 or higher to make work this code correctly.. <@function> Trap_SQLERR <@ERR>= 1 <@end> <@BGWval>= "checkpoints_timed checkpoints_req buffers_checkpoint buffers_clean maxwritten_clean buffers_backend buffers_alloc" <@DBAval>= "numbackends xact_commit xact_rollback blks_read blks_hit tup_returned tup_fetched tup_inserted tup_updated tup_deleted" <@Header>= "On Sessions Commit/s Rollback B_Read/s B_hit/s RowSnd/s RowFch/s RowIns/s RowUpd/s RowDel/s ChpTimed ChptReqs BuffChpt BufClean MxWClean BufBkend BufAlloc" <@-- SetVal: diff => 0 - as it, 1 - diff, 2 - diff/sec --@> <@function> SetVal( name, diff, value ) <@if> value vlike "-*" <@if> $(value) != -1 <@value>= -2 <@end> <@if> !filled $(name)_CURR <@set> $(name)_CURR "$(value)" <@set> $(name)_PREV "$(value)" <@add> AllStats "$(name)" <@end> <@set> $(name)_CURR $(value) <@if> $(diff) != 0 <@set> $(name) $(expr: $($(name)_CURR) - $($(name)_PREV)) <@set> $(name)_PREV $($(name)_CURR) <@if> $(name) vlike "-*" <@set> $(name) 0 <@if> $(diff) == 2 <@set> $(name) $(expr: $($(name)) / $(Timeout).0) <@else> <@set> $(name) $(value) <@end> <@end> <@function> PrintStats <@Line>= " $(OnLine) " <@while> values AllStats <@Line>;= "$(printf:%8.2f:$(AllStats)) " <@end> $(Line) <@end> <@function> GetData <@ERR>= "" <@OnLine>= 0 <@sqlexec> begin; <@while> words DBAval <@sql> select sum( $(DBAval) ) as $(DBAval) from pg_catalog.pg_stat_database; <@end> <@if> !filled $(DBAval) <@set> $(DBAval) 0 <@Diff>= 2 <@if> $(DBAval) == numbackends <@Diff>= 0 <@if> $(DBAval) == xact_rollback <@Diff>= 1 <@call> SetVal( "$(DBAval)", $(Diff), $($(DBAval)) ) <@end> <@sql> select * from pg_catalog.pg_stat_bgwriter; <@while> words BGWval <@call> SetVal( "$(BGWval)", 1, $($(BGWval)) ) <@end> <@end> <@if> !filled ERR <@OnLine>= 1 <@sqlexec> disconnect; <@end> <@function> Usage( err ) $(\n)pgsqlLOAD (dim) $(VER) ## ERROR: $(err) $(\n) Usage: $ WebX.pgSQL $(X_PAGE) -Timeout N -DB dbname[@server[:port]] -User user -Passwd password NOTE: values also may be given as env variables Example: $ WebX.pgSQL $(X_PAGE) -Timeout 10 -DB postgres -User stat -Passwd SecretPass or: $ Passwd=SecretPass $ export Passwd $ WebX.pgSQL $(X_PAGE) -Timeout 10 -DB postgres@dbhost:5432 -User stat <@quit> <@end> <@-- ** Init setup ** --@> <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@if> !filled Timeout <@call> Usage( "Timeout is not filled!" ) <@if> !filled DB <@DB>= [$(env:DB)] <@if> !filled DB <@call> Usage( " is not filled!" ) <@if> !filled User <@User>= [$(env:User)] <@if> !filled User <@call> Usage( " is not filled!" ) <@if> !filled Passwd <@Passwd>= [$(env:Passwd)] <@if> !filled Passwd <@call> Usage( " is not filled!" ) <@X_BASE>= "$(DB)" <@X_USER>= "$(User)" <@X_PASSWD>= "$(Passwd)" <@OnLine>= 0 <@-- Setup SQL/Connection Error trap --@> <@sqltrap> OFF <@option> sql_trap function Trap_SQLERR <@-- <@html> OFF --@> <@-- ** Main Loop ** --@> $(Header) <@while> <@call> GetData <@call> PrintStats <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 07070100007831000081a40000000000000000000000014a01219400000d1f000000200000001d00000000000000000000002100000000root/etc/STATsrv/bin/x.pgsqlSTAT<@-- (dim) PostgreSQL Server stats ** v.1.0 -- primary version May.2009 ** v.1.1 -- added begin / disconnect --@> <@VER>= v.1.1 <@if> icmp $(X_VERSION)0 < 7300 <@error> You need WebX v.7.3 or higher to make work this code correctly.. <@function> Trap_SQLERR <@ERR>= 1 <@end> <@function> PrintLine( name, val ) $(printf:%-40s:name) $(val) <@end> <@function> SetVal( name, diff, desc, value ) <@if> value vlike "-*" <@if> $(value) != -1 <@value>= -2 <@end> <@if> !filled $(name)_NAME <@set> $(name)_NAME "$(desc)" <@set> $(name)_DIFF "$(diff)" <@add> AllStats "$(name)" <@end> <@set> $(name) $(value) <@end> <@function> PrintStats <@call> PrintLine( $(\n)STAT-name, STAT-value ) <@call> PrintLine( db-server-online, $(OnLine) ) <@while> values AllStats <@if> "$($(AllStats)_DIFF)" != 1 <@call> PrintLine( "$($(AllStats)_NAME)", $($(AllStats)) ) <@continue> <@end> <@call> PrintLine( "$($(AllStats)_NAME)", $($(AllStats)) ) <@if> !filled $(AllStats)_prev <@set> $(AllStats)_prev $($(AllStats)) <@if> $(expr: $($(AllStats)) - $($(AllStats)_prev) - 0.0) like "-*" <@set> $(AllStats)_prev $($(AllStats)) <@call> PrintLine( "$($(AllStats)_NAME)/delta", $(expr: ($($(AllStats)) - $($(AllStats)_prev)) ) ) <@call> PrintLine( "$($(AllStats)_NAME)/sec", $(expr: ($($(AllStats)) - $($(AllStats)_prev))/$(Timeout).0 ) ) <@set> $(AllStats)_prev $($(AllStats)) <@end> <@end> <@function> GetData <@ERR>= "" <@OnLine>= 0 <@sqlexec> begin; <@sql> select * from pg_catalog.pg_stat_bgwriter; <@while> words X_sqlnames ";" <@call> SetVal( "BGWR-$(X_sqlnames)", 1, "BGWR-$(X_sqlnames)", $($(X_sqlnames)) ) <@end> <@end> <@sql> select * from pg_catalog.pg_stat_database; <@while> words X_sqlnames ";" <@if> $(X_sqlnames) == datid <@continue> <@if> $(X_sqlnames) == datname <@continue> <@call> SetVal( "DB-$(upper:datname)-$(X_sqlnames)", 1, "DB-$(upper:datname)-$(X_sqlnames)", $($(X_sqlnames)) ) <@end> <@end> <@if> !filled ERR <@OnLine>= 1 <@sqlexec> disconnect; <@end> <@function> Usage( err ) $(\n)pgsqlSTAT (dim) $(VER) ## ERROR: $(err) $(\n) Usage: $ WebX.pgSQL $(X_PAGE) -Timeout N -DB dbname[@server[:port]] -User user -Passwd password NOTE: values also may be given as env variables Example: $ WebX.pgSQL $(X_PAGE) -Timeout 10 -DB postgres -User stat -Passwd SecretPass or: $ Passwd=SecretPass $ export Passwd $ WebX.pgSQL $(X_PAGE) -Timeout 10 -DB postgres@dbhost:5432 -User stat <@quit> <@end> <@-- ** Init setup ** --@> <@WakeUp>= $(X_DT) <@WakeUp>+= $(Timeout) <@if> !filled Timeout <@call> Usage( "Timeout is not filled!" ) <@if> !filled DB <@DB>= [$(env:DB)] <@if> !filled DB <@call> Usage( " is not filled!" ) <@if> !filled User <@User>= [$(env:User)] <@if> !filled User <@call> Usage( " is not filled!" ) <@if> !filled Passwd <@Passwd>= [$(env:Passwd)] <@if> !filled Passwd <@call> Usage( " is not filled!" ) <@X_BASE>= "$(DB)" <@X_USER>= "$(User)" <@X_PASSWD>= "$(Passwd)" <@OnLine>= 0 <@-- Setup SQL/Connection Error trap --@> <@sqltrap> OFF <@option> sql_trap function Trap_SQLERR <@-- ** Main Loop ** --@> <@while> <@call> GetData <@call> PrintStats <@sleep> $(expr: $(WakeUp) - $(X_DT)) <@WakeUp>+= $(Timeout) <@end> 07070100008880000041ed0000000000000000000000024bbc938300000000000000200000001d00000000000000000000001500000000root/etc/STATsrv/log07070100008881000081a40000000000000000000000013975dfc100000000000000200000001d00000000000000000000002000000000root/etc/STATsrv/log/access.log07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!